Basic Information | |
---|---|
Family ID | F069041 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 43 residues |
Representative Sequence | MAMTVQQIHPVAHLPLVLGVLRRLEVATVIDRLIPPHPAH |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.58 % |
% of genes near scaffold ends (potentially truncated) | 91.94 % |
% of genes from short scaffolds (< 2000 bps) | 94.35 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.903 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (18.548 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.452 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF01609 | DDE_Tnp_1 | 2.42 |
PF14104 | DUF4277 | 1.61 |
PF01656 | CbiA | 1.61 |
PF13551 | HTH_29 | 0.81 |
PF12821 | ThrE_2 | 0.81 |
PF13414 | TPR_11 | 0.81 |
PF13613 | HTH_Tnp_4 | 0.81 |
PF13546 | DDE_5 | 0.81 |
PF13384 | HTH_23 | 0.81 |
PF13560 | HTH_31 | 0.81 |
PF10073 | DUF2312 | 0.81 |
PF13751 | DDE_Tnp_1_6 | 0.81 |
PF08352 | oligo_HPY | 0.81 |
PF00413 | Peptidase_M10 | 0.81 |
PF13683 | rve_3 | 0.81 |
PF14714 | KH_dom-like | 0.81 |
PF07508 | Recombinase | 0.81 |
PF03400 | DDE_Tnp_IS1 | 0.81 |
PF02899 | Phage_int_SAM_1 | 0.81 |
PF00884 | Sulfatase | 0.81 |
PF01370 | Epimerase | 0.81 |
PF00565 | SNase | 0.81 |
PF05685 | Uma2 | 0.81 |
PF03811 | Zn_Tnp_IS1 | 0.81 |
PF13586 | DDE_Tnp_1_2 | 0.81 |
PF05943 | VipB | 0.81 |
PF04392 | ABC_sub_bind | 0.81 |
PF05378 | Hydant_A_N | 0.81 |
PF00078 | RVT_1 | 0.81 |
PF00199 | Catalase | 0.81 |
PF13592 | HTH_33 | 0.81 |
PF00400 | WD40 | 0.81 |
PF05598 | DUF772 | 0.81 |
PF15919 | HicB_lk_antitox | 0.81 |
PF02578 | Cu-oxidase_4 | 0.81 |
PF00528 | BPD_transp_1 | 0.81 |
PF06782 | UPF0236 | 0.81 |
PF02371 | Transposase_20 | 0.81 |
PF12770 | CHAT | 0.81 |
PF04191 | PEMT | 0.81 |
PF13431 | TPR_17 | 0.81 |
PF10082 | BBP2_2 | 0.81 |
PF00589 | Phage_integrase | 0.81 |
PF00005 | ABC_tran | 0.81 |
PF02369 | Big_1 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.42 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.42 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.42 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.42 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.42 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.42 |
COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.61 |
COG3517 | Predicted component TssB of the type VI protein secretion system, VipA/VipB/TssB family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.81 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.81 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.81 |
COG3677 | Transposase InsA | Mobilome: prophages, transposons [X] | 0.81 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.81 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.81 |
COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.81 |
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.71 % |
Unclassified | root | N/A | 11.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c0328539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 589 | Open in IMG/M |
3300000550|F24TB_10302173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 628 | Open in IMG/M |
3300000858|JGI10213J12805_10481384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Acaryochloridaceae → Acaryochloris | 781 | Open in IMG/M |
3300000890|JGI11643J12802_10353520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1689 | Open in IMG/M |
3300000955|JGI1027J12803_108821334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 972 | Open in IMG/M |
