NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F069721

Metatranscriptome Family F069721

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069721
Family Type Metatranscriptome
Number of Sequences 123
Average Sequence Length 120 residues
Representative Sequence MFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Number of Associated Samples 96
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 88.62 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(52.846 % of family members)
Environment Ontology (ENVO) Unclassified
(88.618 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(72.358 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 30.77%    Coil/Unstructured: 69.23%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300007341|Ga0079228_1253430All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae598Open in IMG/M
3300009025|Ga0103707_10052256All Organisms → cellular organisms → Eukaryota → Sar742Open in IMG/M
3300009356|Ga0103835_1014755All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae572Open in IMG/M
3300009543|Ga0115099_10746139All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae912Open in IMG/M
3300009677|Ga0115104_10193382All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae600Open in IMG/M
3300009677|Ga0115104_10525505All Organisms → cellular organisms → Eukaryota → Sar576Open in IMG/M
3300009677|Ga0115104_10615158All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae589Open in IMG/M
3300009679|Ga0115105_10822792All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae604Open in IMG/M
3300009679|Ga0115105_11055615All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae570Open in IMG/M
3300009679|Ga0115105_11376621All Organisms → cellular organisms → Eukaryota → Sar562Open in IMG/M
3300012412|Ga0138266_1313299All Organisms → cellular organisms → Eukaryota → Sar652Open in IMG/M
3300012413|Ga0138258_1502491All Organisms → cellular organisms → Eukaryota → Sar660Open in IMG/M
3300012414|Ga0138264_1779138All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae533Open in IMG/M
3300012415|Ga0138263_1382102All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae595Open in IMG/M
3300012416|Ga0138259_1325686All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae733Open in IMG/M
3300012419|Ga0138260_10416442All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae612Open in IMG/M
3300012470|Ga0129329_1098774All Organisms → cellular organisms → Eukaryota → Sar510Open in IMG/M
3300018530|Ga0193521_103148All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae598Open in IMG/M
3300018618|Ga0193204_1017677All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae550Open in IMG/M
3300018625|Ga0192842_1033520All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae557Open in IMG/M
3300018655|Ga0192846_1030375All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae570Open in IMG/M
3300018658|Ga0192906_1033251All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae579Open in IMG/M
3300018674|Ga0193166_1026024All Organisms → cellular organisms → Eukaryota → Sar550Open in IMG/M
3300018692|Ga0192944_1041342All Organisms → cellular organisms → Eukaryota → Sar667Open in IMG/M
3300018702|Ga0193439_1031784All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae579Open in IMG/M
3300018702|Ga0193439_1034672All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae554Open in IMG/M
3300018742|Ga0193138_1040299All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae615Open in IMG/M
3300018742|Ga0193138_1041707All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae604Open in IMG/M
3300018742|Ga0193138_1042776All Organisms → cellular organisms → Eukaryota → Sar596Open in IMG/M
3300018742|Ga0193138_1043039All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae594Open in IMG/M
3300018742|Ga0193138_1045699All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae576Open in IMG/M
3300018746|Ga0193468_1051085All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae596Open in IMG/M
3300018746|Ga0193468_1051226All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae595Open in IMG/M
3300018746|Ga0193468_1052489All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae586Open in IMG/M
3300018746|Ga0193468_1052645All Organisms → cellular organisms → Eukaryota → Sar585Open in IMG/M
3300018762|Ga0192963_1050026All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae691Open in IMG/M
3300018776|Ga0193407_1054377All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae578Open in IMG/M
3300018776|Ga0193407_1055698All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae571Open in IMG/M
3300018779|Ga0193149_1048015All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae608Open in IMG/M
3300018779|Ga0193149_1049187All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae600Open in IMG/M
3300018779|Ga0193149_1050000All Organisms → cellular organisms → Eukaryota → Sar595Open in IMG/M
3300018787|Ga0193124_1054150All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae600Open in IMG/M
3300018787|Ga0193124_1066128All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae544Open in IMG/M
3300018788|Ga0193085_1057315All Organisms → cellular organisms → Eukaryota → Sar598Open in IMG/M
3300018801|Ga0192824_1090089All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae584Open in IMG/M
3300018825|Ga0193048_1057616All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae588Open in IMG/M
3300018825|Ga0193048_1060106All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae575Open in IMG/M
3300018825|Ga0193048_1069644All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae532Open in IMG/M
3300018827|Ga0193366_1071157All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae513Open in IMG/M
3300018830|Ga0193191_1063750All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae599Open in IMG/M
