Basic Information | |
---|---|
Family ID | F070203 |
Family Type | Metagenome |
Number of Sequences | 123 |
Average Sequence Length | 41 residues |
Representative Sequence | YPSVADFMEAYTEKEIGGDSTKWDAYVTAYNKVRTDNPKP |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 95.93 % |
% of genes from short scaffolds (< 2000 bps) | 86.99 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.66 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (47.967 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (39.024 % of family members) |
Environment Ontology (ENVO) | Unclassified (86.992 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.309 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF03906 | Phage_T7_tail | 3.25 |
PF00386 | C1q | 2.44 |
PF16778 | Phage_tail_APC | 1.63 |
PF16945 | Phage_r1t_holin | 1.63 |
PF09335 | SNARE_assoc | 1.63 |
PF09636 | XkdW | 1.63 |
PF08291 | Peptidase_M15_3 | 0.81 |
PF11962 | Peptidase_G2 | 0.81 |
PF13385 | Laminin_G_3 | 0.81 |
PF00902 | TatC | 0.81 |
PF13759 | 2OG-FeII_Oxy_5 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.63 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.63 |
COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.29 % |
Unclassified | root | N/A | 31.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000949|BBAY94_10162578 | Not Available | 605 | Open in IMG/M |
3300001472|JGI24004J15324_10015271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203 | 2683 | Open in IMG/M |
3300001589|JGI24005J15628_10208858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 542 | Open in IMG/M |
3300002483|JGI25132J35274_1104423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC203P | 574 | Open in IMG/M |
3300002518|JGI25134J35505_10102777 | All Organisms → Viruses | 622 | Open in IMG/M |
3300005604|Ga0066852_10230960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 631 | Open in IMG/M |
3300006002|Ga0066368_10327159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aestuariivita → unclassified Aestuariivita → Aestuariivita sp. | 519 | Open in IMG/M |
3300006026|Ga0075478_10027739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1895 | Open in IMG/M |
3300006340|Ga0068503_10356525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1106 | Open in IMG/M |
3300006340|Ga0068503_10456411 | Not Available | 2461 | Open in IMG/M |
3300006340|Ga0068503_10960037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 610 | Open in IMG/M |
3300006414|Ga0099957_1565419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 628 | Open in IMG/M |
3300006735|Ga0098038_1092527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1049 | Open in IMG/M |
3300006738|Ga0098035_1034844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1892 | Open in IMG/M |
3300006738|Ga0098035_1114334 | Not Available | 933 | Open in IMG/M |
3300006750|Ga0098058_1074595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 934 | Open in IMG/M |
3300006750|Ga0098058_1087866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 848 | Open in IMG/M |
3300006750|Ga0098058_1130231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 670 | Open in IMG/M |
3300006754|Ga0098044_1002787 | Not Available | 8920 | Open in IMG/M |
