NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068996

Metagenome / Metatranscriptome Family F068996

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068996
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 41 residues
Representative Sequence GAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA
Number of Associated Samples 101
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 44.35 %
% of genes near scaffold ends (potentially truncated) 49.19 %
% of genes from short scaffolds (< 2000 bps) 88.71 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.516 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(30.645 % of family members)
Environment Ontology (ENVO) Unclassified
(49.194 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(37.903 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 45.45%    β-sheet: 0.00%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF01597GCV_H 37.90
PF02954HTH_8 22.58
PF10518TAT_signal 2.42
PF08238Sel1 1.61
PF13247Fer4_11 1.61
PF00535Glycos_transf_2 0.81
PF13657Couple_hipA 0.81
PF00501AMP-binding 0.81
PF04101Glyco_tran_28_C 0.81
PF13462Thioredoxin_4 0.81
PF12797Fer4_2 0.81
PF12698ABC2_membrane_3 0.81
PF03480DctP 0.81
PF01613Flavin_Reduct 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0509Glycine cleavage system protein H (lipoate-binding)Amino acid transport and metabolism [E] 37.90
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.52 %
UnclassifiedrootN/A10.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002121|C687J26615_10013884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1950Open in IMG/M
3300002220|MLSBCLC_10629118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria685Open in IMG/M
3300003861|Ga0031654_10060291All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300003987|Ga0055471_10234114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria580Open in IMG/M
3300003987|Ga0055471_10296164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria518Open in IMG/M
3300004009|Ga0055437_10099831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria854Open in IMG/M
3300004062|Ga0055500_10185674All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium506Open in IMG/M
3300004779|Ga0062380_10535580All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M
3300005205|Ga0068999_10084591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria612Open in IMG/M
3300005830|Ga0074473_11132829Not Available1725Open in IMG/M
3300005833|Ga0074472_11361262All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300005880|Ga0075298_1039509All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria502Open in IMG/M
3300005897|Ga0075281_1033259All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria764Open in IMG/M
3300005947|Ga0066794_10171595All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria652Open in IMG/M
3300006055|Ga0097691_1018544All Organisms → cellular organisms → Bacteria3084Open in IMG/M
3300006224|Ga0079037_100496202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1171Open in IMG/M
3300006224|Ga0079037_100696955All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria991Open in IMG/M
3300006224|Ga0079037_101991307Not Available580Open in IMG/M
3300006864|Ga0066797_1275604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria587Open in IMG/M
3300006930|Ga0079303_10003320All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Gottesmanbacteria → Candidatus Gottesmanbacteria bacterium GW2011_GWC2_39_84339Open in IMG/M
3300006950|Ga0075524_10302242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria701Open in IMG/M
3300006950|Ga0075524_10403386Not Available603Open in IMG/M
3300009029|Ga0066793_10133998All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1445Open in IMG/M
3300009091|Ga0102851_10621594All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1132Open in IMG/M
3300009091|Ga0102851_10829488Not Available991Open in IMG/M
3300009111|Ga0115026_10549107All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria868Open in IMG/M
3300009167|Ga0113563_11348890All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300009167|Ga0113563_12721436All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300009179|Ga0115028_11043887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria660Open in IMG/M
3300009582|Ga0115601_1068562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2227Open in IMG/M
3300009583|Ga0115598_1037734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria578Open in IMG/M
3300009583|Ga0115598_1102049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2249Open in IMG/M
3300009868|Ga0130016_10510004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium768Open in IMG/M