3300018831|Ga0192949_1066523All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae716Open in IMG/M
3300018870|Ga0193533_1101356All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae605Open in IMG/M
3300018871|Ga0192978_1071672All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae640Open in IMG/M
3300018881|Ga0192908_10050324All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae525Open in IMG/M
3300018913|Ga0192868_10060303All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae598Open in IMG/M
3300018955|Ga0193379_10201119All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae547Open in IMG/M
3300018967|Ga0193178_10046874All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae639Open in IMG/M
3300018975|Ga0193006_10240511All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae522Open in IMG/M
3300018977|Ga0193353_10245139All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae511Open in IMG/M
3300018980|Ga0192961_10170455All Organisms → cellular organisms → Eukaryota → Sar660Open in IMG/M
3300018989|Ga0193030_10177667All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae697Open in IMG/M
3300019027|Ga0192909_10154801All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae649Open in IMG/M
3300019027|Ga0192909_10234306All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae559Open in IMG/M
3300019031|Ga0193516_10308639All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae506Open in IMG/M
3300019036|Ga0192945_10152301All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae744Open in IMG/M
3300019036|Ga0192945_10154745All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae738Open in IMG/M
3300019054|Ga0192992_10281488All Organisms → cellular organisms → Eukaryota → Sar570Open in IMG/M
3300019084|Ga0193051_107349All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae703Open in IMG/M
3300019084|Ga0193051_107473All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae698Open in IMG/M
3300019097|Ga0193153_1030195All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae556Open in IMG/M
3300019097|Ga0193153_1030210All Organisms → cellular organisms → Eukaryota → Sar556Open in IMG/M
3300019097|Ga0193153_1030418All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae554Open in IMG/M
3300019118|Ga0193157_1027508All Organisms → cellular organisms → Eukaryota → Sar589Open in IMG/M
3300019118|Ga0193157_1036926All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae511Open in IMG/M
3300019150|Ga0194244_10118857All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae513Open in IMG/M
3300021350|Ga0206692_1810606All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae589Open in IMG/M
3300021875|Ga0063146_116343All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae784Open in IMG/M
3300021889|Ga0063089_1044718All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae760Open in IMG/M
3300021890|Ga0063090_1054315All Organisms → cellular organisms → Eukaryota → Sar561Open in IMG/M
3300021905|Ga0063088_1101445All Organisms → cellular organisms → Eukaryota → Sar665Open in IMG/M
3300021912|Ga0063133_1009075All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae604Open in IMG/M
3300021923|Ga0063091_1077478All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae676Open in IMG/M
3300021925|Ga0063096_1018571All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae696Open in IMG/M
3300021926|Ga0063871_1056239All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae539Open in IMG/M
3300021927|Ga0063103_1162273All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300021930|Ga0063145_1057031All Organisms → cellular organisms → Eukaryota → Sar604Open in IMG/M
3300021936|Ga0063092_1080324All Organisms → cellular organisms → Eukaryota → Sar567Open in IMG/M
3300021940|Ga0063108_1075879All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae531Open in IMG/M
3300021942|Ga0063098_1013703All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae592Open in IMG/M
3300030653|Ga0307402_10433947All Organisms → cellular organisms → Eukaryota → Sar759Open in IMG/M
3300030653|Ga0307402_10719826All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae581Open in IMG/M
3300030670|Ga0307401_10290599All Organisms → cellular organisms → Eukaryota → Sar742Open in IMG/M
3300030670|Ga0307401_10377548All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae644Open in IMG/M
3300030671|Ga0307403_10615900All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae589Open in IMG/M
3300030699|Ga0307398_10388641All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae764Open in IMG/M
3300030702|Ga0307399_10586356All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae550Open in IMG/M
3300030720|Ga0308139_1038161All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae713Open in IMG/M
3300030721|Ga0308133_1032851All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae706Open in IMG/M
3300030724|Ga0308138_1038251All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae679Open in IMG/M
3300030726|Ga0308126_1049992All Organisms → cellular organisms → Eukaryota → Sar595Open in IMG/M
3300030865|Ga0073972_11412017All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae557Open in IMG/M
3300030952|Ga0073938_12249077All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae562Open in IMG/M
3300030956|Ga0073944_11374420All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae557Open in IMG/M
3300030957|Ga0073976_11710324All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae598Open in IMG/M
3300031522|Ga0307388_10555189All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae760Open in IMG/M
3300031542|Ga0308149_1026956All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae721Open in IMG/M
3300031570|Ga0308144_1032005All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae655Open in IMG/M