3300006789|Ga0098054_1299540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 575 | Open in IMG/M |
3300006793|Ga0098055_1077672 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1308 | Open in IMG/M |
3300006928|Ga0098041_1246777 | Not Available | 569 | Open in IMG/M |
3300006929|Ga0098036_1183957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 636 | Open in IMG/M |
3300006929|Ga0098036_1220257 | Not Available | 575 | Open in IMG/M |
3300007755|Ga0105014_1050828 | Not Available | 1341 | Open in IMG/M |
3300008012|Ga0075480_10563865 | Not Available | 542 | Open in IMG/M |
3300008216|Ga0114898_1037025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 1604 | Open in IMG/M |
3300008217|Ga0114899_1017988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium | 2780 | Open in IMG/M |
3300008218|Ga0114904_1033920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1403 | Open in IMG/M |
3300008220|Ga0114910_1070944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1078 | Open in IMG/M |
3300009413|Ga0114902_1074677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 936 | Open in IMG/M |
3300009414|Ga0114909_1015101 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium | 2636 | Open in IMG/M |
3300009602|Ga0114900_1064727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1076 | Open in IMG/M |
3300009603|Ga0114911_1014688 | All Organisms → Viruses → Predicted Viral | 2726 | Open in IMG/M |
3300009603|Ga0114911_1072637 | Not Available | 1034 | Open in IMG/M |
3300009603|Ga0114911_1110334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 795 | Open in IMG/M |
3300009604|Ga0114901_1022398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium | 2438 | Open in IMG/M |
3300009604|Ga0114901_1051936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1411 | Open in IMG/M |
3300009604|Ga0114901_1224218 | Not Available | 534 | Open in IMG/M |
3300009605|Ga0114906_1072942 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1269 | Open in IMG/M |
3300009605|Ga0114906_1090431 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300009790|Ga0115012_10502024 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300010149|Ga0098049_1193990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 623 | Open in IMG/M |
3300010150|Ga0098056_1130722 | Not Available | 851 | Open in IMG/M |
3300010155|Ga0098047_10150474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 900 | Open in IMG/M |
3300010300|Ga0129351_1117460 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
3300010883|Ga0133547_11610103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1212 | Open in IMG/M |
3300010883|Ga0133547_11843270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 1116 | Open in IMG/M |
3300011013|Ga0114934_10251148 | Not Available | 806 | Open in IMG/M |
3300012953|Ga0163179_10510428 | Not Available | 995 | Open in IMG/M |
3300017720|Ga0181383_1182657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Aestuariivita → unclassified Aestuariivita → Aestuariivita sp. | 559 | Open in IMG/M |
3300017725|Ga0181398_1159212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 534 | Open in IMG/M |
3300017728|Ga0181419_1110967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 671 | Open in IMG/M |
