Metagenome Family F070063

Basic Information
Family ID	F070063
Family Type	Metagenome
Number of Sequences	123
Average Sequence Length	44 residues
Representative Sequence	DDNEKVAGPPEMEFSFNVGVQFGLTDATSDTALKFQGSLSF
Number of Associated Samples	110
Number of Associated Scaffolds	123

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.69 %
% of genes near scaffold ends (potentially truncated)	94.31 %
% of genes from short scaffolds (< 2000 bps)	86.99 %
Associated GOLD sequencing projects	105
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.21

Most Common Taxonomy
Group	Bacteria (86.992 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.195 % of family members)
Environment Ontology (ENVO)	Unclassified (29.268 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (35.772 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 123 Family Scaffolds
PF12706	Lactamase_B_2	34.96
PF13537	GATase_7	3.25
PF01569	PAP2	2.44
PF13522	GATase_6	2.44
PF00196	GerE	1.63
PF02239	Cytochrom_D1	1.63
PF01641	SelR	1.63
PF04966	OprB	1.63
PF03734	YkuD	1.63
PF13411	MerR_1	0.81
PF07730	HisKA_3	0.81
PF08241	Methyltransf_11	0.81
PF01699	Na_Ca_ex	0.81
PF10282	Lactonase	0.81
PF13460	NAD_binding_10	0.81
PF04226	Transgly_assoc	0.81
PF02696	SelO	0.81
PF00535	Glycos_transf_2	0.81
PF12625	Arabinose_bd	0.81
PF05235	CHAD	0.81
PF05690	ThiG	0.81
PF05532	CsbD	0.81

COG ID	Name	Functional Category	% Frequency in 123 Family Scaffolds
COG0229	Peptide methionine sulfoxide reductase MsrB	Posttranslational modification, protein turnover, chaperones [O]	1.63
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	1.63
COG3659	Carbohydrate-selective porin OprB	Cell wall/membrane/envelope biogenesis [M]	1.63
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	1.63
COG5607	CHAD domain, binds inorganic polyphosphates	Function unknown [S]	0.81
COG0214	Pyridoxal 5'-phosphate synthase subunit PdxS	Coenzyme transport and metabolism [H]	0.81
COG4585	Signal transduction histidine kinase ComP	Signal transduction mechanisms [T]	0.81
COG4564	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.81
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.81
COG3850	Signal transduction histidine kinase NarQ, nitrate/nitrite-specific	Signal transduction mechanisms [T]	0.81
COG3237	Uncharacterized conserved protein YjbJ, UPF0337 family	Function unknown [S]	0.81
COG3025	Inorganic triphosphatase YgiF, contains CYTH and CHAD domains	Inorganic ion transport and metabolism [P]	0.81
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	0.81
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.81
COG2022	Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)	Coenzyme transport and metabolism [H]	0.81
COG0530	Ca2+/Na+ antiporter	Inorganic ion transport and metabolism [P]	0.81
COG0397	Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O)	Posttranslational modification, protein turnover, chaperones [O]	0.81
COG0387	Cation (Ca2+/Na+/K+)/H+ antiporter ChaA	Inorganic ion transport and metabolism [P]	0.81

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	86.99 %
Unclassified	root	N/A	13.01 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	86.99 %
Unclassified	root	N/A	13.01 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	86.99 %
Unclassified	root	N/A	13.01 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	76.42 %
Unclassified	root	N/A	13.01 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	3.25 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	75.61 %
Unclassified	root	N/A	13.01 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	3.25 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	63.41 %
Unclassified	root	N/A	13.01 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	3.25 %
Parvularculales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales	0.81 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	29.27 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	13.01 %
Unclassified	root	N/A	13.01 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	3.25 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.81 %
Kaistiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae	0.81 %
Parvularculaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae	0.81 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.81 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	17.89 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	13.01 %
Unclassified	root	N/A	13.01 %
Methyloceanibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter	8.94 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	3.25 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.81 %
Aquisalinus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Aquisalinus	0.81 %
Bauldia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia	0.81 %