3300011397|Ga0137444_1044073Not Available680Open in IMG/M
3300011407|Ga0137450_1055347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria734Open in IMG/M
3300011419|Ga0137446_1021074All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300011428|Ga0137456_1138618Not Available651Open in IMG/M
3300011431|Ga0137438_1018608All Organisms → cellular organisms → Bacteria1989Open in IMG/M
3300011431|Ga0137438_1110906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium837Open in IMG/M
3300011433|Ga0137443_1036863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1303Open in IMG/M
3300011435|Ga0137426_1153636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria677Open in IMG/M
3300011436|Ga0137458_1014103All Organisms → cellular organisms → Bacteria1880Open in IMG/M
3300011437|Ga0137429_1214872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria599Open in IMG/M
3300011442|Ga0137437_1038405All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300012143|Ga0137354_1027741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria871Open in IMG/M
3300012146|Ga0137322_1044178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria666Open in IMG/M
3300012152|Ga0137347_1002086All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1890Open in IMG/M
3300012157|Ga0137353_1051125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria751Open in IMG/M
3300012164|Ga0137352_1027325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1086Open in IMG/M
3300012164|Ga0137352_1086792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria623Open in IMG/M
3300012227|Ga0137449_1039431All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria954Open in IMG/M
3300012931|Ga0153915_11567164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria771Open in IMG/M
3300012964|Ga0153916_10448315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1356Open in IMG/M
3300013092|Ga0163199_1000296All Organisms → cellular organisms → Bacteria → Proteobacteria31606Open in IMG/M
3300013092|Ga0163199_1167783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria875Open in IMG/M
3300013232|Ga0170573_10371112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1071Open in IMG/M
3300014259|Ga0075311_1137145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria551Open in IMG/M
3300014271|Ga0075326_1182389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300014296|Ga0075344_1001540All Organisms → cellular organisms → Bacteria2538Open in IMG/M
3300014315|Ga0075350_1063768All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria815Open in IMG/M
3300014861|Ga0180061_1011417Not Available1230Open in IMG/M
3300014863|Ga0180060_1013070All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria928Open in IMG/M
3300014868|Ga0180088_1048375Not Available730Open in IMG/M
3300014870|Ga0180080_1006715All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300014871|Ga0180095_1064011All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria668Open in IMG/M
3300014872|Ga0180087_1015545All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1333Open in IMG/M
3300014875|Ga0180083_1038374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria960Open in IMG/M
3300014878|Ga0180065_1047114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria921Open in IMG/M
3300014880|Ga0180082_1122047Not Available597Open in IMG/M
3300014881|Ga0180094_1061669All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria816Open in IMG/M
3300014881|Ga0180094_1074959All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300014883|Ga0180086_1079156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria819Open in IMG/M
3300014883|Ga0180086_1132839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria647Open in IMG/M
3300014885|Ga0180063_1054102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1161Open in IMG/M
3300015255|Ga0180077_1031789All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria996Open in IMG/M
3300015255|Ga0180077_1067147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria731Open in IMG/M
3300015257|Ga0180067_1112443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria618Open in IMG/M
3300015259|Ga0180085_1005112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3672Open in IMG/M
3300015259|Ga0180085_1043587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1277Open in IMG/M
3300015259|Ga0180085_1171461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300018084|Ga0184629_10412356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria709Open in IMG/M
3300019246|Ga0172287_1427616All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria850Open in IMG/M