3300017730|Ga0181417_1020081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1677 | Open in IMG/M |
3300017733|Ga0181426_1126151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 516 | Open in IMG/M |
3300017744|Ga0181397_1083842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 848 | Open in IMG/M |
3300017744|Ga0181397_1177843 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → environmental samples → uncultured Bacteroidetes bacterium | 537 | Open in IMG/M |
3300017756|Ga0181382_1118564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 706 | Open in IMG/M |
3300017757|Ga0181420_1213696 | Not Available | 556 | Open in IMG/M |
3300017771|Ga0181425_1224200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 585 | Open in IMG/M |
3300017775|Ga0181432_1176720 | Not Available | 664 | Open in IMG/M |
3300017775|Ga0181432_1221391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 595 | Open in IMG/M |
3300017776|Ga0181394_1118310 | Not Available | 837 | Open in IMG/M |
3300017776|Ga0181394_1140275 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 755 | Open in IMG/M |
3300017952|Ga0181583_10254613 | Not Available | 1131 | Open in IMG/M |
3300018421|Ga0181592_10138378 | Not Available | 1866 | Open in IMG/M |
3300018421|Ga0181592_10686622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 685 | Open in IMG/M |
3300018423|Ga0181593_11016885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 568 | Open in IMG/M |
3300019459|Ga0181562_10253143 | Not Available | 895 | Open in IMG/M |
3300020175|Ga0206124_10196612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 797 | Open in IMG/M |
3300020395|Ga0211705_10036125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1793 | Open in IMG/M |
3300020462|Ga0211546_10314327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 784 | Open in IMG/M |
3300020470|Ga0211543_10002027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED202 | 13397 | Open in IMG/M |
3300020471|Ga0211614_10258335 | Not Available | 760 | Open in IMG/M |
3300020477|Ga0211585_10080472 | All Organisms → Viruses → Predicted Viral | 2282 | Open in IMG/M |
3300020477|Ga0211585_10253427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1079 | Open in IMG/M |
3300021958|Ga0222718_10242214 | Not Available | 962 | Open in IMG/M |
3300022068|Ga0212021_1032862 | Not Available | 1018 | Open in IMG/M |
3300025069|Ga0207887_1012668 | Not Available | 1310 | Open in IMG/M |
3300025078|Ga0208668_1072301 | Not Available | 618 | Open in IMG/M |
3300025082|Ga0208156_1006836 | Not Available | 2938 | Open in IMG/M |
3300025097|Ga0208010_1029512 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
3300025101|Ga0208159_1040101 | All Organisms → Viruses | 1016 | Open in IMG/M |
3300025114|Ga0208433_1001553 | All Organisms → cellular organisms → Bacteria | 8311 | Open in IMG/M |
3300025114|Ga0208433_1033149 | Not Available | 1421 | Open in IMG/M |
3300025118|Ga0208790_1040238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1506 | Open in IMG/M |
3300025125|Ga0209644_1009423 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium | 2018 | Open in IMG/M |
3300025127|Ga0209348_1024886 | All Organisms → Viruses → Predicted Viral | 2198 | Open in IMG/M |
