NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069925

Metagenome / Metatranscriptome Family F069925

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069925
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 44 residues
Representative Sequence IPGARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG
Number of Associated Samples 111
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.37 %
% of genes from short scaffolds (< 2000 bps) 92.68 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.951 % of family members)
Environment Ontology (ENVO) Unclassified
(26.016 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.276 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.61%    β-sheet: 0.00%    Coil/Unstructured: 51.39%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF00561Abhydrolase_1 47.15
PF12697Abhydrolase_6 45.53
PF07883Cupin_2 2.44
PF01557FAA_hydrolase 1.63
PF12146Hydrolase_4 1.63
PF12695Abhydrolase_5 0.81



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000793|AF_2010_repII_A001DRAFT_10002618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4005Open in IMG/M
3300000955|JGI1027J12803_108768942All Organisms → cellular organisms → Bacteria → Proteobacteria632Open in IMG/M
3300001164|JGI11823J13286_1015064All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300002239|JGI24034J26672_10004296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2013Open in IMG/M
3300002245|JGIcombinedJ26739_101519839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7565Open in IMG/M
3300005105|Ga0066812_1013800All Organisms → cellular organisms → Bacteria → Proteobacteria606Open in IMG/M
3300005363|Ga0008090_10126229All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300005436|Ga0070713_101808846All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae593Open in IMG/M
3300005468|Ga0070707_101901087All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005536|Ga0070697_101749238All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300005549|Ga0070704_101069870All Organisms → cellular organisms → Bacteria → Proteobacteria732Open in IMG/M
3300005553|Ga0066695_10662422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7617Open in IMG/M
3300005564|Ga0070664_101091032All Organisms → cellular organisms → Bacteria → Proteobacteria752Open in IMG/M
3300005569|Ga0066705_10563699All Organisms → cellular organisms → Bacteria → Proteobacteria704Open in IMG/M
3300005575|Ga0066702_10525176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7718Open in IMG/M
3300005713|Ga0066905_100765357All Organisms → cellular organisms → Bacteria → Proteobacteria834Open in IMG/M
3300005713|Ga0066905_101971025All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae541Open in IMG/M
3300005713|Ga0066905_102295078All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae504Open in IMG/M
3300005764|Ga0066903_101785534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71174Open in IMG/M
3300005764|Ga0066903_101953253All Organisms → cellular organisms → Bacteria → Proteobacteria1125Open in IMG/M
3300005764|Ga0066903_103427955All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300005764|Ga0066903_103869662All Organisms → cellular organisms → Bacteria → Proteobacteria804Open in IMG/M
3300005764|Ga0066903_104609494All Organisms → cellular organisms → Bacteria → Proteobacteria734Open in IMG/M
3300005764|Ga0066903_107369487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7568Open in IMG/M
3300005844|Ga0068862_102044936All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae584Open in IMG/M
3300005937|Ga0081455_10517957All Organisms → cellular organisms → Bacteria → Proteobacteria796Open in IMG/M
3300006047|Ga0075024_100263105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria832Open in IMG/M
3300006048|Ga0075363_100184276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1189Open in IMG/M
3300006794|Ga0066658_10583234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7608Open in IMG/M
3300006845|Ga0075421_100723102All Organisms → cellular organisms → Bacteria → Proteobacteria1155Open in IMG/M
3300006871|Ga0075434_102340818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7537Open in IMG/M
3300006953|Ga0074063_10009545All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300007788|Ga0099795_10399495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7624Open in IMG/M