3300019257|Ga0180115_1172650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria605Open in IMG/M
3300020068|Ga0184649_1601095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria622Open in IMG/M
3300021081|Ga0210379_10077825All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300021332|Ga0210339_1346523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria868Open in IMG/M
3300021859|Ga0210334_10216471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1105Open in IMG/M
3300022185|Ga0079039_1166265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria652Open in IMG/M
3300022384|Ga0210321_1009590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1016Open in IMG/M
3300022553|Ga0212124_10000190All Organisms → cellular organisms → Bacteria → Proteobacteria56983Open in IMG/M
3300024056|Ga0124853_1476203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1695Open in IMG/M
3300025308|Ga0209211_10085310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2543Open in IMG/M
3300025319|Ga0209520_10216699All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300025322|Ga0209641_10218471All Organisms → cellular organisms → Bacteria1426Open in IMG/M
3300025484|Ga0208587_1047916All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1048Open in IMG/M
3300025956|Ga0210104_1000473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5901Open in IMG/M
3300026059|Ga0208540_1024060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria684Open in IMG/M
3300027843|Ga0209798_10097665All Organisms → cellular organisms → Bacteria1498Open in IMG/M
3300027843|Ga0209798_10398063Not Available644Open in IMG/M
3300027900|Ga0209253_10029930All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4566Open in IMG/M
3300027900|Ga0209253_10193199All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1629Open in IMG/M
3300027900|Ga0209253_10849514Not Available644Open in IMG/M
3300027979|Ga0209705_10220544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria989Open in IMG/M
3300028803|Ga0307281_10113475All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300031965|Ga0326597_12030671All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300031997|Ga0315278_10234336All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1893Open in IMG/M
3300032173|Ga0315268_10312232Not Available1524Open in IMG/M
3300033233|Ga0334722_10382846All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300033406|Ga0316604_10290320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria890Open in IMG/M
3300033408|Ga0316605_10488431All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1131Open in IMG/M
3300033408|Ga0316605_11315574All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300033408|Ga0316605_11968789All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium568Open in IMG/M
3300033416|Ga0316622_101164150All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300033416|Ga0316622_103399950All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria501Open in IMG/M
3300033419|Ga0316601_100026195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3964Open in IMG/M
3300033434|Ga0316613_10874794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria617Open in IMG/M
3300033434|Ga0316613_11163179All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria531Open in IMG/M
3300033481|Ga0316600_10072332All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales2015Open in IMG/M
3300033482|Ga0316627_101171138All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium758Open in IMG/M
3300033482|Ga0316627_101700896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria645Open in IMG/M
3300033487|Ga0316630_10973669Not Available740Open in IMG/M
3300033488|Ga0316621_10044116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2183Open in IMG/M
3300034113|Ga0364937_063794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria706Open in IMG/M
3300034165|Ga0364942_0180674All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria688Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil30.