unclassified Hyphomicrobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae	0.81 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.81 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobium denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	17.89 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	13.01 %
Unclassified	root	N/A	13.01 %
Methyloceanibacter caenitepidi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	4.07 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	3.25 %
Methyloceanibacter marginalis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	2.44 %
Methyloceanibacter superfactus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	2.44 %
Hyphomicrobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	0.81 %
Aquisalinus flavus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Aquisalinus → Aquisalinus flavus	0.81 %
Bauldia litoralis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis	0.81 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.81 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2228664021\|ICCgaii200_c0625148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	839	Open in IMG/M
3300000651\|AP72_2010_repI_A10DRAFT_1029843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	700	Open in IMG/M
3300000787\|JGI11643J11755_11692296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	699	Open in IMG/M
3300000891\|JGI10214J12806_11338710	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	601	Open in IMG/M
3300000893\|AP72_2010_repI_A001DRAFT_1014272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1337	Open in IMG/M
3300004003\|Ga0055445_10331473	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	529	Open in IMG/M
3300004063\|Ga0055483_10208991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	635	Open in IMG/M
3300004156\|Ga0062589_100760223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	871	Open in IMG/M
3300004479\|Ga0062595_100074366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Aquisalinus → Aquisalinus flavus	1686	Open in IMG/M
3300005093\|Ga0062594_102989838	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	528	Open in IMG/M
3300005332\|Ga0066388_105481914	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium	643	Open in IMG/M
3300005332\|Ga0066388_106292750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	599	Open in IMG/M
3300005332\|Ga0066388_107168035	Not Available	560	Open in IMG/M
3300005340\|Ga0070689_100371794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	1203	Open in IMG/M
3300005340\|Ga0070689_100699039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	885	Open in IMG/M
3300005436\|Ga0070713_101301209	Not Available	704	Open in IMG/M
3300005547\|Ga0070693_101640816	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300005607\|Ga0070740_10280476	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	672	Open in IMG/M
3300005615\|Ga0070702_100173642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1404	Open in IMG/M
3300005616\|Ga0068852_101461593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	706	Open in IMG/M
3300005719\|Ga0068861_102110862	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	563	Open in IMG/M
3300005764\|Ga0066903_100924598	Not Available	1582	Open in IMG/M
3300005764\|Ga0066903_104501753	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	743	Open in IMG/M
3300005764\|Ga0066903_107054162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	582	Open in IMG/M
3300005764\|Ga0066903_107582870	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	559	Open in IMG/M
3300005764\|Ga0066903_108051353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	540	Open in IMG/M
3300005840\|Ga0068870_11092974	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	573	Open in IMG/M
3300005840\|Ga0068870_11446300	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300005843\|Ga0068860_101844646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	626	Open in IMG/M
3300006635\|Ga0075526_1007215	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	766	Open in IMG/M
3300006846\|Ga0075430_100472868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	1034	Open in IMG/M
3300006846\|Ga0075430_100516596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	985	Open in IMG/M
3300006880\|Ga0075429_101952195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	508	Open in IMG/M
3300006903\|Ga0075426_10309330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	1156	Open in IMG/M
3300006904\|Ga0075424_100373535	All Organisms → cellular organisms → Bacteria	1519	Open in IMG/M
3300006954\|Ga0079219_11184723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	659	Open in IMG/M
3300006954\|Ga0079219_12015337	Not Available	549	Open in IMG/M