3300031579|Ga0308134_1081661All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae736Open in IMG/M
3300031579|Ga0308134_1121456All Organisms → cellular organisms → Eukaryota → Sar600Open in IMG/M
3300031580|Ga0308132_1088070All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae638Open in IMG/M
3300031674|Ga0307393_1085645All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae678Open in IMG/M
3300031709|Ga0307385_10348696All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae564Open in IMG/M
3300031710|Ga0307386_10400522All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae706Open in IMG/M
3300031717|Ga0307396_10258815All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae830Open in IMG/M
3300031725|Ga0307381_10184339All Organisms → cellular organisms → Eukaryota → Sar725Open in IMG/M
3300031729|Ga0307391_10607918All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae619Open in IMG/M
3300031734|Ga0307397_10283615All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae749Open in IMG/M
3300031739|Ga0307383_10344745All Organisms → cellular organisms → Eukaryota → Sar726Open in IMG/M
3300031742|Ga0307395_10395781All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae600Open in IMG/M
3300031743|Ga0307382_10275677All Organisms → cellular organisms → Eukaryota → Sar754Open in IMG/M
3300031750|Ga0307389_11214378All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae505Open in IMG/M
3300031752|Ga0307404_10266437All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae710Open in IMG/M
3300033572|Ga0307390_10524092All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Dictyochophyceae735Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine52.85%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine39.02%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine4.88%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.81%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.81%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.81%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300007341Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S2 Surf_B metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009356Microbial communities of water from the North Atlantic ocean - ACM16EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018530Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002103 (ERX1789596-ERR1719514)EnvironmentalOpen in IMG/M
3300018618Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000071 (ERX1782354-ERR1712005)EnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018702Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002354 (ERX1789558-ERR1719169)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018788Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000933 (ERX1789381-ERR1719390)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018827Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782415-ERR1712182)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018881Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782151-ERR1712094)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021923Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-8M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021926Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 ARK-20-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021936Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-15M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030726Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1292_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030865Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030952Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030957Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0079228_125343013300007341MarineHNFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA*
Ga0103707_1005225623300009025Ocean WaterLGSSARVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA*
Ga0103835_101475513300009356River WaterQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA*
Ga0115099_1074613913300009543MarineSKTSMFKLITATLLVAYVLADTNSTNSSAFYICEPTGMAKHVGTYSAKGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGEFPPLVQFETNAKKAKDPAPVIQTTPCEP*
Ga0115104_1019338213300009677MarineNNFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA*
Ga0115104_1052550513300009677MarineAHKLRATMFKLCILALVAICALAGEKDIYYICPPTGMPQHVGNYTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPVIQTTPCES*
Ga0115104_1061515813300009677MarineERQAHTNPPPAMFKLCILALVAVCALAGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQTTPCES*
Ga0115105_1082279213300009679MarineRHNFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA*
Ga0115105_1105561513300009679MarineMFKLCILALVAVCALAGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQTTPCES*
Ga0115105_1137662113300009679MarineAMFKLCILALVAICALAGEKDIYYICPPTGMPQHVGNYTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPVIQTTPCES*
Ga0138266_131329913300012412Polar MarineGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQASPCEA*
Ga0138258_150249113300012413Polar MarineTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPPRHPGQSLRSINACC*
Ga0138264_177913813300012414Polar MarineTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA*
Ga0138263_138210213300012415Polar MarineQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA*
Ga0138259_132568613300012416Polar MarineMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA*
Ga0138260_1041644213300012419Polar MarineGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA*
Ga0129329_109877413300012470AqueousSKTSMFKLITATLLVAYVLADTNSTNSSAFYICEPTGMAKHVGTYSAKGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQDTPCQA*