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil11.29%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands7.26%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland4.84%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.84%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands4.03%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.23%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.23%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.42%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.42%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.42%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.42%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.42%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.61%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.61%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.81%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.81%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.81%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.81%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.81%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300002220Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011EngineeredOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004062Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005880Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201EnvironmentalOpen in IMG/M
3300005897Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009582Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009583Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300011407Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011428Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012146Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2EnvironmentalOpen in IMG/M
3300012152Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2EnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012164Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2EnvironmentalOpen in IMG/M
3300012227Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013092Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150mEnvironmentalOpen in IMG/M
3300013232Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1EngineeredOpen in IMG/M
3300014259Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300014863Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10DEnvironmentalOpen in IMG/M
3300014868Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10DEnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015255Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10DEnvironmentalOpen in IMG/M
3300015257Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10DEnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300019246Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021332Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021859Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022185Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022384Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022553Powell_combined assemblyEnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025308Soil microbial communities from Rifle, Colorado, USA - Groundwater A2EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025484Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025956Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026059Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C687J26615_1001388443300002121SoilASPRREVGTMGYIIFGIAYVVLGVIAAVRPHAGPT*
MLSBCLC_1062911823300002220Hydrocarbon Resource EnvironmentsVRGQWFPRKEVGTMGYLIIGIAFIVLTVIAAVRTRPGHA*
Ga0031654_1006029113300003861Freshwater Lake SedimentVRGKLAPRREVGTMAYLVMGIAFIVLVVIAAVRGRTWHA*
Ga0055471_1023411413300003987Natural And Restored WetlandsVRGKWTPRKEVGKMGYLMVGIAFIVLAVIAAMRTRTGHA*
Ga0055471_1029616413300003987Natural And Restored WetlandsVRGKHAPRKEVGTMGYLVMGVAYIVLAVLAAVRPRARQA*
Ga0055437_1009983113300004009Natural And Restored WetlandsVRGNGSPRKEVGTMGYLVIGIAFIVLAIVAAVRTRAEHV*
Ga0055500_1018567413300004062Natural And Restored WetlandsVRGKWAPRREVGTMGYLVMGIALIVLVVIAAVRARTGHV*
Ga0062380_1053558023300004779Wetland SedimentVRGKWAPRREVGTMAYLVMGIAFIVLAVIAAVRGRTWHA*
Ga0068999_1008459113300005205Natural And Restored WetlandsVVRGQKFPREEVGTMGYLVIGIAYIVLAVAAVVKPHAGHA*
Ga0074473_1113282923300005830Sediment (Intertidal)MQSPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA*
Ga0074472_1136126233300005833Sediment (Intertidal)KPVRGTTSPRKEVGTMGYILFGIAYLVLGVIAAVRPHAGTM*
Ga0075298_103950913300005880Rice Paddy SoilSPRKEVGTMGYLVFGIAYIVLAVIAAVKPRAGDA*
Ga0075281_103325923300005897Rice Paddy SoilVRGRRSPRREVGTMGYMMIGIGFIVLAVIAAFRARTGHV*
Ga0066794_1017159523300005947SoilGAGRAPQKEVGTMGYMVIGIAYIVLAVMAVVKPRAGHA*
Ga0097691_101854413300006055Arctic Peat SoilMADAVDIGAGSDPRKEVGTMGYLVIGIAYIVLAVAAAVKPRAGHA*
Ga0079037_10049620213300006224Freshwater WetlandsAGRTLRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA*
Ga0079037_10069695513300006224Freshwater WetlandsMSDALDIVAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA*
Ga0079037_10199130723300006224Freshwater WetlandsMADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPR
Ga0066797_127560423300006864SoilAPQKEVGTMGYMVIGIAYIVLAVMAVVKPRAGHA*
Ga0079303_1000332013300006930Deep SubsurfaceRGQQYPREEVGTMGYLVIGIAFIVLAIVAAVRPRTGHA*