3300009038|Ga0099829_10420813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1105Open in IMG/M
3300009094|Ga0111539_10383176All Organisms → cellular organisms → Bacteria → Proteobacteria1637Open in IMG/M
3300009098|Ga0105245_12813172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7539Open in IMG/M
3300009156|Ga0111538_10267573All Organisms → cellular organisms → Bacteria → Proteobacteria2163Open in IMG/M
3300010046|Ga0126384_10378019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1189Open in IMG/M
3300010046|Ga0126384_10499473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71048Open in IMG/M
3300010047|Ga0126382_10417429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71053Open in IMG/M
3300010048|Ga0126373_10393990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71408Open in IMG/M
3300010359|Ga0126376_11756515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7657Open in IMG/M
3300010366|Ga0126379_12886817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7575Open in IMG/M
3300010376|Ga0126381_100968459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71227Open in IMG/M
3300010398|Ga0126383_10716507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71080Open in IMG/M
3300010398|Ga0126383_12581426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7592Open in IMG/M
3300010868|Ga0124844_1168900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria817Open in IMG/M
3300012189|Ga0137388_10719338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7927Open in IMG/M
3300012205|Ga0137362_10179787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1817Open in IMG/M
3300012209|Ga0137379_11809194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300012354|Ga0137366_10440247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7946Open in IMG/M
3300012469|Ga0150984_117570927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria966Open in IMG/M
3300012503|Ga0157313_1018087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300012685|Ga0137397_10449490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria960Open in IMG/M
3300012930|Ga0137407_11751798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7592Open in IMG/M
3300012948|Ga0126375_10744787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7769Open in IMG/M
3300012971|Ga0126369_12750147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7576Open in IMG/M
3300012985|Ga0164308_11795722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7571Open in IMG/M
3300015077|Ga0173483_10898342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7521Open in IMG/M
3300016387|Ga0182040_11469467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300018031|Ga0184634_10417156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7610Open in IMG/M
3300018066|Ga0184617_1227302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7557Open in IMG/M
3300019866|Ga0193756_1031007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7755Open in IMG/M
3300019867|Ga0193704_1065603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7689Open in IMG/M
3300019871|Ga0193702_1032342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7664Open in IMG/M
3300021168|Ga0210406_10215127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1589Open in IMG/M
3300021377|Ga0213874_10254537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7648Open in IMG/M
3300021478|Ga0210402_11573131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7584Open in IMG/M
3300024055|Ga0247794_10238942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7597Open in IMG/M
3300025910|Ga0207684_10072914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2916Open in IMG/M
3300025914|Ga0207671_10807274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7744Open in IMG/M
3300025916|Ga0207663_10331563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1146Open in IMG/M
3300025922|Ga0207646_11708084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7540Open in IMG/M
3300025931|Ga0207644_11651973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7537Open in IMG/M
3300026075|Ga0207708_10041917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3489Open in IMG/M
3300027381|Ga0208983_1097111All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300027527|Ga0209684_1076436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7523Open in IMG/M