3300003324|soilH2_10332819 | Not Available | 1861 | Open in IMG/M |
3300004633|Ga0066395_10288705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 893 | Open in IMG/M |
3300004633|Ga0066395_10913619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 532 | Open in IMG/M |
3300005172|Ga0066683_10680064 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300005174|Ga0066680_10681049 | Not Available | 634 | Open in IMG/M |
3300005289|Ga0065704_10541204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 641 | Open in IMG/M |
3300005332|Ga0066388_101134174 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300005450|Ga0066682_10547762 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium | 732 | Open in IMG/M |
3300005564|Ga0070664_100960803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 802 | Open in IMG/M |
3300005764|Ga0066903_100621220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1879 | Open in IMG/M |
3300005764|Ga0066903_101055143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Chthonomonadetes → Chthonomonadales → Chthonomonadaceae → Chthonomonas → Chthonomonas calidirosea | 1493 | Open in IMG/M |
3300005764|Ga0066903_101058756 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
3300005764|Ga0066903_102049212 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300005764|Ga0066903_103710076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 821 | Open in IMG/M |
3300005764|Ga0066903_104193403 | Not Available | 771 | Open in IMG/M |
3300005764|Ga0066903_106601976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
3300005764|Ga0066903_106710203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 599 | Open in IMG/M |
3300005764|Ga0066903_107209973 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005764|Ga0066903_108938231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 508 | Open in IMG/M |
3300005764|Ga0066903_108939094 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005843|Ga0068860_101506406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 694 | Open in IMG/M |
3300005844|Ga0068862_102089995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 577 | Open in IMG/M |
3300005983|Ga0081540_1025350 | All Organisms → cellular organisms → Bacteria | 3414 | Open in IMG/M |
3300006049|Ga0075417_10566014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 576 | Open in IMG/M |
3300006049|Ga0075417_10584164 | Not Available | 567 | Open in IMG/M |
3300006194|Ga0075427_10016627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1144 | Open in IMG/M |
3300006796|Ga0066665_11603123 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum → Leptospirillum sp. Group I → Leptospirillum ferrooxidans | 512 | Open in IMG/M |
3300006845|Ga0075421_100401132 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
3300006845|Ga0075421_102467301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 542 | Open in IMG/M |
3300006853|Ga0075420_100981260 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300006854|Ga0075425_101816667 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300006880|Ga0075429_101582998 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300006894|Ga0079215_10807211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 656 | Open in IMG/M |
3300006969|Ga0075419_10820085 | Not Available | 667 | Open in IMG/M |
3300009038|Ga0099829_10317476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1279 | Open in IMG/M |