Ga0193521_10314813300018530MarineHNFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193204_101767713300018618MarineGLVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0192842_103352013300018625MarineETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0192846_103037513300018655MarineMGCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0192906_103325113300018658MarineERQAHTNPPPAMFKLCILALVAVCALAGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQTTPCES
Ga0193166_102602413300018674MarineHGLAGEKDIYYICPPTGMPQHVGNYTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPVIQTTPCES
Ga0192944_104134213300018692MarineAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0193439_103178413300018702MarineMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193439_103467213300018702MarineTTRATPAATMFKLCILALVAVCVFAGETDTFYICPPTGMSKHVGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQSAPCES
Ga0193138_104029913300018742MarineDKAHQRKHLSAMFKLCILALVAVCALAGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQATPCES
Ga0193138_104170713300018742MarineNFAPPQHHTQAMFKLCVLALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193138_104277613300018742MarineHKLKSTQARATMFKLCILALVAICALAGEKDIYYICPPTGMPQHVGNYTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPVIQTTPCES
Ga0193138_104303913300018742MarineFAPQQHTAMFKLCILALVAICATAGETDIFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193138_104569913300018742MarineMFKLCILALVAVCALAGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQTTPCES
Ga0193468_105108513300018746MarineETNNFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQATPCES
Ga0193468_105122613300018746MarineNFAPQQHTAMFKLCILALVAICATAGETDIFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193468_105248913300018746MarineMFKLCTLALVAVCALAGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQATPCES
Ga0193468_105264513300018746MarineHKLRATMFKLCILALVAICALAGEKDIYYICPPTGMPQHVGNYTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPVIQTTPCES
Ga0192963_105002613300018762MarineTTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0193407_105437713300018776MarineRHNFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193407_105569813300018776MarineNFAPPQHHTQAMFKLCILALVAICATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193149_104801513300018779MarineAHQRKHLSAMFKLCILALVAVCALAGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQATPCES
Ga0193149_104918713300018779MarineQRHNFAPQQHTAMFKLCILALVAICATAGETDIFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193149_105000013300018779MarineMFKLCILALVAICALAGEKDIYYICPPTGMPQHVGNYTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPVIQTTPCES
Ga0193124_105415013300018787MarineRHNFAPQQHTAMFKLCILALVAICATAGETDIFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193124_106612823300018787MarineMFKLCILALVAVCVFAGETDTFYICPPTGMSKHVGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQSAPCES
Ga0193085_105731513300018788MarineKSTQARATMFKLCILALVAICALAGEKDIYYICPPTGMPQHVGNYTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPVIQTTPCES
Ga0192824_109008913300018801MarineNFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193048_105761613300018825MarineQQHTAMFKLCILALVAICATAGETDIFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193048_106010613300018825MarineQAHTNPPPAMFKLCILALVAVCALAGENDTLYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQTTPCES
Ga0193048_106964413300018825MarineEDKAHQRKHLSAMFKLCILALVAVCALAGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQATPCES
Ga0193366_107115713300018827MarineWGYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQTTPCES
Ga0193191_106375013300018830MarineRHNFAPPQHHTQAMFKLCILALVAICATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0192949_106652313300018831MarineTTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0193533_110135613300018870MarineTRHNFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0192978_107167223300018871MarineTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0192908_1005032413300018881MarineMGDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0192868_1006030313300018913MarineMGTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193379_1020111913300018955MarineAPPQHHTQAMLKLCILALVAICATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193178_1004687413300018967MarinePQHHTQAMFKLCILALVAICATAGETDIFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193006_1024051113300018975MarineHGYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193353_1024513913300018977MarineGYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0192961_1017045513300018980MarineGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0193030_1017766713300018989MarineMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQATPCES
Ga0192909_1015480113300019027MarineHGGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQATPCES
Ga0192909_1023430613300019027MarineHGLALVAVCALAGENDTFYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQTTPCES
Ga0193516_1030863913300019031MarineICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQTTPCES
Ga0192945_1015230113300019036MarineTWELIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0192945_1015474513300019036MarineTWELIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0192992_1028148813300019054MarineMGSTISSARPTMCKLCILALVAVCALAGENDVFFICPPTGMPQHVGNYTASGFQDGISKYTNTGGTSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQSTPCES
Ga0193051_10734913300019084MarineQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0193051_10747313300019084MarineQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0193153_103019513300019097MarineMGVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0193153_103021013300019097MarineFKLCILALVAICALAGEKDIYYICPPTGMPQHVGNYTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPVIQTTPCES
Ga0193153_103041813300019097MarineMGYICPPVGSAQHIGNFTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQTTPCES
Ga0193157_102750813300019118MarineLLVAICALAGEKDIYYICPPTGMPQHVGNYTAKGFQDGISKYTNKAGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPVIQTTPCES
Ga0193157_103692613300019118MarineMGYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0194244_1011885713300019150MarineICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0206692_181060613300021350SeawaterSKTSMFKLITATLLVAYVLADTNSTNSSAFYICEPTGMAKHVGTYSAKGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGEFPPLVQFETNAKKAKDPAPVIQTTPCEP
Ga0063146_11634313300021875MarineNSKTSMFKLITATLLVAYVLADTNSTNSSAFYICEPTGMAKHVGTYSAKGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGEFPPLVQFETNAKKAKDPAPVIQTTPCEP
Ga0063089_104471813300021889MarineLLVAYVLADTNSTNSSAFYICEPTGMAKHVGTYSAKGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGEFPPLVQFETNAKKAKDPAPVIQTTPCEP
Ga0063090_105431513300021890MarineQTTTKMFKFAIASLIVACVLADTNITNSTSFYICEPTGMAKHVGTYSARGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQDTPCQA
Ga0063088_110144513300021905MarineKTSMFKLITATLLVAYVLADTNSTNSSAFYICEPTGMAKHVGTYSAKGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGEFPPLVQFETNAKKAKDPAPVIQTTPCEP
Ga0063133_100907513300021912MarineSHNFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0063091_107747813300021923MarineKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVSSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0063096_101857113300021925MarineHTKTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVSSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0063871_105623913300021926MarineKTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVSSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCE
Ga0063103_116227313300021927MarineIASLIVACVLADTNITNSTSFYICEPTGMAKHVGTYSARGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQDTPCQA
Ga0063145_105703113300021930MarineTTKMFKFAIASLIVACVLADTNITNSTSFYICEPTGMAKHVGTYSARGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQDTPCQA
Ga0063092_108032413300021936MarineTTTKMFKFAIASLIVACVLADTNITNSTSFYICEPTGMAKHVGTYSARGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQDTPCQA
Ga0063108_107587913300021940MarineAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVSSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0063098_101370313300021942MarineHTKTTKMFKLIAALMIVCAFAGENDTFYICTPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVSSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307402_1043394713300030653MarineMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0307402_1071982613300030653MarineHKSQSTTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307401_1029059913300030670MarineMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQASPCEA
Ga0307401_1037754813300030670MarineADPTDTPTHKSQSTTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307403_1061590013300030671MarineQSTTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307398_1038864113300030699MarineMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307399_1058635613300030702MarineQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQASPCEA
Ga0308139_103816113300030720MarineTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQATPCE
Ga0308133_103285113300030721MarineQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0308138_103825113300030724MarineKTTKMFKLIAALMIVCAFAGENDTFYICTPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCE
Ga0308126_104999213300030726MarineTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCE
Ga0073972_1141201713300030865MarineHNFAPPQHHTQAMLKLCILALVAICATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0073938_1224907713300030952MarineAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0073944_1137442013300030956MarineTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0073976_1171032413300030957MarineFAPPQHHTQAMFKLCILALVAVCATAGETDTFYICPPTGMTKHLGNYTAKGFQDGISKYTNKEGMSIYRHNGYWYIGDVRNWPPTTHYRCVSDCPKDEELPPLVQFETNAKKAKDPAPTIQKTPCEA
Ga0307388_1055518913300031522MarineTSTTQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQASPCEA
Ga0308149_102695613300031542MarineTTQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0308144_103200513300031570MarineGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0308134_108166113300031579MarineITSTTQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0308134_112145613300031579MarineKMFKFAIASLIVACVLADTNITNSTSFYICEPTGMAKHVGTYSARGYQDGIAKYTNKAGISIYRHNGYWYIGDVTNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQDTPCQA
Ga0308132_108807013300031580MarineTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCE
Ga0307393_108564513300031674MarineQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307385_1034869613300031709MarineTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307386_1040052213300031710MarineHTTQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0307396_1025881513300031717MarineILPTLPHKSQSTTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307381_1018433913300031725MarineQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQTNPCEA
Ga0307391_1060791813300031729MarinePTLPTHKSQSTTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307397_1028361513300031734MarineSQSTTQTTTKMFKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA
Ga0307383_1034474513300031739MarineIATHKSHTTQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0307395_1039578113300031742MarineTTQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQASPCEA
Ga0307382_1027567713300031743MarineMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQTNPCEA
Ga0307389_1121437813300031750MarineMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGESPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0307404_1026643713300031752MarineQTTTKMFKLIAALMIVCAFAGENDTFYICPPTGMAKHIGNYTAKGFQDGVSKYTNKVSGMSIYRNNGYWYVGDVNNWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPVIQATPCEA
Ga0307390_1052409213300033572MarinePHNKQPTTKMVKLVAALMIVCAFAGENDTFYICPPTGMAKHIGNYTATGFQDGISKYTNKASGVSIYRHNGYWYIGDVTSWPPTTHYRCVSDCEKDGETPPLVQFETNAKKAKDPAPAIQATPCEA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.