Ga0075524_1030224223300006950Arctic Peat SoilDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAVVKPRTGHA*
Ga0075524_1040338613300006950Arctic Peat SoilMADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAVVKP
Ga0066793_1013399833300009029Prmafrost SoilMVDAVDIGAGRAPQKEVGTMGYMVIGIAYIVLAVMAVVKPRAGHA*
Ga0102851_1062159413300009091Freshwater WetlandsGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA*
Ga0102851_1082948823300009091Freshwater WetlandsMADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA*
Ga0115026_1054910723300009111WetlandMADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA*
Ga0113563_1134889023300009167Freshwater WetlandsMADALDIGAGRTLRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA*
Ga0113563_1272143613300009167Freshwater WetlandsMADALYIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKP
Ga0115028_1104388723300009179WetlandMADAVDIVAGSDSRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA*
Ga0115601_106856243300009582WetlandRHPRKEVGTMAYLVIGIGFIVLEVVAAVRMRAGHA*
Ga0115598_103773423300009583WetlandGPPRKEVGTMGYLVIGIAYIVLAVVTAVKPRAGHA*
Ga0115598_110204913300009583WetlandHPRKEVGTMAYLVIGLGFTVLEVVAATRMRTGHA*
Ga0130016_1051000423300009868WastewaterVRGKWSPREEVGTMAYLAMGIAFVVLEIIAAVKTRTGHA*
Ga0137444_104407313300011397SoilMADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAPMKPRARHA*
Ga0137450_105534713300011407SoilMADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA*
Ga0137446_102107413300011419SoilMADAVDIGAGSDPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAGHA*
Ga0137456_113861823300011428SoilMADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKP
Ga0137438_101860833300011431SoilMADAVYISAGRAPRKEVGTMGYLVIVIAYIVLAVVAVVKPRAGHA*
Ga0137438_111090613300011431SoilVRGKWAPREEVGKMGYLMVGIAFIVLEVIAAVRTRTGHA*
Ga0137443_103686323300011433SoilMADAVYIGAGSAPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAGHA*
Ga0137426_115363623300011435SoilMADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA*
Ga0137458_101410323300011436SoilMADAVDIGAGSDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA*
Ga0137429_121487223300011437SoilMADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAAMKPREGHA*
Ga0137437_103840533300011442SoilMADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAGHA*
Ga0137354_102774123300012143SoilMADAVDIGAGSDPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA*
Ga0137322_104417823300012146SoilMADAVNIGAGRAPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAEHA*
Ga0137347_100208623300012152SoilMPDAIYIGAGRDPRKEVGTMGYLVIGIAFIVLEVVAAVKMRTGHA*
Ga0137353_105112523300012157SoilMADALDIGAGMDPRKGVGTMGYLVLGLAYIVLTVVAAVKPRAGHA*
Ga0137352_102732513300012164SoilMADALDIGAGMDPRKGVGTMGYLVIGLAYIVLTVVAAVKPRAGHA*
Ga0137352_108679223300012164SoilMADALDIGAGRTLRKEVGTMGYLVIGIAYIVLTVVAVVKPHAGHA*
Ga0137449_103943123300012227SoilMADAVYISAGRVPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAVHA*
Ga0153915_1156716413300012931Freshwater WetlandsHCGRKVRGKWTPRREVGKMGYLIIGIAFLVLAVIAAVRTRAGHA*
Ga0153916_1044831523300012964Freshwater WetlandsMRGKWFPRREVGKMGYLIIGIAFIVLAVIAAVRTRPGHA*
Ga0163199_1000296123300013092FreshwaterMWYPRKEVGTMGYMVIGIAYIVLAVVAAMKPRAGNA*
Ga0163199_116778313300013092FreshwaterAPHDRDGWEVRGKWARREEVGTMGYLVMGIALLVLAVIAAMRARARHA*
Ga0170573_1037111223300013232SedimentMAPRKEVGTMGYLVIGIAYIVLAVVAVAKPRAEHA*
Ga0075311_113714523300014259Natural And Restored WetlandsMPAWIAIGMADALDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRTGHA*
Ga0075326_118238923300014271Natural And Restored WetlandsMADALDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA*
Ga0075344_100154043300014296Natural And Restored WetlandsMQSPRKEVGTMGYLVIGIAYIVLAVVAVVKPREGHA*
Ga0075350_106376813300014315Natural And Restored WetlandsSPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA*
Ga0180061_101141713300014861SoilMADALDIGAGKDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA*
Ga0180060_101307013300014863SoilMADAVYIGAGSAPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAVHA*
Ga0180088_104837513300014868SoilMADAVDIGAGSDPRKEVGKMGFLIFAATYIVLGIIAVTKPRTDHA*
Ga0180080_100671533300014870SoilCGSEVRGEWAPRREVGKMVYLAMGIAFIVLEVITAVKARTGHA*
Ga0180095_106401123300014871SoilMADAVDIGAGSAPRKEVGTMGYLVIGIAFIVLAILAAARTRAGHA*
Ga0180087_101554513300014872SoilRVWNAAGMADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA*
Ga0180083_103837423300014875SoilAWNAAGMADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLAVVAAVKPRAGHA*
Ga0180065_104711423300014878SoilVAGLADAVDIGAGSDPRKEVGTMGYLMIGIAYIVLTVVAVVKPRAGHA*
Ga0180082_112204723300014880SoilMADALDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPSTG
Ga0180094_106166923300014881SoilMADALDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA*