3300009089|Ga0099828_10193561 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
3300009090|Ga0099827_11544858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 578 | Open in IMG/M |
3300009090|Ga0099827_11558912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 575 | Open in IMG/M |
3300009094|Ga0111539_10346391 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
3300009098|Ga0105245_10631064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1100 | Open in IMG/M |
3300009100|Ga0075418_10293736 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
3300009100|Ga0075418_12690080 | Not Available | 543 | Open in IMG/M |
3300009101|Ga0105247_10204227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1329 | Open in IMG/M |
3300009143|Ga0099792_11134042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300009147|Ga0114129_10746858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1253 | Open in IMG/M |
3300009147|Ga0114129_10895942 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300009156|Ga0111538_12843341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 606 | Open in IMG/M |
3300009553|Ga0105249_10068230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 3279 | Open in IMG/M |
3300009553|Ga0105249_11803483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 684 | Open in IMG/M |
3300009609|Ga0105347_1200256 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300009792|Ga0126374_10080051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Chamaesiphonaceae → Chamaesiphon → Chamaesiphon minutus | 1783 | Open in IMG/M |
3300010043|Ga0126380_12002373 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300010046|Ga0126384_10189990 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1617 | Open in IMG/M |
3300010046|Ga0126384_12080154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 544 | Open in IMG/M |
3300010047|Ga0126382_10323449 | Not Available | 1169 | Open in IMG/M |
3300010047|Ga0126382_10566710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 928 | Open in IMG/M |
3300010359|Ga0126376_10921950 | Not Available | 866 | Open in IMG/M |
3300010359|Ga0126376_13211496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 506 | Open in IMG/M |
3300010360|Ga0126372_12865105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
3300010361|Ga0126378_11066379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 910 | Open in IMG/M |
3300010362|Ga0126377_10970751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 915 | Open in IMG/M |
3300010362|Ga0126377_12827505 | Not Available | 560 | Open in IMG/M |
3300010362|Ga0126377_12941829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 550 | Open in IMG/M |
3300010362|Ga0126377_13311457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 521 | Open in IMG/M |
3300010366|Ga0126379_11221333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 858 | Open in IMG/M |
3300010366|Ga0126379_11996842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
3300010398|Ga0126383_11600755 | Not Available | 741 | Open in IMG/M |
3300010398|Ga0126383_13006925 | Not Available | 551 | Open in IMG/M |
3300010398|Ga0126383_13033516 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300011269|Ga0137392_10736548 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300012400|Ga0134048_1393132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 555 | Open in IMG/M |