3300006969\|Ga0075419_10142391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1564	Open in IMG/M
3300007076\|Ga0075435_100236506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1553	Open in IMG/M
3300007076\|Ga0075435_101195316	All Organisms → cellular organisms → Bacteria	665	Open in IMG/M
3300009081\|Ga0105098_10566307	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300009092\|Ga0105250_10018983	All Organisms → cellular organisms → Bacteria	2781	Open in IMG/M
3300009098\|Ga0105245_11324917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	769	Open in IMG/M
3300009100\|Ga0075418_10174778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	2287	Open in IMG/M
3300009146\|Ga0105091_10194624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	964	Open in IMG/M
3300009157\|Ga0105092_10153325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	1280	Open in IMG/M
3300009488\|Ga0114925_10028562	All Organisms → cellular organisms → Bacteria	3241	Open in IMG/M
3300009778\|Ga0116151_10456490	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300009792\|Ga0126374_10212424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1234	Open in IMG/M
3300009815\|Ga0105070_1097765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	577	Open in IMG/M
3300010362\|Ga0126377_12984230	Not Available	546	Open in IMG/M
3300010397\|Ga0134124_12729342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	537	Open in IMG/M
3300010403\|Ga0134123_12571219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	576	Open in IMG/M
3300012895\|Ga0157309_10279880	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	555	Open in IMG/M
3300012899\|Ga0157299_10208599	Not Available	594	Open in IMG/M
3300012901\|Ga0157288_10008647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1620	Open in IMG/M
3300012908\|Ga0157286_10051441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1058	Open in IMG/M
3300012948\|Ga0126375_10320705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1085	Open in IMG/M
3300012951\|Ga0164300_11148148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	511	Open in IMG/M
3300012958\|Ga0164299_10610932	Not Available	747	Open in IMG/M
3300012958\|Ga0164299_10611693	Not Available	747	Open in IMG/M
3300012964\|Ga0153916_12129805	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	630	Open in IMG/M
3300012987\|Ga0164307_10009089	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4757	Open in IMG/M
3300012989\|Ga0164305_10329996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1140	Open in IMG/M
3300013297\|Ga0157378_10075757	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3030	Open in IMG/M
3300013307\|Ga0157372_11551434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus	763	Open in IMG/M
3300014317\|Ga0075343_1095932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	670	Open in IMG/M
3300014320\|Ga0075342_1085429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	807	Open in IMG/M
3300014324\|Ga0075352_1084959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	808	Open in IMG/M
3300014325\|Ga0163163_11048458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	879	Open in IMG/M
3300014745\|Ga0157377_10358497	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	981	Open in IMG/M
3300015371\|Ga0132258_13491032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis	1077	Open in IMG/M
3300018053\|Ga0184626_10240396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	761	Open in IMG/M
3300018429\|Ga0190272_11525075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	681	Open in IMG/M
3300018920\|Ga0190273_11723018	Not Available	566	Open in IMG/M
3300019487\|Ga0187893_10531397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	760	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10063919	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	1483	Open in IMG/M
3300025167\|Ga0209642_10336026	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	854	Open in IMG/M
3300025174\|Ga0209324_10031903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	3622	Open in IMG/M
3300025321\|Ga0207656_10207941	Not Available	947	Open in IMG/M
3300025544\|Ga0208078_1044471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	952	Open in IMG/M
3300025566\|Ga0210140_1108288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	570	Open in IMG/M
3300025912\|Ga0207707_11581005	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	517	Open in IMG/M
3300025928\|Ga0207700_11573508	Not Available	582	Open in IMG/M
3300025938\|Ga0207704_11910522	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	511	Open in IMG/M
3300025940\|Ga0207691_11537873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	543	Open in IMG/M