3300025128|Ga0208919_1121727 | Not Available | 827 | Open in IMG/M |
3300025131|Ga0209128_1075815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1143 | Open in IMG/M |
3300025131|Ga0209128_1196162 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 572 | Open in IMG/M |
3300025131|Ga0209128_1218078 | Not Available | 527 | Open in IMG/M |
3300025132|Ga0209232_1127290 | Not Available | 835 | Open in IMG/M |
3300025141|Ga0209756_1337852 | Not Available | 517 | Open in IMG/M |
3300025251|Ga0208182_1035192 | Not Available | 1118 | Open in IMG/M |
3300025251|Ga0208182_1079634 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 619 | Open in IMG/M |
3300025268|Ga0207894_1075368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 575 | Open in IMG/M |
3300025274|Ga0208183_1041340 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon SCG-AAA382B04 | 953 | Open in IMG/M |
3300025280|Ga0208449_1045512 | Not Available | 1200 | Open in IMG/M |
3300025282|Ga0208030_1052313 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
3300025296|Ga0208316_1104726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 500 | Open in IMG/M |
3300025301|Ga0208450_1131196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 525 | Open in IMG/M |
3300025751|Ga0208150_1046305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1491 | Open in IMG/M |
3300025853|Ga0208645_1053462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1909 | Open in IMG/M |
3300025853|Ga0208645_1195274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 722 | Open in IMG/M |
3300025873|Ga0209757_10012430 | Not Available | 2284 | Open in IMG/M |
3300025873|Ga0209757_10218646 | Not Available | 604 | Open in IMG/M |
3300026205|Ga0208406_1051018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1013 | Open in IMG/M |
3300026253|Ga0208879_1138196 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1000 | Open in IMG/M |
3300026258|Ga0208130_1159097 | Not Available | 600 | Open in IMG/M |
3300026262|Ga0207990_1119006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
3300028018|Ga0256381_1035682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 792 | Open in IMG/M |
3300028022|Ga0256382_1145198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 569 | Open in IMG/M |
3300028196|Ga0257114_1062876 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300029319|Ga0183748_1064732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 966 | Open in IMG/M |
3300029787|Ga0183757_1038030 | Not Available | 936 | Open in IMG/M |
3300031695|Ga0308016_10181338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 817 | Open in IMG/M |
3300031811|Ga0310125_10416659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 650 | Open in IMG/M |
3300032274|Ga0316203_1046452 | Not Available | 1252 | Open in IMG/M |
3300034375|Ga0348336_043551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1931 | Open in IMG/M |
3300034655|Ga0326746_030054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 569 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 39.02% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 18.70% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.38% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.50% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.69% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.06% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.44% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.44% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.81% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.81% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.81% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.81% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.81% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.81% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.81% |
Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.81% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.81% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.81% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
3300006002 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
3300006414 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500m | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300007755 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
3300026205 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF89A (SPAdes) | Environmental | Open in IMG/M |
3300026253 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes) | Environmental | Open in IMG/M |
3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
3300026262 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 (SPAdes) | Environmental | Open in IMG/M |
3300028018 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m | Environmental | Open in IMG/M |
3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
3300034655 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
BBAY94_101625781 | 3300000949 | Macroalgal Surface | EFAEAYTEKEFGGDSTKMDSYKIKYNKVRSDNPK* |
JGI24004J15324_100152711 | 3300001472 | Marine | IEYPSVQDFMEAYTEKEIGGDSTKWDAYETAYNKVRTDNPKD* |
JGI24005J15628_102088582 | 3300001589 | Marine | PSQKDFMEAYTEKEIGGDSTKWDAYKTAYNKVRTDNPKG* |
JGI25132J35274_11044232 | 3300002483 | Marine | RSIAYPSLKEFAEAYCEKEIGGNSTKWNEYVTKYNKVRTDNPKE* |
JGI25134J35505_100355401 | 3300002518 | Marine | EYARKRQAAYPSRADFMEAYTEKEIGGDSTKWDAYVINYNKVRTENPK* |
JGI25134J35505_101027771 | 3300002518 | Marine | ARDISYPNLKEFAEAYTEKEIGGDSTKWDAYVINYNKVRTDNPKE* |
Ga0066852_102309602 | 3300005604 | Marine | DDFMEAYTEKEIGGDSTKWDAYVIAYNKVRTDNPK* |
Ga0066368_103271591 | 3300006002 | Marine | SAYPDIKDFMEAYTEKEIGSDSTKWDAYVIAYNKVRTDNPK* |
Ga0075478_100277391 | 3300006026 | Aqueous | YPSTKEFMEAYTEKEIGGDSTKWDAYVVKYNQVRTDNPKPSG* |
Ga0068503_103565253 | 3300006340 | Marine | KDYPSIDDFMEAYTEKEIGSDSTKWDAYVIAYNKVRTDNPK* |
Ga0068503_104564111 | 3300006340 | Marine | LVNPNTEKEIGEDSTKWDAYVIAYNKVRSDNSKD* |
Ga0068503_109600373 | 3300006340 | Marine | YPSLKEFTEAYTEKEIGEDSTKWDAYVAKYNLVRSNNPKP* |
Ga0099957_15654192 | 3300006414 | Marine | PSVDDFMEAYTEKEIGSDSTKWDAYVIAYNKVRTDNPK* |
Ga0098038_10925271 | 3300006735 | Marine | TFQEFAEAYCEKEIGGDSTKWDAYKTAYNKVRTDNPKG* |
Ga0098035_10348443 | 3300006738 | Marine | MQYHDGVDNTRASEYPSTETFLEAYTEKEIGGDSTKWDAYVIAYNKVR |
Ga0098035_11143341 | 3300006738 | Marine | VEYPITTEFIEAYTEKEILNDDTKWNEYVSKYNQVRTDNPKE* |