3300012929|Ga0137404_10294880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → Lichenibacterium ramalinae | 1405 | Open in IMG/M |
3300012929|Ga0137404_10994162 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300012930|Ga0137407_10483600 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300012948|Ga0126375_10037112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2482 | Open in IMG/M |
3300012948|Ga0126375_10367343 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300012951|Ga0164300_10189070 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 999 | Open in IMG/M |
3300012971|Ga0126369_10793795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1029 | Open in IMG/M |
3300012971|Ga0126369_13338077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 526 | Open in IMG/M |
3300013308|Ga0157375_12815632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 581 | Open in IMG/M |
3300015372|Ga0132256_103558137 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300015373|Ga0132257_100337418 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
3300015374|Ga0132255_105750960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 525 | Open in IMG/M |
3300016270|Ga0182036_11783913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 521 | Open in IMG/M |
3300016357|Ga0182032_10846750 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 775 | Open in IMG/M |
3300016404|Ga0182037_10428971 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300016422|Ga0182039_10409278 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300016445|Ga0182038_11550687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 595 | Open in IMG/M |
3300018468|Ga0066662_10331883 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300020065|Ga0180113_1075491 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300021406|Ga0210386_11396719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 587 | Open in IMG/M |
3300025910|Ga0207684_10540125 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300025936|Ga0207670_11309179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 614 | Open in IMG/M |
3300025945|Ga0207679_11257533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 679 | Open in IMG/M |
3300026041|Ga0207639_10302693 | Not Available | 1414 | Open in IMG/M |
3300026295|Ga0209234_1025526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2244 | Open in IMG/M |
3300026524|Ga0209690_1038725 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
3300027424|Ga0209984_1023901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 845 | Open in IMG/M |
3300027874|Ga0209465_10031997 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
3300027882|Ga0209590_10207211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1241 | Open in IMG/M |
3300027909|Ga0209382_12328161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 502 | Open in IMG/M |
3300030499|Ga0268259_10095875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 659 | Open in IMG/M |
3300031054|Ga0102746_10969448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 2911 | Open in IMG/M |
3300031724|Ga0318500_10451978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 643 | Open in IMG/M |
3300031770|Ga0318521_11047019 | Not Available | 501 | Open in IMG/M |
3300031847|Ga0310907_10474797 | Not Available | 665 | Open in IMG/M |
3300031910|Ga0306923_12440827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