3300025945\|Ga0207679_11813468	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300025949\|Ga0207667_10339092	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1534	Open in IMG/M
3300025960\|Ga0207651_10196318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1613	Open in IMG/M
3300025961\|Ga0207712_10028176	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3755	Open in IMG/M
3300026035\|Ga0207703_11318160	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	694	Open in IMG/M
3300026041\|Ga0207639_10028995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4047	Open in IMG/M
3300026075\|Ga0207708_10077104	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2558	Open in IMG/M
3300027379\|Ga0209842_1062719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	661	Open in IMG/M
3300027706\|Ga0209581_1180670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	672	Open in IMG/M
3300027723\|Ga0209703_1257527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	628	Open in IMG/M
3300027765\|Ga0209073_10339207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	604	Open in IMG/M
(restricted) 3300027872\|Ga0255058_10391885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	674	Open in IMG/M
3300027880\|Ga0209481_10262698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	871	Open in IMG/M
3300028379\|Ga0268266_10087552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2725	Open in IMG/M
3300030003\|Ga0302172_10119255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	810	Open in IMG/M
3300030006\|Ga0299907_10308802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	1288	Open in IMG/M
3300030619\|Ga0268386_10013698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	6303	Open in IMG/M
3300031226\|Ga0307497_10139546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	994	Open in IMG/M
3300031232\|Ga0302323_100225963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	1905	Open in IMG/M
3300031539\|Ga0307380_10209381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1875	Open in IMG/M
3300031563\|Ga0307436_1121127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	733	Open in IMG/M
3300031565\|Ga0307379_10325824	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	1503	Open in IMG/M
3300031566\|Ga0307378_10518506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	1065	Open in IMG/M
3300031673\|Ga0307377_10448338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis	950	Open in IMG/M
3300031747\|Ga0318502_10498074	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	730	Open in IMG/M
3300031847\|Ga0310907_10404076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	712	Open in IMG/M
3300031902\|Ga0302322_103463192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	540	Open in IMG/M
3300032003\|Ga0310897_10380658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	663	Open in IMG/M
3300032041\|Ga0318549_10077335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi	1421	Open in IMG/M
3300032076\|Ga0306924_11925657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	612	Open in IMG/M
3300032273\|Ga0316197_10153337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans	1375	Open in IMG/M
3300032516\|Ga0315273_13190497	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	507	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	71.54%
Host-Associated	Host-Associated	27.64%
Engineered	Engineered	0.81%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	58.54%
Plants	Host-Associated → Plants	27.64%
Aquatic	Environmental → Aquatic	13.01%
Wastewater	Engineered → Wastewater	0.81%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	55.28%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.26%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.57%
Marine	Environmental → Aquatic → Marine	7.32%
Freshwater	Environmental → Aquatic → Freshwater	4.88%
Peat	Environmental → Terrestrial → Peat	2.44%
Sediment	Environmental → Aquatic → Sediment	0.81%
Cave	Environmental → Terrestrial → Cave	0.81%
Roots	Host-Associated → Plants → Roots	0.81%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	34.15%
Loam	Environmental → Terrestrial → Soil → Loam	13.82%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.01%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.76%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.25%
Clay	Environmental → Terrestrial → Soil → Clay	3.25%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.25%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.44%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.44%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.44%
Oceanic	Environmental → Aquatic → Marine → Oceanic	1.63%
Sand	Environmental → Terrestrial → Soil → Sand	1.63%
Lake	Environmental → Aquatic → Freshwater → Lake	0.81%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.81%