Ga0180094_107495923300014881SoilMADALDIGAGRAPRKEVGTMGYLVIGIAYIVLTVAAVVKPRAGHA*
Ga0180086_107915623300014883SoilAPRKEVGTMGYLVIGIAYIVLTVAAVVKPRAGHA*
Ga0180086_113283913300014883SoilGTPRKEVGTMGYLVIGIAYIVLTVVAAVKPREGHA*
Ga0180063_105410223300014885SoilVRGEWAPRREVGKMVYLAMGIAFIVLEVITAVKARTGHA*
Ga0180077_103178923300015255SoilMADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPSTGHA*
Ga0180077_106714723300015255SoilMAPRREVGKMGYLAIGIAFIVLAVIAAVRTRTGHA*
Ga0180067_111244323300015257SoilMADAVDIGAGSAPRKEVGTMGYLVIGIAYIVLTVVAAMKPREGHA*
Ga0180085_100511253300015259SoilMADALDIGAGMDPRKGVGTMGYLVIGLAYIVLTVV
Ga0180085_104358733300015259SoilAWNAVGMADALDIGAGMDPRKGVGTMGYLVIGLAYIVLTVVAAVKPRAGHA*
Ga0180085_117146123300015259SoilVRGKWAPRREVGKMGYLMMGIALVVLAVIAAVRTRTGQA*
Ga0184629_1041235623300018084Groundwater SedimentMADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA
Ga0172287_142761623300019246WetlandGPPRKEVGTMGYLVIGIAYIVLAVVTAVKPRAGHA
Ga0180115_117265013300019257Groundwater SedimentGPPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA
Ga0184649_160109513300020068Groundwater SedimentWTPRKEVGKMGYLMMGIAYIALAVIAAVRPRTGHT
Ga0210379_1007782513300021081Groundwater SedimentRGAGRVATRREVGKMGYLVMGIAFIVLAVIAAVRTRTGHA
Ga0210339_134652313300021332EstuarineEVRGMQSPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA
Ga0210334_1021647123300021859EstuarineMQSPRKEVGTMGYLVIGIAYIVLAVVAVVKPREGHA
Ga0079039_116626513300022185Freshwater WetlandsRDPRKEVGTMGYLVFGIAYIVLAVVAVVKPRAGHA
Ga0210321_100959013300022384EstuarineMQSPRKEVGTMGYLVIGIAYIVLAVVAVVKPRADHA
Ga0212124_10000190233300022553FreshwaterMWYPRKEVGTMGYMVIGIAYIVLAVVAAMKPRAGNA
Ga0124853_147620333300024056Freshwater WetlandsMADAVDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA
Ga0209211_1008531023300025308SoilVRGKWAPRKEVREMGYLMIGIAFIVLAVIAAVRVRAGHA
Ga0209520_1021669933300025319SoilRCGSEVRGKGSPRGEVGTMGYLVIGIAFIVLAVIAAVRTRAGHA
Ga0209641_1021847133300025322SoilSEVRGKWAPRKEVREMGYLMIGIAFIVLAVIAAVRVRTGHA
Ga0208587_104791633300025484Arctic Peat SoilKKPPQKEVGTMGYLVIGIAYIVLAVAAAVKPRAGHA
Ga0210104_100047313300025956Natural And Restored WetlandsMQSPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA
Ga0208540_102406023300026059Natural And Restored WetlandsGMQSPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA
Ga0209798_1009766513300027843Wetland SedimentAGSSPLRKEVGTMGYLVIGIAFIVLAIVAAVRTRAGHA
Ga0209798_1039806323300027843Wetland SedimentMADAVDIGAGSSPLRKEVGTMGYLVIGIAFIVLAIVAAVR
Ga0209253_1002993013300027900Freshwater Lake SedimentQTPRREVGTMAYLVIGIAFIVLEIIAAVRMRTGHA
Ga0209253_1019319913300027900Freshwater Lake SedimentHNRGCCSPREEVGKMGYLVIGMAYIVLVLSAVMKPHTGHA
Ga0209253_1084951413300027900Freshwater Lake SedimentMDIGAGSSPPRKEVGTMGYLVIGIAFIVLAVVAAVR
Ga0209705_1022054423300027979Freshwater SedimentIAVIEVRGKWTPRREVGTMGYLVMGIALIVLVVIAAVKARTGHA
Ga0307281_1011347523300028803SoilMADAVDIVAGSDPRKEVGTMGYLVIGIAYIVLAVVAAVNPRAGHA
Ga0326597_1203067113300031965SoilVRGKWAPRKEVREMGYLMIGIAFIVLAVIAAVRVRT
Ga0315278_1023433613300031997SedimentAAGTADAVDIGAGSSPPRKEVGTMGYLVIGIAFIVLAIIAAMRTRAGHA
Ga0315268_1031223223300032173SedimentVVCGKRAPRREVGTMGYLVMGIVLIVLVVIAAVRARTEHA
Ga0334722_1038284613300033233SedimentVRGKWAPRREVGTMGYLVMGVAYVVLAVLSAVRPRARHA
Ga0316604_1029032023300033406SoilMADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA
Ga0316605_1048843113300033408SoilRGRHPRKEVGTMAYLVIGIGFIVLEVVAAVRMRAGHA
Ga0316605_1131557423300033408SoilMADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA
Ga0316605_1196878923300033408SoilMADAVDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKP
Ga0316622_10116415023300033416SoilMADALDIGAGRTLRKEVGTMGYLVIGIAYIVLTVVAVVKPRA
Ga0316622_10339995023300033416SoilAVGMADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA
Ga0316601_10002619573300033419SoilSRGGLPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA
Ga0316613_1087479413300033434SoilNAVGMADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA
Ga0316613_1116317923300033434SoilWSPRKEVGTMAYLVMGIAFLVLMVVSAVRTRTGHA
Ga0316600_1007233213300033481SoilGMADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA
Ga0316627_10117113813300033482SoilMADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVK
Ga0316627_10170089613300033482SoilSRGRHPRKEVGTMAYLVIGIGFIVLEVVAAMRLRAGHA
Ga0316630_1097366913300033487SoilMADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA
Ga0316621_1004411613300033488SoilKESRGGLPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA
Ga0364937_063794_2_1303300034113SedimentGSEVRGKWAPRREVGKMGYLMMGIALVVLAVIAAVRTRTGHA
Ga0364942_0180674_276_3863300034165SedimentMWTPRREVGTMGYLVMGIAFIVLEVIAAVKTRTGHA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.