3300027546|Ga0208984_1007235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2039Open in IMG/M
3300027633|Ga0208988_1134101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria602Open in IMG/M
3300027866|Ga0209813_10099768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria986Open in IMG/M
3300027882|Ga0209590_10814112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300028596|Ga0247821_10506853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7768Open in IMG/M
3300028721|Ga0307315_10138471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7734Open in IMG/M
3300028778|Ga0307288_10102831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1042Open in IMG/M
3300028784|Ga0307282_10195622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria966Open in IMG/M
3300028784|Ga0307282_10260105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7834Open in IMG/M
3300028810|Ga0307294_10264334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7614Open in IMG/M
3300028811|Ga0307292_10021887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2258Open in IMG/M
3300028819|Ga0307296_10709321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7549Open in IMG/M
3300028876|Ga0307286_10117727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria940Open in IMG/M
3300030988|Ga0308183_1122413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7615Open in IMG/M
3300031455|Ga0307505_10138419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1107Open in IMG/M
3300031545|Ga0318541_10146799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1292Open in IMG/M
3300031681|Ga0318572_10203870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71155Open in IMG/M
3300031713|Ga0318496_10034536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2568Open in IMG/M
3300031716|Ga0310813_12051805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7540Open in IMG/M
3300031723|Ga0318493_10156146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71183Open in IMG/M
3300031723|Ga0318493_10442185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7714Open in IMG/M
3300031724|Ga0318500_10110765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71258Open in IMG/M
3300031724|Ga0318500_10255632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7851Open in IMG/M
3300031736|Ga0318501_10784244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7527Open in IMG/M
3300031740|Ga0307468_100145919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1509Open in IMG/M
3300031778|Ga0318498_10235303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7828Open in IMG/M
3300031779|Ga0318566_10332634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7750Open in IMG/M
3300031782|Ga0318552_10298148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7819Open in IMG/M
3300031793|Ga0318548_10432686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7644Open in IMG/M
3300031805|Ga0318497_10514701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7670Open in IMG/M
3300031832|Ga0318499_10147418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7918Open in IMG/M
3300031879|Ga0306919_10301878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71215Open in IMG/M
3300031880|Ga0318544_10181799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7810Open in IMG/M
3300031897|Ga0318520_10025009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2908Open in IMG/M
3300031959|Ga0318530_10408191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7563Open in IMG/M
3300031981|Ga0318531_10144018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71065Open in IMG/M
3300032010|Ga0318569_10301618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7745Open in IMG/M
3300032012|Ga0310902_11164279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7542Open in IMG/M
3300032042|Ga0318545_10369994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7516Open in IMG/M
3300032054|Ga0318570_10446125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7590Open in IMG/M
3300032068|Ga0318553_10297324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7844Open in IMG/M
3300032089|Ga0318525_10272549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7869Open in IMG/M
3300032090|Ga0318518_10078398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1621Open in IMG/M