Coastal	Environmental → Aquatic → Marine → Coastal	0.81%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.81%
Strait	Environmental → Aquatic → Marine → Strait	0.81%
Gulf	Environmental → Aquatic → Marine → Gulf	0.81%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.81%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.81%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.81%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.51%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.01%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.76%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.50%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.88%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.06%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.25%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	3.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.25%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.44%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.44%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.44%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.44%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	1.63%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.63%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.63%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	1.63%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.81%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.81%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	0.81%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.81%
Unclassified	Environmental → Aquatic → Marine → Strait → Unclassified	0.81%
Unclassified	Environmental → Aquatic → Marine → Gulf → Unclassified	0.81%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.81%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.81%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.81%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.81%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	12.20%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.13%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	6.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.06%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.06%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	3.25%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	3.25%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.44%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.44%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.44%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.44%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.44%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.44%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.44%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	2.44%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.44%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	1.63%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.63%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.63%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.63%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.63%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	1.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.63%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.81%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.81%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Sediment	0.81%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.81%
Seawater	Environmental → Aquatic → Marine → Strait → Unclassified → Seawater	0.81%
Seawater	Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater	0.81%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.81%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.81%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.81%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.81%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000651	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000893	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001	Environmental	Open in IMG/M
3300004003	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1	Environmental	Open in IMG/M
3300004063	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005607	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006635	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-three	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009488	Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG	Environmental	Open in IMG/M
3300009778	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG	Engineered	Open in IMG/M