3300031943|Ga0310885_10604199 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300032059|Ga0318533_10973226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
3300032075|Ga0310890_11585793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300032076|Ga0306924_12518801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 516 | Open in IMG/M |
3300032179|Ga0310889_10031306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1955 | Open in IMG/M |
3300033289|Ga0310914_11272741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 638 | Open in IMG/M |
3300033551|Ga0247830_11052991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 649 | Open in IMG/M |
3300034643|Ga0370545_032304 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 947 | Open in IMG/M |
3300034665|Ga0314787_013194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1102 | Open in IMG/M |
3300034667|Ga0314792_257992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 511 | Open in IMG/M |
3300034668|Ga0314793_169870 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 505 | Open in IMG/M |
3300034673|Ga0314798_156235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 524 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 18.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.10% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300031054 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 1C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_03285392 | 3300000033 | Soil | MALSVQQIHPVAHLPLVLGVLRHLEVATVIDSLIAPHPAHV |
F24TB_103021732 | 3300000550 | Soil | MAIAVQQSHPIAHLPLVLGVLRRLEVATIIDRLILPHPAHVLTP* |
JGI10213J12805_104813842 | 3300000858 | Soil | MALTVQQIQPVIILSPGVLRRLEVAMVIARPIPPYPAHMLSCGAGTVIAERHWMYLIA* |
JGI11643J12802_103535203 | 3300000890 | Soil | MAIAVQPIHPVAPVPVVLGVLRRLEVATVVDHLIPLHPAPVLSCGRGVEAV |
JGI1027J12803_1088213341 | 3300000955 | Soil | MALAVQQIDPVAHLPLVLGVLRRLEVATVIDRLIPPHPAH |
soilH2_103328192 | 3300003324 | Sugarcane Root And Bulk Soil | MTIAVQQIDPVAHLPLILVVLRRLDVATVIDCLIPPYPAHVLSCGRGLEALVQAILDGDQAL* |
Ga0066395_102887052 | 3300004633 | Tropical Forest Soil | MALTVQQIRPMAHLPLILGVLRRLEVATVIESLIAPHPKHVLSTGRGVEALVL |
Ga0066395_109136191 | 3300004633 | Tropical Forest Soil | MAIAVPQIYPLAHVPLVLGVLRHLAVATVMDHLIPPHPAYGLSPGRG |
Ga0066683_106800641 | 3300005172 | Soil | MAIAVQQIHSVAHLPLILGVLRRLEVATVIDRLIPPHPAHVL |
Ga0066680_106810492 | 3300005174 | Soil | MAMAVQTMHPMAQVPLVLGVLWRLEVATVIDRLIPPHPAHSLSCGRGV |
Ga0065704_105412042 | 3300005289 | Switchgrass Rhizosphere | MATPVQQMHPVAHLPLVLGVLRRLEVAAVIDRLIPPPSGAWALVRAWS* |
Ga0066388_1011341741 | 3300005332 | Tropical Forest Soil | MTMAVQQIHPIAHLPLVLGVLRRLEVATVIDRLIPPHPAHVL |
Ga0066682_105477622 | 3300005450 | Soil | MAITVQQMHPVAHLPLILGVLRRLGVATLIDGLIPPHPAHGLSCGRG |
Ga0070664_1009608032 | 3300005564 | Corn Rhizosphere | MAIAVQQIHPVAHLPLVLGVLRRLEVATVIDRLLPPHPAHVLSS |
Ga0066903_1006212201 | 3300005764 | Tropical Forest Soil | MAMTVQQIHPVAHLPLVLGVLRRLAVATVGDGLMP |
Ga0066903_1010551431 | 3300005764 | Tropical Forest Soil | MPVFVQQSHPIAHLPLVLGVLRRLEVATVIDGLIPPHPAHGL |
Ga0066903_1010587561 | 3300005764 | Tropical Forest Soil | MALTEQQIRPVAHLPLVLGVLRRLEVATVIDSLIAPHPAHVLST |
Ga0066903_1020492121 | 3300005764 | Tropical Forest Soil | MPVSVQHSYPIAHLPLVLGVLRRLEVATIIDCLIPPHPAHGLSCG |
Ga0066903_1037100762 | 3300005764 | Tropical Forest Soil | MAMTVQQIHPVAHLPLVLGVLRRLEVATLIDGLIPPHPAHGL |
Ga0066903_1041934033 | 3300005764 | Tropical Forest Soil | MAIAVQQIRPIAHLPLILGVLRRLEVATLVDGIIPLHP |
Ga0066903_1066019761 | 3300005764 | Tropical Forest Soil | MTIAVQQIRPIAHWPLGLGGLRRLEVASLIDALIPPHPAHVLSTGRGAEALVL |
Ga0066903_1067102032 | 3300005764 | Tropical Forest Soil | MAVAVQPIHPIAHVPLVLGVLRRLEVATIIDRLIPPHPAHGLSCGR |
Ga0066903_1072099732 | 3300005764 | Tropical Forest Soil | MTVAVQQISPVAHLPLILGVLRRLEIATVIDRLLPPHPAHVLSCGRGV |
Ga0066903_1089382312 | 3300005764 | Tropical Forest Soil | MAIAVQQVYPIAHLPLVLGVIRRLEVATGINRLVPPHPAHR |
Ga0066903_1089390942 | 3300005764 | Tropical Forest Soil | MAITVQQIHPVAHLPLVLGVLRRLEVATLIDGLIPPHPAHGL |
Ga0068860_1015064061 | 3300005843 | Switchgrass Rhizosphere | MALTVQQIHPVAHWPFILGVLRRLEVATVIENLIAPHPRQVLSIGRGVEALGLAILDGDH |
Ga0068862_1020899951 | 3300005844 | Switchgrass Rhizosphere | MALTVQQIHPVAHWPFILGVLRRLEVATVIENLIAPHPRQVLSIGRG |
Ga0081540_10253502 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MAANGLIGINSTVQQIHPVAHLPLVLGVLRRLEVATVIDRLIPPHPAHGLSC |
Ga0075417_105660142 | 3300006049 | Populus Rhizosphere | MAITVQQIHPVAHLPLVLGVLRRLEVATLIDGLIPPH |
Ga0075417_105841642 | 3300006049 | Populus Rhizosphere | MAVSVQPMRPVAQVPLGLGVLRRLEVATVIDGLLA |
Ga0075427_100166272 | 3300006194 | Populus Rhizosphere | MALTVQQIRPVAHVPFILGVLQHLGVATVIECFIAPHPRHVLSTGRGVEAMVL |
Ga0066665_116031231 | 3300006796 | Soil | MAITVQQIHPVGHLPLVLGVLRRLEVATVIDRLIPPHPA |
Ga0075421_1004011321 | 3300006845 | Populus Rhizosphere | MGIAVQQIHPVAHLPLVLAVSRHLKVASLIDDRIPPHPAPGLST |
Ga0075421_1024673011 | 3300006845 | Populus Rhizosphere | MAIAVQQIHPVAHLPLVLGVLRRLEVATVIDHLIPPHPAHGLSCGR |
Ga0075420_1009812603 | 3300006853 | Populus Rhizosphere | MATTLQQMHPVAHLPLVLGVLRRLEVATVIDRLIPPHPAHGLSGGRG |
Ga0075425_1018166671 | 3300006854 | Populus Rhizosphere | MAMAVQQIHPIAHLPLVLGVLRCLEVATVIDRLIPPHPAHGL |
Ga0075429_1015829982 | 3300006880 | Populus Rhizosphere | MAMTVQQIHPVAHLPLVLGVLRRLEVATVIDRLIPPHPAH |
Ga0079215_108072111 | 3300006894 | Agricultural Soil | MAMTVQQIHPVAHWPLVLGVLRRLEVATLIDDLIPPHPAHGLSCG |
Ga0075419_108200852 | 3300006969 | Populus Rhizosphere | MAVAVQQISPVVHLPLVLGVLRRLEIAPVIDRLLPPHPAHVL |
Ga0099829_103174762 | 3300009038 | Vadose Zone Soil | MATTVQQIHPVAHLPLVLSVLRRLEVATVMDRLIPP |
Ga0099828_101935611 | 3300009089 | Vadose Zone Soil | MAIAVQQIHSVAHLPLVLGVLRRLEVATVVDRLIP |
Ga0099827_115448582 | 3300009090 | Vadose Zone Soil | MAITVQQMHPMAHVPLVLGVVRCLDVATAIDGLIPPHPAHGLSCGR |
Ga0099827_115589121 | 3300009090 | Vadose Zone Soil | MAMTVQQIHPVAHLPLVLVVLRSLEVSPLIDGLIPPY |
Ga0111539_103463913 | 3300009094 | Populus Rhizosphere | MAMTVQQMHPVAHLPLVLGVLRRLEVAPAIDRLIPPHPAHGLS |
Ga0105245_106310641 | 3300009098 | Miscanthus Rhizosphere | MAMTVQQIHPVAHLPLVLDVLRRLEVATLIDGLIPPHPAHGLSCGRGVEALV |
Ga0075418_102937361 | 3300009100 | Populus Rhizosphere | MAMAVQQIHPIAHLPLVLGVLRRLEVATIIDRLIPPHPAHV |
Ga0075418_126900801 | 3300009100 | Populus Rhizosphere | MATIVQQIHPVAHLPLVLGVLRRLEVAAVIDHLIPPHPAHGLSCG |
Ga0105247_102042271 | 3300009101 | Switchgrass Rhizosphere | MALTVQQIHPVAHWPFILGVLRRLEVATVIENLIAPHPRQVL |
Ga0099792_111340422 | 3300009143 | Vadose Zone Soil | MATIVQQIHPVAHLPLVLGVLRRLEVATVIDRLIPPHPAHGLSCGR |
Ga0114129_107468583 | 3300009147 | Populus Rhizosphere | MAITVQQIEPVAHLPLILGVLRRLEVATLIDQLIPPHPAH |
Ga0114129_108959421 | 3300009147 | Populus Rhizosphere | MAIAVQQIDPVAHLPLVLGVLRRLEVATMIDRLNPPARGALFA |
Ga0111538_128433411 | 3300009156 | Populus Rhizosphere | MAITVQQIHPIAHLPLVLGVLRRLEVATRIDGLIPPHPAQGLSCGR |
Ga0105249_100682304 | 3300009553 | Switchgrass Rhizosphere | MAIAVQQIHPIAHLPLVLGVLRRLEVATIIDRLILPHPAHVLTP* |