Ga0098058_10745951 | 3300006750 | Marine | KDFMEAYTEKEIGGDSTKWDTYVVAYNKVRTDNPKP* |
Ga0098058_10878661 | 3300006750 | Marine | ARARDISYPNLKEFAEAYTEKEIGGDSTKWDAYVINYNKVRTENPK* |
Ga0098058_11302311 | 3300006750 | Marine | ASAYPNVNDFMEAYTEKEIGGDATKWDEYVVKYNKVRTDNPK* |
Ga0098044_100278720 | 3300006754 | Marine | HDGVDNTRASEYPSTETFLEAYTEKEIGGDSTKWDAYVIAYNKVRADNPK* |
Ga0098054_12995401 | 3300006789 | Marine | KYDAQDYARNRQKEYPVITEFLEAYTEKEIGGDSTKWDAYIIKYNKTRSDNPKG* |
Ga0098055_10776723 | 3300006793 | Marine | MEAYTEKEIGGDETKWNEYKTKYNKVRTDNPKESS* |
Ga0098041_12467771 | 3300006928 | Marine | RSRDTQYPSLKEFAEAYCEKEIGGDTTKWDEYVVKYNKVRTDNPK* |
Ga0098036_11658112 | 3300006929 | Marine | GYARKRAEEYPSIQDFMEAYTEKEIGGDSTKWDSYKTKYNKVRSDNPKS* |
Ga0098036_11839573 | 3300006929 | Marine | MQYHDGVDNTRASEYPSTETFLEAYTEKEIGGDSTKWDAYVIAYNKVRADNPK* |
Ga0098036_12202573 | 3300006929 | Marine | FMEAYTEKEIGGSSTKWDAYKTAYNKVRTDNPKG* |
Ga0105014_10508283 | 3300007755 | Marine | YPSVADFMEAYTEKEIGGDSTKWDAYVTAYNKVRTDNPKP* |
Ga0075480_105638652 | 3300008012 | Aqueous | YPSMVEFIEAYTEKEILDNSTKWDEYVVKYNEVRTDYPKPS* |
Ga0114898_10370252 | 3300008216 | Deep Ocean | EGEYPSTKDFMEAYTEKEIGGNSAKWDAYVINYDKVRTENPK* |
Ga0114899_10179888 | 3300008217 | Deep Ocean | HWREFMEAYTEKEFGGDSTKMDAYKIKYEKVRSDNPK* |
Ga0114904_10339204 | 3300008218 | Deep Ocean | PSTKDFMEAYTEKEIGGSSGKWDAYVINYNKVRSDNPK* |
Ga0114910_10709441 | 3300008220 | Deep Ocean | ARARKTAYPVTKDFIEAYTEKEIGGDSTKWDAYIVKYNKVRNDNPKG* |
Ga0114902_10746772 | 3300009413 | Deep Ocean | DKEYPKVKEFMEAYTEKEIGDDSTKWDAYVIKYNKVRTENPK* |
Ga0114909_10151016 | 3300009414 | Deep Ocean | ARDISYPSLNEFAEAYTEKEIGGDSTKWDAYVINYNKVRTENPK* |
Ga0114900_10647271 | 3300009602 | Deep Ocean | SYPNLKEFAEAYTEKEIGGDDTKWNEYVTKYNKVRTDNPKG* |
Ga0114911_10146881 | 3300009603 | Deep Ocean | EYPSLQEFAEAYCEKEIGGDSTKWDTYKTAYNKVRSDNPKG* |
Ga0114911_10726371 | 3300009603 | Deep Ocean | PQLREFLEAYTEKEIGGDSTKWDAYVVKYNKVRSDNPKP* |
Ga0114911_11103341 | 3300009603 | Deep Ocean | PSVQDFMEAYTEKEIGGDSTKWDAYKTAYNKVRTDNPKE* |
Ga0114901_10223981 | 3300009604 | Deep Ocean | EFLEAYTEKEIGGDSTKWDAYVVKYNKVRSDNPKP* |
Ga0114901_10519361 | 3300009604 | Deep Ocean | PSTKAFMEAYTEKEIGGSSGKWDAYAINYNKVRSDNPK* |
Ga0114901_12242182 | 3300009604 | Deep Ocean | PNVDEFMEAYTEKEILADTTKWDEHVIKYNKVRTDNPK* |
Ga0114906_10729421 | 3300009605 | Deep Ocean | RGGEYPSTKDFMEAYTEKEIGGSSGKWDAYVINYNKVRSDNPK* |
Ga0114906_10904313 | 3300009605 | Deep Ocean | SEYPSTKDFMEAYTEKEIGGSSGKWDAYVINYNKVRSDNPK* |
Ga0115012_105020243 | 3300009790 | Marine | RARALAYPSLSEFVEAYTEKEIGEDSTKWDAYVVKYNQVREDNPKE* |
Ga0098049_11939902 | 3300010149 | Marine | STKDFMEAYTEKEIGGNSTKWDAYVTKYNKVRTDNPK* |
Ga0098056_11307223 | 3300010150 | Marine | SLKEFAEAYTEKEIGADTTKWDEYVIKYNKVRTDNPK* |
Ga0098047_101504741 | 3300010155 | Marine | REGEYPPTKDFMEAYTEKEIGGDSTKWDAYVINYNKVRTENPK* |
Ga0129351_11174601 | 3300010300 | Freshwater To Marine Saline Gradient | AEYPSLQEFAEAYCEKEIGGSSTKWDAYKTAYNKVRTDNPKE* |
Ga0133547_116101031 | 3300010883 | Marine | AYPPIQDFMEAYTEKEIGSVSTKWDAYVTAYNKVRTDNPK* |
Ga0133547_118432701 | 3300010883 | Marine | DFMEAYTEKEIDSNSSKWDAYVINRNKVRTDNPK* |
Ga0114934_102511481 | 3300011013 | Deep Subsurface | FAEAYCEKEIGGDSTKWDTYKTAYNKVRSDNPKG* |
Ga0163179_105104281 | 3300012953 | Seawater | YARKRAKSYPSMLEFIEAYTEKEIGGDTTKWDEYVVKYNKVRTDNPK* |