3300009788	Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009815	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012895	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014317	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1	Environmental	Open in IMG/M
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental	Open in IMG/M
3300014324	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental	Open in IMG/M
3300024519 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27	Environmental	Open in IMG/M
3300025167	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)	Environmental	Open in IMG/M
3300025174	Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025544	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025566	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300027379	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)	Environmental	Open in IMG/M
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027723	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental	Open in IMG/M
3300027872 (restricted)	Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300030003	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031563	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40	Environmental	Open in IMG/M
3300031565	Soil microbial communities from Risofladan, Vaasa, Finland - UN-2	Environmental	Open in IMG/M
3300031566	Soil microbial communities from Risofladan, Vaasa, Finland - UN-1	Environmental	Open in IMG/M
3300031673	Soil microbial communities from Risofladan, Vaasa, Finland - TR-3	Environmental	Open in IMG/M
3300031747	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032041	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032273	Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxic	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.21
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.21
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F070063

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICCgaii200_06251482	2228664021	Soil	NAPEPAGTEFSMNIGYQFGLTDVTSDGALKLQGSLAF
AP72_2010_repI_A10DRAFT_10298432	3300000651	Forest Soil	AAGSPNLELSFNVGVQFGLTDATSDGALKFQGTFSW*
JGI11643J11755_116922961	3300000787	Soil	EGDEEEVKGDKDNDKASGPSEMQLSFNIGLQFGVTDATSDTALKFQGSLSF*
JGI10214J12806_113387102	3300000891	Soil	VPAGMELTFNLGVQFGLTDATSDTALKFQGSLSF*
AP72_2010_repI_A001DRAFT_10142721	3300000893	Forest Soil	GPTLFWKPVGGEDEAKNEGGENDNRAAGSPNLELSFNVGVQFGLTDATSDGALKFQGTFSW*
Ga0055445_103314731	3300004003	Natural And Restored Wetlands	GGEGDADEDDVASAPEMELYLNVGLQFGLTDATSDTALKFQGSLQF*
Ga0055483_102089911	3300004063	Natural And Restored Wetlands	ADEGDADGAQGTSLSLNVGVQFGLTDATSDTALKFQGSLQF*
Ga0062589_1007602231	3300004156	Soil	KKSDDNEKVAGPPEMEFSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0062595_1000743664	3300004479	Soil	MYQTTGKDNDKASGPSEMQLSFNIGLQFGLMDATSDTALKFQGSLSF*
Ga0062594_1029898382	3300005093	Soil	EAKGGDEDEDNNKVPGPPNLELSFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0066388_1054819141	3300005332	Tropical Forest Soil	AEGGNDDRVAGPAQMAFSMNLGVQFGLTDATSDTALKLQGSLSF*
Ga0066388_1062927501	3300005332	Tropical Forest Soil	GKEDNDNEKVAGTPEMELSFNVGVQFGLTDATSDAALKFQGTISF*
Ga0066388_1071680351	3300005332	Tropical Forest Soil	AGGDEDENEAKSPAPLELSFNVGVQFGLTDATSDTTLKFQGSLSF*
Ga0070689_1003717941	3300005340	Switchgrass Rhizosphere	GGDDDDKATEAPAMKFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0070689_1006990391	3300005340	Switchgrass Rhizosphere	GGEGDDDDENNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF*
Ga0070713_1013012091	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	EEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0068853_1013313932	3300005539	Corn Rhizosphere	GDDDEAEGEGKKKGGDDDDKATEAPAMKFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0070693_1016408162	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	KKGGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF*
Ga0070740_102804762	3300005607	Surface Soil	TKKQEDVGDAAGGEDEENGTPGPEPLELSFNVGVQFGLTDATSDGALKFQGSLSW*
Ga0070702_1001736423	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	EGEGKKKGGDDDDKATEAPPMKFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0068852_1014615931	3300005616	Corn Rhizosphere	NAPEPASTEFSMNVGVQFGLTDATSDTALKFQGSLAF*
Ga0068861_1021108622	3300005719	Switchgrass Rhizosphere	DDDENKKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF*
Ga0066903_1009245981	3300005764	Tropical Forest Soil	EKVAGASEMELSFNVGVQFGLTDATSDTALKFQGTISF*
Ga0066903_1045017531	3300005764	Tropical Forest Soil	AAGPPKMEFSLNVGVQFGLTDATSDTAPKFQGSLSF*
Ga0066903_1070541622	3300005764	Tropical Forest Soil	KEVKQGKEDNDNEKVAGASEMELSFNVGVQFGLTDATSDTALKFQGTFSF*
Ga0066903_1075828701	3300005764	Tropical Forest Soil	ESEEREGKEDNDNEKVAGQPKLELSFNVGVQFGLTDATSDTALKFQGTVSF*
Ga0066903_1080513532	3300005764	Tropical Forest Soil	NDNEKVAGAPEMELSFNVGLQFGLTDATSDTALKFQGSLSF*