Ga0105249_118034831 | 3300009553 | Switchgrass Rhizosphere | MAMAVQQIHPIAHLPLVLGVLRRLEVATVIDRLIPPHPAH |
Ga0105347_12002561 | 3300009609 | Soil | MAIPIQQIQPVAHLPLVLGVLRRLEVATVVDGLIPVHSAHVLSCG |
Ga0126374_100800513 | 3300009792 | Tropical Forest Soil | MATTIQQIHPVAHLPRVLGVLRRLEVAPVIDRLIPPHPAHGLSC |
Ga0126380_120023732 | 3300010043 | Tropical Forest Soil | MAIAVQQMHPVAHVPLVLGVLRRLEVATVIAYMIPPPPAHGLSCGRGGEAMGLAMLAG |
Ga0126384_101899903 | 3300010046 | Tropical Forest Soil | VQQMRPVAHLPLVLGVLRRLKVASLIDDLIPPHPAH |
Ga0126384_120801541 | 3300010046 | Tropical Forest Soil | MAIAVQQIDPIAHLPLVLGVLRRLEVATVVDRLIPPHPAHELTTGQRPTSSPG* |
Ga0126382_103234491 | 3300010047 | Tropical Forest Soil | MAIAVQEIRPVAHLPLVLGVLRRLEVATVLDDLIPPHPAH |
Ga0126382_105667101 | 3300010047 | Tropical Forest Soil | MAIAVQQIDPIVHLPLILGVLRRLEVATVIDRLIPPHPAHELATGQRPTSSPG* |
Ga0126376_109219502 | 3300010359 | Tropical Forest Soil | MAMAVQQMYPVAHVPFMLEGVRRLEVATLLAQLLPPHPA |
Ga0126376_132114961 | 3300010359 | Tropical Forest Soil | MAITVPPIHPVAPWPVVLGVLRRLAVATVVDRLLPPHPAHGLA |
Ga0126372_128651051 | 3300010360 | Tropical Forest Soil | MAMAVQQMHPVAHVPLVLGVVRRLAVAPVIDSMIPPHPAP |
Ga0126378_110663792 | 3300010361 | Tropical Forest Soil | MAITVQQIYPVAHLPLVLGVLRRLEVATLIDGIIP |
Ga0126377_109707511 | 3300010362 | Tropical Forest Soil | MAMAVQTIHPVAHLPLVLGVLRRLEVAIVIDRLIPPHPAHGLSCGR |
Ga0126377_128275051 | 3300010362 | Tropical Forest Soil | MAIAVQQIRPVAHLPLVLGVLRRLKVASLIDDLIPPHPAH |
Ga0126377_129418291 | 3300010362 | Tropical Forest Soil | MAIAVQQIYPIAHLPLVLGVLRRLEVATVIDRLIPPHPAHGLAPGRG |
Ga0126377_133114571 | 3300010362 | Tropical Forest Soil | MAMAVQQIYPIAHLPLVLGVLRRLEVATIIDRLIPPHPAHVLS |
Ga0126379_112213332 | 3300010366 | Tropical Forest Soil | MAIAVQHIHPVAHLPLVLGVLRRLEAATVIDRLRLPHPRHVAA |
Ga0126379_119968422 | 3300010366 | Tropical Forest Soil | MATTVQQIHPVAHLPLVLGVLRRLEVATVIDRLISPHPAHGLSC |
Ga0126383_116007551 | 3300010398 | Tropical Forest Soil | MASTVQQMEPGAHMPFLLGVLRRWEGATRMDQLLPPHPAHGRSC |
Ga0126383_130069251 | 3300010398 | Tropical Forest Soil | MAMTVQPMHPVAHVPLVLGVGRRLEVATLIDGLIPP |
Ga0126383_130335161 | 3300010398 | Tropical Forest Soil | MPVSVRQSHPIAHLPLVLGVLRRLEVATVIDHLIPPHP |
Ga0137392_107365481 | 3300011269 | Vadose Zone Soil | MAIAVQQSDPVAHLPLVLGVLRHLEIATVIDRLIPP |
Ga0134048_13931321 | 3300012400 | Grasslands Soil | MAVSVQQIHPIAHLPLVLGVLRRLEVATVIDRLIPPHPA |
Ga0137404_102948801 | 3300012929 | Vadose Zone Soil | MALTVQQIQPVAHLSLVLGVLRRLEVATVIDRLIPPQPAHMLSCGRGAIIQ |
Ga0137404_109941622 | 3300012929 | Vadose Zone Soil | MASAVQQMHPMVHLPWVLGVLRRLEVATMIDRLIPPHPAHGLSCGRG |
Ga0137407_104836001 | 3300012930 | Vadose Zone Soil | MALAVQQIYPIAHLPLVLGFLRRLEIATIIDGLIASHPAHVLSAGRG |
Ga0126375_100371124 | 3300012948 | Tropical Forest Soil | MAPTGPQIHPVAHFPFVLGVLRRLEVATVMDRLLPP |
Ga0126375_103673431 | 3300012948 | Tropical Forest Soil | MATTVQQMHSVAHLPLVLGVVRRLEVAAVMDRLIPP |
Ga0164300_101890702 | 3300012951 | Soil | MAMAVQQIHPIAHLPLILGVLRRLEVAAIIDRLIPP |
Ga0126369_107937953 | 3300012971 | Tropical Forest Soil | MATTIQQIYPVAHLPLVLGVLRRLEVATVIDRLIPPHP |
Ga0126369_133380771 | 3300012971 | Tropical Forest Soil | MATTVQQIYPVAHLPLVLGVLRRLEVATVIDRLIPPHPAHGLSCGRG |
Ga0157375_128156321 | 3300013308 | Miscanthus Rhizosphere | MATTVQQMHPVAHLPLVLGVLRRLEVATIIDRLIPPH |
Ga0132256_1035581371 | 3300015372 | Arabidopsis Rhizosphere | MTVAVQQIYSVAHLPLILGVLRRLEVATVIDRLLPPHPAHVISC |
Ga0132257_1003374181 | 3300015373 | Arabidopsis Rhizosphere | MAVSVQHMHPIAHLPLVLGVLRRLEVATIIDRLIPPHPAHGLSC |
Ga0132255_1057509602 | 3300015374 | Arabidopsis Rhizosphere | MAVAVQQIHPVAHLPLVLGVLRRLEVATIIDRLLPPPP |
Ga0182036_117839131 | 3300016270 | Soil | MAMAVQQIHPIAHLPFVLGVLRRLEVATVIDRLIPPH |
Ga0182032_108467501 | 3300016357 | Soil | MVIAVQQIRPVAHLPLVLSVVRRLEVASLIDALIPPHPAHVLSTGRG |
Ga0182037_104289711 | 3300016404 | Soil | MAITIQQIYPLAHLSLALGVLRRLEVATLIDGLIPPHPAHGL |
Ga0182039_104092782 | 3300016422 | Soil | MAIAVQQMYPVAHLPLILGVLRRLEVATLIDRLIPPHPAHGLSCGRGV |
Ga0182038_115506872 | 3300016445 | Soil | MATTVQQIHPVAHLPLVLGVLRRLEVATVIDGLLPPHPAHVL |
Ga0066662_103318832 | 3300018468 | Grasslands Soil | MAMTVQQIYPVAHLPLVLGMLRRLEVAMVVAGLIPPHPAHVLSCGH |
Ga0180113_10754911 | 3300020065 | Groundwater Sediment | MAVAVQQIHPVAHLPLLLGVLRRLEVAPIVDRLLPPHPAHVLSGGRGGEAL |
Ga0210386_113967191 | 3300021406 | Soil | MATTIQQLPPVAHLPLVLGVLRRLEVATIIERLIPPHPAHG |
Ga0207684_105401251 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMTVQQRRPVAHVPVVLGGLRRLEVATILDRLIPP |
Ga0207670_113091791 | 3300025936 | Switchgrass Rhizosphere | MAMTVQQMHPVAHLPLVLGVLRRLEAATRLDDCIPPHPAHEHSCRRG |
Ga0207679_112575332 | 3300025945 | Corn Rhizosphere | MAITVQQIHPVAHLPFVLGVLRRLEVATVIDRLLPSH |
Ga0207639_103026931 | 3300026041 | Corn Rhizosphere | MAMAVQQIHPIAHLPLVLGVLRRLEVATVIDRLIPPH |
Ga0209234_10255262 | 3300026295 | Grasslands Soil | MAIAVQTIHPVAHLPLVLGVLRRLEVATVIDRLIPPHPAHGLS |
Ga0209690_10387253 | 3300026524 | Soil | MAMTVQQIHPVAHLPLVLGVLRRLEVATLIDGLIPPH |
Ga0209984_10239011 | 3300027424 | Arabidopsis Thaliana Rhizosphere | MAMTVQQIHPVAHLPLVLGVLRRLEVAAVIDRLIPPHPAHGLSC |
Ga0209465_100319971 | 3300027874 | Tropical Forest Soil | MTVAVPQMYSVAHLPLILGVLRRLEVATVIDRLLPPHPAHVLSCGRG |
Ga0209590_102072112 | 3300027882 | Vadose Zone Soil | MAVSVQQIHPVAHLPLVLGVLRRLEVATVIDRLLPSHPAHVLS |
Ga0209382_123281612 | 3300027909 | Populus Rhizosphere | MATTVQQRYPVAHLPLVLGVLRRLEVATVIDRLIPPIRR |
Ga0268259_100958751 | 3300030499 | Agave | MALTVQQIQHVAHFPLILGVLRRLEVATVIDRLIPPHPAHVLSAGRGGEALVL |
Ga0102746_109694481 | 3300031054 | Soil | MAVQQIRPAAPLPLVLDVLRRLEVASLLDDLMPMPPHPGHVLTTGHGVEAL |
Ga0318500_104519782 | 3300031724 | Soil | MAMTVQQIHPVAHLPLVLGVLRRLAVATVGNGLMPPHP |
Ga0318521_110470191 | 3300031770 | Soil | MAVSVQEIRPIAHLPLVLGVLRRLEVATIIENLIAPHPQHVLSTG |
Ga0310907_104747971 | 3300031847 | Soil | MALTVQQIRPVAHVPFILGVLRRLEVATIIERLIAPHP |
Ga0306923_124408271 | 3300031910 | Soil | MAIAVQQIYPVAHSPLILGVLRRLEVATLIDQLIPPHPAHGLSCGRG |
Ga0310885_106041991 | 3300031943 | Soil | MAITVQQIHPVAHLPLVLGVLRRLEVAAVIDHLIPPH |
Ga0318533_109732261 | 3300032059 | Soil | MAIAVQQIYPVAHSPLILGVLRRLEVATLIDQLIPPHP |
Ga0310890_115857932 | 3300032075 | Soil | MATTVQQIHPVAHLPLVLGVLRRLEVATVIDRLIPPHPAHGLSCGR |
Ga0306924_125188012 | 3300032076 | Soil | MALTVQQIRPVAHVPLVLGVLRRLEVATVIDSLIAPHPAH |
Ga0310889_100313063 | 3300032179 | Soil | MAMTVQQIHPVAHLPLVLGVLRRLEVATVIDRLIPPHP |
Ga0310914_112727412 | 3300033289 | Soil | MAMAVQQIRPIAHVPLILGVLRRLEVAAVVDGLIPPHP |
Ga0247830_110529912 | 3300033551 | Soil | MAIAVQQIHPIAHLPLVLGVLRRLEVATIIDRLILPHPAHVLTP |
Ga0370545_032304_3_107 | 3300034643 | Soil | MAMTVQQIRPVAHLPLVLGVLRRREVATSIDRLIP |
Ga0314787_013194_992_1102 | 3300034665 | Soil | MAIAVQTIHPVAHLPLVLGVLRRLEVATVIDRLIPPH |
Ga0314792_257992_2_124 | 3300034667 | Soil | MATTVQQIHPIAHLPLVLGVLRRLEVATVIDRLIPPHPAHG |
Ga0314793_169870_366_503 | 3300034668 | Soil | MAVSVQHIHPVAHLPLVLGVLRRLEVATVLDRLLPPHPAHGLSSGS |
Ga0314798_156235_1_108 | 3300034673 | Soil | MAVAVQQIHPVAHLPLVLGVLRRLEVATIIDRLLPP |
⦗Top⦘ |