Ga0181383_11826571 | 3300017720 | Seawater | IEYPSLKEFAEAYCEKEIGGDSTKWNAYKTAYNKVRTDNPKE |
Ga0181398_11592122 | 3300017725 | Seawater | DFMEAYTEKEIGGNSTKWDAYKTAYNKVRTDNPKG |
Ga0181419_11109671 | 3300017728 | Seawater | IEYPSLKEFTEAYCEKEIGGDSKKWNAYKIAYNKVRTDNPKK |
Ga0181417_10200814 | 3300017730 | Seawater | LQEFAEAYCEKEIGSDSTKWDAYKTAYNKVRTDNPKG |
Ga0181426_11261511 | 3300017733 | Seawater | KEFAEAYCEKEIGEDSTKWDAYKTAYNKVRSDNPKG |
Ga0181397_10838421 | 3300017744 | Seawater | REWQYPNLKEFAEAYCEKEINNDNTKWNEYVAKYNNVRTTFPKP |
Ga0181397_11778432 | 3300017744 | Seawater | PNEYKDKRVKQYPNILEFIEAYTEKEIGGDDTKWNEYKTKYNKVRTDNPKS |
Ga0181382_11185642 | 3300017756 | Seawater | EYPSLKEFAEAYCEKEIGEDSTKWDAYKTAYNKVRSDNPKG |
Ga0181420_12136961 | 3300017757 | Seawater | DFMEAYTEKEIGSSSTKWDAYVTAYNKVRSDNPKP |
Ga0181425_12242001 | 3300017771 | Seawater | PSLQEFAEAYCEKEIGGSSTKWDAYKTAYNKVRTDNPKE |
Ga0181432_11767201 | 3300017775 | Seawater | VTKEFIEAYTEKEIDGDSTKWDAYVIKRNKVRTDNPK |
Ga0181432_12213912 | 3300017775 | Seawater | AEVYKRKRHIEYPAKVEFIEAWTEKEIGGDDTKWNEYVTKYNKVRSDNSK |
Ga0181394_11183101 | 3300017776 | Seawater | EFAEAYCEKEIGEDSTKWDAYKTAYNKVRSDNPKG |
Ga0181394_11402751 | 3300017776 | Seawater | RKRAIEYPSTKDFMEAYTEKEIGSNSTKWDAYVTKYNKVRTENPKS |
Ga0181583_102546134 | 3300017952 | Salt Marsh | MIEFIEAYTEKEILADSTKWDAYVVKYNQVRTDFPKPS |
Ga0181592_101383786 | 3300018421 | Salt Marsh | ALNYPPMIEFIEAYTEKEIFADSTKWDAYVVKYNQVRTDFPKPS |
Ga0181592_106866223 | 3300018421 | Salt Marsh | ALAYPLTIEFIEAYTEKEILGNSTKWDAYVEKYNQVRTDYPKP |
Ga0181593_110168853 | 3300018423 | Salt Marsh | PLTIEFIEAYTEKEILGNSTKWDAYVEKYNQVRTDYPKP |
Ga0181562_102531432 | 3300019459 | Salt Marsh | SRKRNQSYPSLKEFAEAYCEKEIGGDSTKWNEYVVKYNKVRTDNPK |
Ga0206124_101966122 | 3300020175 | Seawater | KMARAFAYPSIREFIEAYTEKEIGEDTTKWDAYVVKYNQVRTDNPKPSE |
Ga0211705_100361254 | 3300020395 | Marine | IRIFMEAYTEKEIGGDNTKWDAYKAAYNKVRTDNPKE |
Ga0211546_103143271 | 3300020462 | Marine | FVEAYTEKEIGEDSTKWDAYVVKYNQVRTDNPKXVL |
Ga0211543_100020271 | 3300020470 | Marine | SLSEFVEAYTEKEIGEDSTKWDAYVVKYNQVREDNPKE |
Ga0211614_102583352 | 3300020471 | Marine | YPSLQEFAEAYCEKEIGADTTKWDEYVVKYNKVRTDNPK |
Ga0211585_100804725 | 3300020477 | Marine | KRAEEYPSLKEFAEAYCEKEIGGDDTKWNEYKTKYNKVRTNNPKESS |
Ga0211585_102534271 | 3300020477 | Marine | DGQDYARKRAEEYPSLKEFAEAYCEKEIIKDSTKWDSYKTKYNQVRNDNPKE |
Ga0222718_102422143 | 3300021958 | Estuarine Water | ARAEAYPSVADFMEAYTEKEIGSSSTKWDAYVTAYNKVRSDNPKP |
Ga0212021_10328621 | 3300022068 | Aqueous | SFIEAYTEKEILGVSEKWDAYVVDYNQVRSDNPKPS |
Ga0207887_10126684 | 3300025069 | Marine | YARARAVAYPSTPDFMEAYTEKEIGGDSTKWDAYIINYNKVRTDNPK |
Ga0208668_10723011 | 3300025078 | Marine | ARSRKQAYPNVDEFMEAYTEKEIGGNSTKWDAYIINYNKVRTENPK |
Ga0208156_100683610 | 3300025082 | Marine | LLKEFAEAYCEKEIGGNSAKWDAYVTKYNLVRSNNPKP |
Ga0208010_10295121 | 3300025097 | Marine | VKEFAEAYTEKEIGGDDTKWNEYVTKYNKVRTDNPKDN |
Ga0208159_10401013 | 3300025101 | Marine | VQDFMEAYTEKEIGSSSTKWDAYVTKYNKVRSDNPKXAH |
Ga0208433_10015533 | 3300025114 | Marine | MQYHDGVDNTRASEYPSTETFLEAYTEKEIGGDSTKWDAYVIAYNKVRADNPK |
Ga0208433_10331492 | 3300025114 | Marine | LKEFAEAYCEKEILADTTKWDDYVVKYNKVRTDNPK |