Ga0068870_110929741	3300005840	Miscanthus Rhizosphere	NHNPEPAKMEFSMNVGVQFGLTDVTSDSALKFQGSLAF*
Ga0068870_114463002	3300005840	Miscanthus Rhizosphere	GDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF*
Ga0068860_1018446461	3300005843	Switchgrass Rhizosphere	ENKKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF*
Ga0075526_10072152	3300006635	Arctic Peat Soil	DDDDERKVGGPPEMEVSFNVGVQFGLTDFTSDTALKFQGSLGF*
Ga0075430_1004728682	3300006846	Populus Rhizosphere	AEAPEMEVSLNVGVQFGLTDATSDTAVKFQGSIGF*
Ga0075430_1005165962	3300006846	Populus Rhizosphere	GSEEEEAKGGDEDEDNNKVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0075429_1019521951	3300006880	Populus Rhizosphere	APEPAKTEFSMNFGVQFGLTDVTSDGALKFQGSLAF*
Ga0075426_103093301	3300006903	Populus Rhizosphere	VPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0075424_1003735354	3300006904	Populus Rhizosphere	DAAGGDEDENKGPGPAPLELSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0079219_111847232	3300006954	Agricultural Soil	DEEEAKGDKDNDKASGPSEMQLSFNIGLQFGVTDATSDTALKFQGSLSF*
Ga0079219_120153371	3300006954	Agricultural Soil	EGEEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGLLSF*
Ga0075419_101423911	3300006969	Populus Rhizosphere	EEEAKGGDEDEDNNKVPGPPNMELSFNVGVQSGLTDVTSDGALKFQGSLAW*
Ga0075435_1002365062	3300007076	Populus Rhizosphere	LQGDGDEAEEKGAGPAPLELSLNVGVQFGLTDATSDVALKFQGSLAF*
Ga0075435_1011953162	3300007076	Populus Rhizosphere	NKSQGPAPLELSFNVGVQLGLTDATSDTALKFQGSLSF*
Ga0105098_105663071	3300009081	Freshwater Sediment	NGKFTAEAPEMEVSLNIGVQFGLTDATSDTALKFQGSLAF*
Ga0105250_100189836	3300009092	Switchgrass Rhizosphere	EKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0105245_113249172	3300009098	Miscanthus Rhizosphere	DKDEDNNKVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0075418_101747785	3300009100	Populus Rhizosphere	GDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0105091_101946241	3300009146	Freshwater Sediment	EEGEGENGDDDDGATEAAEMEFSLNVGVQFGLTDVTSDSALKFQGSLAF*
Ga0105092_101533251	3300009157	Freshwater Sediment	DDENGVAEAPEMEVSLNVGVQFGLTVATSDTAVKFQGSIGF*
Ga0114925_100285624	3300009488	Deep Subsurface	GDDDDEKVGGPPEMELSLNIGVQFGLTDVTSDTALKFQGSLAF*
Ga0116151_104564901	3300009778	Anaerobic Digestor Sludge	DDGDEGELELDDDVVAGPPEMELSFNVGVQFGLTDNTSDSALKFQDSLEF*
Ga0114923_110799552	3300009788	Deep Subsurface	GDDDAVGGEGKGAEDEVAGPRKMEFFLNVGVQFGLTDMTSDTALKFQGSLEF*
Ga0126374_102124242	3300009792	Tropical Forest Soil	EEEEAKAGDEDEDNNKIPGPPNMELSFNVGVQFGLTDVTSDGALKFQGTFSW*
Ga0105070_10977651	3300009815	Groundwater Sand	VGAPPEMEFSLNVGVQFGLTDVTSDTALKFQGTLEF*
Ga0126377_129842302	3300010362	Tropical Forest Soil	GDAAGGDENENKGPGPAPLELSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0134124_127293421	3300010397	Terrestrial Soil	IGLRLVAGTRAMELSFNVGVQFGLTDATSDTALKIQGSLSF*
Ga0134122_116724761	3300010400	Terrestrial Soil	LFYNPGGYDDEAEGEGKKKGGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF*
Ga0134123_125712191	3300010403	Terrestrial Soil	PEPAKTEFSMNVGVQFGLTDVTSDSALKFQGSLAF*
Ga0157309_102798801	3300012895	Soil	EAKGGDEDEDNNKVRGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0157299_102085991	3300012899	Soil	DKDNDKASGPSEMQLSFNIGLQFGVTDATSDTALKFQGSLSF*
Ga0157288_100086473	3300012901	Soil	KGGDEDEDNNKVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSIAW*
Ga0157286_100514411	3300012908	Soil	VGDAAGGDEEENKGPGPAPLELSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0126375_103207053	3300012948	Tropical Forest Soil	DKEKVAGAPEMELSFNVGVQFGLTDATSDTALKFQGTVSF*
Ga0164300_111481481	3300012951	Soil	HQAAKAEFSMNVGVQFGLTDATSDTALKFQGSLAF*
Ga0164299_106109322	3300012958	Soil	GEEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0164299_106116931	3300012958	Soil	TGKKHQAAKAEFSMNVGVQFGLTDATSDTALKFQGSLAF*
Ga0153916_121298051	3300012964	Freshwater Wetlands	KGSDDDDKAIEAPDMEFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0164307_100090898	3300012987	Soil	EGKEDKDTEKVAGPPKMELSFNVGVQLGLTDATSDAALKFQGSLSF*
Ga0164307_117759852	3300012987	Soil	KAKARGQEQASEPSAMAFSMNVGVQFGLTDATSDTALKFQGSLAF*
Ga0164305_103299961	3300012989	Soil	KDNEKVAGPPKMELSFNVGVQFGLTDATFDAALKFQGSLSF*
Ga0157378_100757571	3300013297	Miscanthus Rhizosphere	ENVGGEGDDDDENNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF*
Ga0163162_129522162	3300013306	Switchgrass Rhizosphere	DEESEGEGKKKGGDDDDKATEAPAMKFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0157372_115514341	3300013307	Corn Rhizosphere	DDNEKVAGPPEMEFSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0075343_10959321	3300014317	Natural And Restored Wetlands	DVGEDDDDDNGGVTKAPETEFSMNVGLQFGLTDMTSDTAMKFQGSLAF*
Ga0075342_10854292	3300014320	Natural And Restored Wetlands	GKGDDDGDKRVAGPSKMDFSLNVGVQFGLTDLTSDTALKFQGSLAF*