3300032174|Ga0307470_11556924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7551Open in IMG/M
3300033289|Ga0310914_11579982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7559Open in IMG/M
3300034151|Ga0364935_0110464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria850Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.01%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil8.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.06%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.06%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.25%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.63%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.63%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.81%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001164Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1EnvironmentalOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005105Soil and rhizosphere microbial communities from Laval, Canada - mgHPCEnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019871Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A001DRAFT_1000261813300000793Forest SoilRFELIDAVHMMPAQAPAPLLALLQDFLNAQARSTTRQRAG*
JGI1027J12803_10876894223300000955SoilELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS*
JGI11823J13286_101506413300001164Forest SoilASEQFAQAIPNARFELIDAVHMMPAQAAGPLLALLKDFLGAQATSATQQRAS*
JGI24034J26672_1000429613300002239Corn, Switchgrass And Miscanthus RhizosphereAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS*
JGIcombinedJ26739_10151983923300002245Forest SoilFELIDAVHMMPAQAPDALLALLLDFLGAQAASTNRQRAG*
Ga0066812_101380013300005105SoilIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS*
Ga0008090_1012622913300005363Tropical Rainforest SoilFARTIPSARFELIDAVHMMPAQAPDALLALLQDFLGAQPASTTRQRAG*
Ga0070713_10180884613300005436Corn, Switchgrass And Miscanthus RhizosphereAASEQFAKTIPDARFELIDGVHMMPAQASGPLLALLQDFLDAQAAPAARRAKG*
Ga0070707_10190108723300005468Corn, Switchgrass And Miscanthus RhizosphereDARFELIDAVHMMPAQAPDALLALLLDFLGTQAASTTRQRTG*
Ga0070697_10174923823300005536Corn, Switchgrass And Miscanthus RhizosphereFARTIPGARFELIDAVHMMPAQAAAALLALLRDFLGGQARPAARQRVI*
Ga0070704_10106987013300005549Corn, Switchgrass And Miscanthus RhizospherePAASEQFAQTIPAARFELIDAVHMMPAQAAGPLLALLEDFLPAQAASAAQQRAS*
Ga0066695_1066242213300005553SoilARFELIDAVHMMPAQAPAALLALLQDFLGGEAQSVTRQRAG*
Ga0070664_10109103213300005564Corn RhizosphereAQTIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASSAKQRAS*
Ga0066705_1056369923300005569SoilSIPGARFELIDAVHMMPAQAPAALLALLQDFLHGQTRSATQQRVG*
Ga0066702_1052517613300005575SoilARFELIDAVHMMPAQAPAALLALLQDFLQGQTRSPARQRAG*
Ga0066905_10076535713300005713Tropical Forest SoilEQFARTIPGARFELIDAVHMMPAQAAAALLALLQDFLGAQPASATQERAG*
Ga0066905_10197102523300005713Tropical Forest SoilEQMAREIRGARFELIDAVHMMPAQAPGPLLALLKDFLTTAAAPQAQGASQTS*
Ga0066905_10229507813300005713Tropical Forest SoilEQFARTIPGARFELIDAVHMMPAQAAAALLALLQDFLGAQSASATQQRAG*
Ga0066903_10178553433300005764Tropical Forest SoilAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG*
Ga0066903_10195325313300005764Tropical Forest SoilLARDIPGARFEAIDAVHMLPAQAPDALLALLDDFLTAHAAGAAQRAH*
Ga0066903_10342795513300005764Tropical Forest SoilIPGARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTLQRAG*
Ga0066903_10386966213300005764Tropical Forest SoilARFELIDAVHMMPAQAPHALLALIEDFLRSEPGAQHGASAASAGRQRAG*
Ga0066903_10460949423300005764Tropical Forest SoilIPSARFELIDGVHMMPAQAAPVLLALLQDFLGAQAASTADTRRVKG*
Ga0066903_10736948723300005764Tropical Forest SoilRFELIDAVHMMPAQAPAALLALLQDFLGSQARPATRQRAS*
Ga0068862_10204493613300005844Switchgrass RhizospherePPAASEQFAQTIPAARFELIDAVHMMPAQAAGPLLALLEDFLPAQAASAAQQRAS*
Ga0081455_1051795723300005937Tabebuia Heterophylla RhizosphereIPGARFELIDACHMMPAQAPDLLLPLLTNFLTRHAASAA*
Ga0075024_10026310513300006047WatershedsFELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS*
Ga0075363_10018427633300006048Populus EndosphereFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS*
Ga0066658_1058323413300006794SoilAVHMMPAQAPEALLALLQDFLGGQARPAARQRAS*
Ga0075421_10072310233300006845Populus RhizosphereQFAQTIPAARFELIDAVHMMPAQAAGPLLALLEDFLPAQAASAAQQRAS*
Ga0075434_10234081813300006871Populus RhizosphereARFELIDAVHMMPAQAPAALLALLQDFLHAQTRSAPRQRAG*
Ga0074063_1000954523300006953SoilPDARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG*
Ga0099795_1039949513300007788Vadose Zone SoilIPGARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG*
Ga0099829_1042081323300009038Vadose Zone SoilARFELIDAVHMMPAQAAGPLLALLEDFLGAQSASTTQQRAS*
Ga0111539_1038317613300009094Populus RhizospherePDARFELIDAVHMMPAQAPAALLALLQDFLQGQTRSPARQRAG*
Ga0105245_1281317223300009098Miscanthus RhizospherePDARFELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS*
Ga0111538_1026757313300009156Populus RhizosphereFAETIPDVRFELIDAVHMMPAQAARELLALLQDFLSAQDAATQGTRRVKG*
Ga0126384_1037801933300010046Tropical Forest SoilIRGARFELIDAVHMMPAQAPGPLLALLKDFLTTAAAPQAQGASQTS*
Ga0126384_1049947323300010046Tropical Forest SoilARTIPGARFELIDAVHMMPAQAAHALLALLQDFFGAQAASATQQRAG*
Ga0126382_1041742913300010047Tropical Forest SoilRFELIDAVHMMPAQAAAALLALLQDFLGAQPASATQQRVG*
Ga0126373_1039399033300010048Tropical Forest SoilFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG*
Ga0126376_1175651523300010359Tropical Forest SoilTIPGARFELIDAVHMMPAQAAHALLALLQDFLGAQAVSATQQRAG*
Ga0126379_1288681713300010366Tropical Forest SoilPPAASEQFARTIPGVRFELIDAVHMMPAQAADALLTLLQDFLGAQAASTTRQRAG*
Ga0126381_10096845933300010376Tropical Forest SoilAASEQFARTIPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRTG*
Ga0126383_1071650723300010398Tropical Forest SoilIPGARFELIDAVHMMPAQAAAALLALLQDFLGAQAASATQQRAG*
Ga0126383_1258142623300010398Tropical Forest SoilEQFAQTIPGARFELIDAVHMMPAQAPAPLLALLQDFLNAQARSTTRQRAG*
Ga0124844_116890023300010868Tropical Forest SoilLIDAVHMMPAQAPGPLLALLKSFLTTATASPAQRASR*
Ga0137388_1071933823300012189Vadose Zone SoilEQFAQTIPHARFELIDAVHMMPAQAAGPLLALLEDFLGAQPASTTQQRAS*
Ga0137362_1017978713300012205Vadose Zone SoilASEQFARTIPGARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG*
Ga0137379_1180919413300012209Vadose Zone SoilLIDAVHMMPAQAAGALLALLEDFLPAQSAAQQRAN*
Ga0137366_1044024723300012354Vadose Zone SoilFARTVPGARFELIDAVHMMPAQAPAALLALLQDFLGGEAQSVTRQRAG*
Ga0150984_11757092713300012469Avena Fatua RhizosphereIPYARFELIDAVHMMPAQAAGALLALLEDFLGKQAASTAKQRAS*
Ga0157313_101808713300012503Arabidopsis RhizosphereASEQFAQTIPGARFELIDGVHMMPAQAAPVLLALLQDFLGAQAAATEGARRVKG*
Ga0137397_1044949013300012685Vadose Zone SoilTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASAAPRRAS*
Ga0137407_1175179823300012930Vadose Zone SoilPGVRFELIDAVHMMPAQAAGPLLALLQDFLGAQAASTTQQRAG*
Ga0126375_1074478723300012948Tropical Forest SoilGARFELIDAVHMMPAQAPAALLALLQDFLGSQARPATRQRAS*
Ga0126369_1275014723300012971Tropical Forest SoilEQFARTIPGARFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTQQRAG*
Ga0164308_1179572213300012985SoilRFELIDAVHMMPAQAAGPLLALLNDFLGAQAASAAPRRAS*
Ga0173483_1089834213300015077SoilRFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS*
Ga0182040_1146946713300016387SoilFELIDAVHMMPAQAPAALLPLLEDFLTAPAGAGARAAAQSR
Ga0184634_1041715613300018031Groundwater SedimentTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS
Ga0184617_122730213300018066Groundwater SedimentARFELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS
Ga0193756_103100723300019866SoilQTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASAAPRRAS
Ga0193704_106560323300019867SoilASEQFAQTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASAAPRRAS
Ga0193702_103234223300019871SoilLIDAVHMMPAQAAGPLLALLNDFLGAHAASAAPRRAS
Ga0210406_1021512713300021168SoilQTIPDARFELIDAVHMMPAQAPAALLALLQDFLQGQTRSPARQRAG
Ga0213874_1025453713300021377Plant RootsIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0210402_1157313113300021478SoilRFELIDAVHMMPAQAPAALLALLQDFLQGQTRSPARQRAG
Ga0247794_1023894213300024055SoilTIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS
Ga0207684_1007291413300025910Corn, Switchgrass And Miscanthus RhizosphereARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0207671_1080727423300025914Corn RhizosphereAQTIPDARFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS
Ga0207663_1033156323300025916Corn, Switchgrass And Miscanthus RhizosphereDVRFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS
Ga0207646_1170808423300025922Corn, Switchgrass And Miscanthus RhizosphereELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0207644_1165197323300025931Switchgrass RhizosphereAASEQFAQTIPAARFELIDAVHMMPAQAAGPLLALLEDFLPAQAASAAQQRAS
Ga0207708_1004191753300026075Corn, Switchgrass And Miscanthus RhizosphereDARFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS
Ga0208983_109711123300027381Forest SoilPPAASEQFAQAIPNARFELIDAVHMMPAQAAGPLLALLKDFLGAQATSATQQRAS
Ga0209684_107643623300027527Tropical Forest SoilASEQFARTIPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG
Ga0208984_100723513300027546Forest SoilRPPAASEQFAQAIPNARFELIDAVHMMPAQAAGPLLALLKDFLGAQATSATQQRAS
Ga0208988_113410113300027633Forest SoilKTIPGARFELIDAVHMMPAQAPAPLLALLTDFLGAQAASNAQRAS
Ga0209813_1009976813300027866Populus EndosphereRFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS
Ga0209590_1081411223300027882Vadose Zone SoilRAIPGARFELIDAGHMMPAQAPGPLLRLLQDFLAVHAAHAG
Ga0247821_1050685313300028596SoilPDARFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS
Ga0307315_1013847123300028721SoilEQFAKTIPGARFELIDAVHMMPAQAPGPLLALLTDFLGAQAASNAQRAS
Ga0307288_1010283113300028778SoilASEQFAQTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAQAASAAPRRAS
Ga0307282_1019562223300028784SoilEQFAKTIPGARFELIDAVHMMPAQAPGPLLALLTDFLGAQAASSAQHAS
Ga0307282_1026010513300028784SoilAQTIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTVKQRAS
Ga0307294_1026433423300028810SoilSEQFAQTIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS
Ga0307292_1002188733300028811SoilFAKTIPGVRFELIDAVHMMPAQAPGPLLALLTDFLGAQAASNAQRAS
Ga0307296_1070932123300028819SoilFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS
Ga0307286_1011772723300028876SoilIDAVHMMPAQAAGPLLALLEDFLGKQAASTVKQRAS
Ga0308183_112241313300030988SoilSEQFAQTIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAQQRAS
Ga0307505_1013841923300031455SoilQTIPDARFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS
Ga0318541_1014679933300031545SoilTIPGARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG
Ga0318572_1020387013300031681SoilARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG
Ga0318496_1003453643300031713SoilEEFARTIPGARFELIDAVHMMPAQAAGSLLALLEDFLSTQAAARQGAQ
Ga0310813_1205180523300031716SoilRFELIDAVHMMPAQAPAALLALLQDFLHAQTRSAPRQRAG
Ga0318493_1015614623300031723SoilTIPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG
Ga0318493_1044218513300031723SoilDAVHMMPAQAPAPLLALLLDFFNAQTRSTTRQRAG
Ga0318500_1011076533300031724SoilIPDARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0318500_1025563213300031724SoilGARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG
Ga0318501_1078424413300031736SoilLIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0307468_10014591913300031740Hardwood Forest SoilELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS
Ga0318498_1023530323300031778SoilAASEQFARTIPGARFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG
Ga0318566_1033263423300031779SoilLIDAVHMMPAQAAHALLALLQDFLGAQAASATQQRAG
Ga0318552_1029814823300031782SoilIPGARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG
Ga0318548_1043268623300031793SoilFARTIPDARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0318497_1051470123300031805SoilRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTQQRAG
Ga0318499_1014741823300031832SoilARTIPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG
Ga0306919_1030187833300031879SoilRFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0318544_1018179923300031880SoilELIDAVHMMPAQAPDALLALLHDFLGAQAASTTRQRTG
Ga0318520_1002500943300031897SoilEFARTIPGARFELIDAVHMMPAQAAGSLLALLEDFLSTQAAARQGAQ
Ga0318530_1040819123300031959SoilQFAQTIPGARFELIDAVHMMPAQAPAPLLALLLDFFNAQTRSTTRQRAG
Ga0318531_1014401823300031981SoilFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG
Ga0318569_1030161813300032010SoilTIPGARFELIDAVHMMPAQAPAPLLALLLDFFNAQTRSTTRQRAG
Ga0310902_1116427913300032012SoilDARFELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS
Ga0318545_1036999423300032042SoilARTIPDARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0318570_1044612513300032054SoilKTSEEFARTIPGARFELIDAVHMMPAQAAGSLLALLEDFLSTQAAARQGAQ
Ga0318553_1029732413300032068SoilDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0318525_1027254913300032089SoilYELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG
Ga0318518_1007839833300032090SoilIPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG
Ga0307470_1155692423300032174Hardwood Forest SoilQFAQTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS
Ga0310914_1157998223300033289SoilIDAVHMMPAQAAGALLALLQDFLGAQAASTSQQRAG
Ga0364935_0110464_3_1253300034151SedimentRFELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.