Ga0208790_10402381 | 3300025118 | Marine | TRALEYPSTETFLEAYTEKEIGGDSTKWDAYVIAYNKVRTDNPK |
Ga0209644_10094235 | 3300025125 | Marine | AYSRKRESEYPSTKDFMEAYTEKEIGGNSTKWDAYVINYNKVRTENPK |
Ga0209348_10248861 | 3300025127 | Marine | ARKREMEYPSVQDFMEAYTEKEIGGDSTKWDAYKTAYNKVRTDNPKE |
Ga0208919_11217271 | 3300025128 | Marine | ARNRAAAYPSLQEFAEAYCEKEIGGDTTKWDEYVIKYNKVRTDNPK |
Ga0209128_10758151 | 3300025131 | Marine | LKEFAEAYTEKEIGGDSTKWDAYVINYNKVRTDNPKE |
Ga0209128_11961621 | 3300025131 | Marine | NLKEFAEAYTEKEIGGDDAKWNEYVTKYNKVRTDNPKG |
Ga0209128_12180781 | 3300025131 | Marine | PNVDDFMEAYTEKEIGGNSSKWDEYVIKYNKVRSDNPKL |
Ga0209232_11272902 | 3300025132 | Marine | RAAEYPSLQEFAEAYCEKEIGSDSTKWDAYKTAYNKVRTDNPKG |
Ga0209756_13378522 | 3300025141 | Marine | ARARKQEYPNVDDFMEAYTEKEIGGNSSKWDEYVIKYNKVRSDNPKL |
Ga0208182_10351921 | 3300025251 | Deep Ocean | ARDISYPSLKEFAEAYTEKEIGGDSTKWDAYVINYNKVRTENPK |
Ga0208182_10796341 | 3300025251 | Deep Ocean | PSIQDFMEAYTEKEIGGSSTKWNAYKTAYNKVRSDNPKE |
Ga0207894_10753681 | 3300025268 | Deep Ocean | HEFAEAYTEKEIGGSSGKWDAYVINYNKVRSDNPK |
Ga0208183_10413401 | 3300025274 | Deep Ocean | PQLREFLEAYTEKEIGGDSTKWDAYVVKYNKVRSDNPKP |
Ga0208449_10455123 | 3300025280 | Deep Ocean | DYARKREGEYPSTKDFMEAYTEKEIGGNSTKWDAYVINYNKVRTENPK |
Ga0208030_10523131 | 3300025282 | Deep Ocean | SEYPSTKDFMEAYTEKEIGGSSGKWDAYVINYNKVRSDNPK |
Ga0208316_11047261 | 3300025296 | Deep Ocean | RERLKKYPRILEFIEAYTEKEIGGDSTKWDVYVAQYNQVRSDNPKG |
Ga0208450_11311962 | 3300025301 | Deep Ocean | ARARKTAYPVTKDFIEAYTEKEIGGDSTKWDAYIVKYNKVRNDNPKG |
Ga0208150_10463051 | 3300025751 | Aqueous | YPSIQEFMEAYTEKEIGGDSTKWDAYVVKYNQVRTDNPKPGE |
Ga0208645_10534621 | 3300025853 | Aqueous | VAYPSTKEFMEAYTEKEIGGDSTKWDAYVVKYNQVRTDNPKPSG |
Ga0208645_11952743 | 3300025853 | Aqueous | FMEAYTEKEIGGDSTKWDAYVVKYNQVRTDNPKPGE |
Ga0209757_100124301 | 3300025873 | Marine | QEFAEAYSEKEIGADSTKWDAYVLKYNKVRTDNPKL |
Ga0209757_102186461 | 3300025873 | Marine | YPPTKDFMEAYTEKEIGGDSTKWDAYVINYNKVRTENPK |
Ga0208406_10510181 | 3300026205 | Marine | TVPSVTDFMEAYTEKEIGSDSSKWDAYVIAYNKVRTDNPKP |
Ga0208879_11381963 | 3300026253 | Marine | ARKREEEYPSVKDFMEAYTEKEIGGDFTKWNAYVITYNQVRIDNPKG |
Ga0208130_11590974 | 3300026258 | Marine | NKEFIEAYTEKEIGGDTTKWDAYVKKYNQVRTDNPKPS |
Ga0207990_11190061 | 3300026262 | Marine | TKEFIEAYTEKEIGGDTTKWDAYVVKYNKVRSDNQKP |
Ga0256381_10356821 | 3300028018 | Seawater | ADFMEAYTEKEIGSDSTKWDAYVIAYNKVRTDNPK |
Ga0256382_11451981 | 3300028022 | Seawater | AAYPSVADFMEAYTEKEIGSDSTKWDAYVIAYNKVRTDNPK |
Ga0257114_10628764 | 3300028196 | Marine | KTDRKAAYPSVMDFIEAYTEKEIGEDSTKWDAYVIKYNQVRTDYPKPSE |
Ga0183748_10647323 | 3300029319 | Marine | RKREIEYPSVQDFMEAYTEKEIGGDSTKWDAYTTAYNKVRTDNPKE |
Ga0183757_10380301 | 3300029787 | Marine | YARKREMEYPSVQDFMEAYTEKEIGGDSTKWDAYKTAYNKVRTDNPKE |
Ga0308016_101813381 | 3300031695 | Marine | EEYPPLIEFAEAYTEKEINGNDTKWLQYKTKYNKVRTDNPKS |
Ga0310125_104166592 | 3300031811 | Marine | AYPADADFKEAYTEKEIGGDSTKWDAYVTAYNKVRTDNPKS |
Ga0316203_10464521 | 3300032274 | Microbial Mat | PSTKDFMEAYTEKEIGSNSTKWDAYVTKYNKVRTENPKS |
Ga0348336_043551_1821_1928 | 3300034375 | Aqueous | MEAYTEKEIGGDSTKWDAYVVKYNQVRTDNPKPSG |
Ga0326746_030054_437_568 | 3300034655 | Filtered Seawater | GTAYPQLKEFTEAYCEKEIGGDSAKWDAYVLKYNKVRTDNPKP |
⦗Top⦘ |