Ga0075352_10849592	3300014324	Natural And Restored Wetlands	KVAGPPDMELSFNVGVQFGLTDATSDGALKFQGSLTW*
Ga0163163_110484583	3300014325	Switchgrass Rhizosphere	GSSEMELSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0157377_103584971	3300014745	Miscanthus Rhizosphere	NPEPAKMEFSMNVGVQFGLTDVTSDSALRFQGSLAF*
Ga0132258_134910323	3300015371	Arabidopsis Rhizosphere	EKKKEGGGPADMEFSLNVGVQFGLTDATSDTALKFQGELDF*
Ga0184626_102403961	3300018053	Groundwater Sediment	NEKVASPPEMEFSLNVGVQFGLTEVTSDTALKFQGSLAF
Ga0190272_115250752	3300018429	Soil	SGPPEMEFSLNVGVQFGLSDVTSDTALKFQGSLAF
Ga0190273_117230181	3300018920	Soil	KKVGGAPEMEFSLNVGLQFGLTDVTSDTALKFQGTLEF
Ga0187893_105313972	3300019487	Microbial Mat On Rocks	EVEIYDDEQAGGAVAMTFSMNVGVQFGLTDSTSDTALKFQGAVQF
(restricted) Ga0255046_100639193	3300024519	Seawater	NDDDEIAGEPEMEFVFNVGLQFGLTDATSDTALKFQGAMEF
Ga0209642_103360261	3300025167	Soil	GGPPEMEFSMNVGVQFGLTDVTSDTALKFQGTLEF
Ga0209324_100319031	3300025174	Soil	GDDNGNGKGPGDDDDKKKVGGPPEMEFSMNVGVQFGLTDVTSDTALKFQGTLEF
Ga0207656_102079412	3300025321	Corn Rhizosphere	EGEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF
Ga0208078_10444712	3300025544	Arctic Peat Soil	GDDDEKGGGGAETEFSMNIGVQFGLTDATSEGALKVQGSLQF
Ga0210140_11082882	3300025566	Natural And Restored Wetlands	VPGGPVEMEVSFNVGVQFGLTDETSDSALKFQGMLEF
Ga0207707_115810051	3300025912	Corn Rhizosphere	ARCRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0207700_115735081	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	EEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF
Ga0207704_119105221	3300025938	Miscanthus Rhizosphere	EDEDNNKVPGPPNLELSFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0207691_115378731	3300025940	Miscanthus Rhizosphere	NNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLNF
Ga0207679_118134681	3300025945	Corn Rhizosphere	EGKKKGGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF
Ga0207667_103390921	3300025949	Corn Rhizosphere	EAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF
Ga0207651_101963181	3300025960	Switchgrass Rhizosphere	NKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0207712_100281761	3300025961	Switchgrass Rhizosphere	DEDEDNNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0207703_113181602	3300026035	Switchgrass Rhizosphere	GGEGDDDDENKKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF
Ga0207639_100289959	3300026041	Corn Rhizosphere	NGNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF
Ga0207708_100771043	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	EKDENVGGEGDDDDENNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF
Ga0209842_10627191	3300027379	Groundwater Sand	DNGNGNGDDDNKIAGPAKVEFSMNVGVQFGLTDLTSDTALKFQGTLEF
Ga0209581_11806702	3300027706	Surface Soil	TKKQEDVGDAAGGEDEENGTPGPEPLELSFNVGVQFGLTDATSDGALKFQGSLSW
Ga0209703_12575271	3300027723	Freshwater Sediment	NGNAPEPAKTEFSMNVGVQFGLTDVTSDGALKFQGSLAF
Ga0209073_103392071	3300027765	Agricultural Soil	EGGDDDKKAAGPPDMELSFNVGVQLGLTDAASDGALKFQGSLSW
(restricted) Ga0255058_103918852	3300027872	Seawater	EIAGEPEMEFVFNVGLQFGLTDATSDTALKFQGGVEF
Ga0209481_102626982	3300027880	Populus Rhizosphere	EEEAKGGDEDEDNNKVPGPPNMELSFNVGVQSGLTDVTSDGALKFQGSLAW
Ga0268266_100875521	3300028379	Switchgrass Rhizosphere	PGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0302172_101192551	3300030003	Fen	DKVAGPPPLELSFNVGVQFGLTDVTSDTALKFQGELNF
Ga0299907_103088021	3300030006	Soil	DDDDDDNGNRNGNHEVAGPAKPEFSMNVGVQFGLTDFTSETALKFQGALEF
Ga0268386_100136987	3300030619	Soil	DDERKVGGPPEMEVSLNVGVQFGLTDFTSDTALKFQGSLGF
Ga0307497_101395461	3300031226	Soil	SAGGPAAMEFSMNVGVQFGLTDATSDTALKFQGSLAF
Ga0302323_1002259631	3300031232	Fen	NDEDGVGKAEGGDDDKVAGPPPLELSFNVGVQFGLTDVTSDTALKFQGELNF
Ga0307380_102093811	3300031539	Soil	DGDDDDGDNGATKAPEMEFSMNVGLQFGLTDLTSDGAVKFQGSLAF
Ga0307436_11211272	3300031563	Salt Marsh	GEGDADEDDAAGASQASLSLNVGVQFGLTDATSDTALKFQGSFQF
Ga0307379_103258241	3300031565	Soil	GDDDEEDDVAGPPDMEFSLNVGLQFGLTDAASDTALKFQGSLAF
Ga0307378_105185062	3300031566	Soil	GDDDDDDRKVGGPPEIEFSLNVGVQFGLIDVTSDGALKFQGSLAF
Ga0307377_104483382	3300031673	Soil	AVAGPPEMEFSFNVGLQFGLTDATSDTALKFQGSLGF
Ga0318502_104980742	3300031747	Soil	PREGDDEKVAGPPKMELSLNVGVQFGLTDATSDLQLKFQTSLSF
Ga0310907_104040762	3300031847	Soil	SEEEEAKGGDEDEDNNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0302322_1034631922	3300031902	Fen	KVAGPPPLELSFNVGVQFGLTDVTSDTALKFQGELNF
Ga0310897_103806582	3300032003	Soil	NNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0318549_100773351	3300032041	Soil	ARAGPDALSMNVGYQFGLADATSDSALKFQGSLSF
Ga0306924_119256572	3300032076	Soil	DEKAAGPPATELALNVGVQFGLTDATSDTALKFQGSIGF
Ga0316197_101533372	3300032273	Sediment	DLDEDFVPGGPVEMEMSFNVGVQFGLTDETSDSALKFQGKLEF
Ga0315273_131904972	3300032516	Sediment	DDKESQKSTEFQMNVGVQFGLTELASDAALKVQGALQF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign