NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068616

Metagenome / Metatranscriptome Family F068616

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068616
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 47 residues
Representative Sequence VVAAYAAGEKPILARGLDYSSEEVYTYVQRIAQQYRAELRRKGGR
Number of Associated Samples 114
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 93.55 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.355 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(8.871 % of family members)
Environment Ontology (ENVO) Unclassified
(20.161 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.742 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.14%    β-sheet: 0.00%    Coil/Unstructured: 69.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF03743TrbI 4.84
PF03524CagX 1.61
PF01464SLT 0.81
PF03741TerC 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2948Type IV secretory pathway, VirB10 componentIntracellular trafficking, secretion, and vesicular transport [U] 4.84
COG3504Type IV secretory pathway, VirB9 componentsIntracellular trafficking, secretion, and vesicular transport [U] 1.61
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.35 %
UnclassifiedrootN/A5.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001172|JGI12681J13546_1001386All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300001175|JGI12649J13570_1002706All Organisms → cellular organisms → Bacteria2611Open in IMG/M
3300001176|JGI12655J13551_101192All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium661Open in IMG/M
3300004476|Ga0068966_1123330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia604Open in IMG/M
3300004479|Ga0062595_100583630All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia866Open in IMG/M
3300004631|Ga0058899_11886315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia836Open in IMG/M
3300005332|Ga0066388_105006710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium673Open in IMG/M
3300005467|Ga0070706_101239773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia685Open in IMG/M
3300005541|Ga0070733_10805674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia631Open in IMG/M
3300005541|Ga0070733_11019598All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005542|Ga0070732_10458951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia771Open in IMG/M
3300005561|Ga0066699_11283970All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium501Open in IMG/M
3300005591|Ga0070761_10436200All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005921|Ga0070766_10532154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium784Open in IMG/M
3300005995|Ga0066790_10267656All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia729Open in IMG/M
3300006800|Ga0066660_10660104All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300006854|Ga0075425_103051807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia511Open in IMG/M
3300006864|Ga0066797_1089860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1076Open in IMG/M
3300006893|Ga0073928_10317904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1163Open in IMG/M
3300006893|Ga0073928_10700660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia706Open in IMG/M
3300007076|Ga0075435_100834105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia803Open in IMG/M
3300009089|Ga0099828_11408481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium616Open in IMG/M
3300009520|Ga0116214_1012827All Organisms → cellular organisms → Bacteria2964Open in IMG/M
3300009633|Ga0116129_1082523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium944Open in IMG/M
3300009635|Ga0116117_1124157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium655Open in IMG/M
3300009645|Ga0116106_1039640All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300009645|Ga0116106_1251026All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010366|Ga0126379_13227709All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300010379|Ga0136449_103286150All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300010379|Ga0136449_103623811All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300012004|Ga0120134_1039665All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium797Open in IMG/M
3300012198|Ga0137364_10388868All Organisms → cellular organisms → Bacteria → Acidobacteria1043Open in IMG/M
3300012202|Ga0137363_11583808All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300012205|Ga0137362_11218699All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium637Open in IMG/M
3300012211|Ga0137377_10140286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2312Open in IMG/M
3300012357|Ga0137384_10296776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1344Open in IMG/M
3300012363|Ga0137390_11261193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium685Open in IMG/M
3300012923|Ga0137359_10580982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium984Open in IMG/M
3300012930|Ga0137407_11291758All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium693Open in IMG/M
3300014161|Ga0181529_10374112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium776Open in IMG/M
3300014169|Ga0181531_10507411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium745Open in IMG/M
3300014200|Ga0181526_10998491All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300014492|Ga0182013_10205818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1178Open in IMG/M
3300014493|Ga0182016_10514137All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300014654|Ga0181525_10287553Not Available898Open in IMG/M
3300014658|Ga0181519_10096129All Organisms → cellular organisms → Bacteria1919Open in IMG/M
3300014839|Ga0182027_11888331All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300016270|Ga0182036_10887264All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300016371|Ga0182034_11621772Not Available568Open in IMG/M
3300017822|Ga0187802_10286283All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300017925|Ga0187856_1274243All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300017931|Ga0187877_1237101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium707Open in IMG/M
3300017942|Ga0187808_10504048All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300017943|Ga0187819_10314549All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300017943|Ga0187819_10750375All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300017948|Ga0187847_10518815All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300017974|Ga0187777_10594646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium779Open in IMG/M
3300017975|Ga0187782_11362918Not Available557Open in IMG/M
3300018006|Ga0187804_10475380All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300018012|Ga0187810_10252932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium723Open in IMG/M
3300018026|Ga0187857_10328702All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300018034|Ga0187863_10654344All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300018037|Ga0187883_10157888All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300018038|Ga0187855_10078709All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300018044|Ga0187890_10464883All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium710Open in IMG/M
3300018088|Ga0187771_11157861All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300018433|Ga0066667_11132956All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium678Open in IMG/M
3300019240|Ga0181510_1210965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium736Open in IMG/M
3300019787|Ga0182031_1328965All Organisms → cellular organisms → Bacteria1959Open in IMG/M
3300020579|Ga0210407_11468305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium504Open in IMG/M
3300021181|Ga0210388_11207522All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium641Open in IMG/M
3300021181|Ga0210388_11242131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium631Open in IMG/M
3300021475|Ga0210392_11099803All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300022533|Ga0242662_10095254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium841Open in IMG/M
3300022716|Ga0242673_1028004All Organisms → cellular organisms → Bacteria → Acidobacteria848Open in IMG/M
3300022733|Ga0224562_1022853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium519Open in IMG/M
3300025434|Ga0208690_1080237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium507Open in IMG/M
3300025905|Ga0207685_10847790All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium506Open in IMG/M
3300025906|Ga0207699_11278086All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300025922|Ga0207646_10917890All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300026508|Ga0257161_1025772All Organisms → cellular organisms → Bacteria → Acidobacteria1140Open in IMG/M
3300027094|Ga0208094_104483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium665Open in IMG/M
3300027565|Ga0209219_1052763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1015Open in IMG/M
3300027895|Ga0209624_10483037All Organisms → cellular organisms → Bacteria → Acidobacteria825Open in IMG/M
3300029907|Ga0311329_10292674All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300029908|Ga0311341_10643945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium594Open in IMG/M
3300029910|Ga0311369_11478231All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300029911|Ga0311361_11495837All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium510Open in IMG/M
3300029939|Ga0311328_10507687All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300029943|Ga0311340_10929928Not Available720Open in IMG/M
3300030020|Ga0311344_10752693All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300030503|Ga0311370_10928700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium982Open in IMG/M
3300030520|Ga0311372_10984359All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300030524|Ga0311357_11786911Not Available512Open in IMG/M
3300030580|Ga0311355_10504587All Organisms → cellular organisms → Bacteria → Acidobacteria1160Open in IMG/M
3300030743|Ga0265461_10631634All Organisms → cellular organisms → Bacteria → Acidobacteria940Open in IMG/M
3300030813|Ga0265750_1015826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium919Open in IMG/M
3300030838|Ga0311335_11234589All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300030878|Ga0265770_1080678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium635Open in IMG/M
3300031128|Ga0170823_15305687All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300031231|Ga0170824_116439722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium809Open in IMG/M
3300031236|Ga0302324_101015762All Organisms → cellular organisms → Bacteria → Acidobacteria1125Open in IMG/M
3300031236|Ga0302324_103536630All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031524|Ga0302320_10913048All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300031524|Ga0302320_11486605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium667Open in IMG/M
3300031525|Ga0302326_11425068Not Available934Open in IMG/M
3300031525|Ga0302326_11516050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium897Open in IMG/M
3300031573|Ga0310915_11263516Not Available509Open in IMG/M
3300031708|Ga0310686_115542830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2607Open in IMG/M
3300031718|Ga0307474_10931633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium688Open in IMG/M
3300031820|Ga0307473_11298415All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031837|Ga0302315_10151279All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300031890|Ga0306925_10288001All Organisms → cellular organisms → Bacteria1768Open in IMG/M
3300031954|Ga0306926_12970993All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300032059|Ga0318533_11453030All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300032076|Ga0306924_12020414All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300032205|Ga0307472_100160695All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300032515|Ga0348332_12238689All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300032805|Ga0335078_10384959All Organisms → cellular organisms → Bacteria → Acidobacteria1848Open in IMG/M
3300032892|Ga0335081_10249616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2397Open in IMG/M
3300032893|Ga0335069_10269856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2037Open in IMG/M
3300032893|Ga0335069_10754589All Organisms → cellular organisms → Bacteria → Acidobacteria1100Open in IMG/M
3300032898|Ga0335072_10167715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus2661Open in IMG/M
3300033887|Ga0334790_112143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium867Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.06%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.26%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.26%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.65%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.84%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.03%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.23%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.42%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.42%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.42%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.81%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.81%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001172Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1EnvironmentalOpen in IMG/M
3300001175Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3EnvironmentalOpen in IMG/M
3300001176Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2EnvironmentalOpen in IMG/M
3300004476Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300027094Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF022 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12681J13546_100138633300001172Forest SoilELQELFDGDLRLVIAAYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK*
JGI12649J13570_100270613300001175Forest SoilAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK*
JGI12655J13551_10119213300001176Forest SoilIAAYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK*
Ga0068966_112333013300004476Peatlands SoilHGDLRLVIAAYAAGEQPVLARGLDYSSEEVYTYVQRIAQQYRAELRRTGGK*
Ga0062595_10058363013300004479SoilALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0058899_1188631523300004631Forest SoilELQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0066388_10500671023300005332Tropical Forest SoilVMAAYAAGEGPVLARGLDYSSQEVYTYVQRIGQQYRAELRRKERK*
Ga0070706_10123977323300005467Corn, Switchgrass And Miscanthus RhizosphereELQALFHGDFRLVVAAYAAGERPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0070733_1080567413300005541Surface SoilDLRLVIAAYAAGEKPILARGLDYSSEEVYTHVQRVAQQYRAELRRKGGR*
Ga0070733_1101959823300005541Surface SoilVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK*
Ga0070732_1045895113300005542Surface SoilELQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELGRKRGR*
Ga0066699_1128397023300005561SoilAGEKPILARRLDYSSEEVYTYVQRVAQQYRAELGRKGGR*
Ga0070761_1043620013300005591SoilIAAYAAGEKPILARGLDYSSEEVYTHVQRIAQQYRAELRRKGGR*
Ga0070766_1053215423300005921SoilRQIRARGLSYSSEEVYTYVQRIAQQYRAELRRSGVR*
Ga0066790_1026765623300005995SoilLQAHFHGDFRLVVAAYAAGEKPILARGLDYSSEEGYTYVQRIAQQYRAELRRKGGR*
Ga0066660_1066010423300006800SoilVVAAYAAGEKPILARGLDYSSEEVYTYVQRIAQQYRAELRRKGGR*
Ga0075425_10305180723300006854Populus RhizosphereHGDLRLMMAAYAVGEKPVLARGLNYSSGEVYHYVQRVAQQYSAELRREGGR*
Ga0066797_108986033300006864SoilMAAYAAGERPILVRGLNYSSSEVYAYVQRIAQQYRAEREGGK*
Ga0073928_1031790423300006893Iron-Sulfur Acid SpringPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0073928_1070066023300006893Iron-Sulfur Acid SpringQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0075435_10083410523300007076Populus RhizosphereRLVMAAYAAGEKPILARGLDYSSEEVFKYVQRVAQQYRAELGRKGGR*
Ga0099828_1140848123300009089Vadose Zone SoilYAAGEKPILARGLDYSSEEVYTYVQRVAQQYRAELGRKGGR*
Ga0116214_101282713300009520Peatlands SoilLRLVIAAYAAGERPVLAQGLDYSSAEVYTYVQRIGQQYRAELRRTGGK*
Ga0116129_108252323300009633PeatlandAAYAAGEGPVLARGLDYSSQEVYTYVQRIGQQYRAELRRKERR*
Ga0116117_112415713300009635PeatlandGDLRLVMAAYAAGEGPVLARGLDYSSQEVYTYVQRIGQQYRAELRRKERK*
Ga0116106_103964013300009645PeatlandHGDLRLVIAAYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK*
Ga0116106_125102623300009645PeatlandLFHGDLRLMMAAYAAGEGPVLARGLDYSSEAVYTYVQRIGQQYRAELRQKERK*
Ga0126379_1322770923300010366Tropical Forest SoilGERPIKAKGLNYSSPEVYDYVQRIAQQYRAELRRTGGK*
Ga0136449_10328615023300010379Peatlands SoilAYLAELQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYAYVQRIVQQYRAELRRKGGR*
Ga0136449_10362381123300010379Peatlands SoilDLRLVMAAYVAGEKPILARRLDYSSEEVYTYVQRVAQQYRAELGRKGGR*
Ga0120134_103966513300012004PermafrostFRLVVAAYAAGERPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0137364_1038886823300012198Vadose Zone SoilAAYVAGERPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0137363_1158380813300012202Vadose Zone SoilLVVAAYAAGERPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0137362_1121869923300012205Vadose Zone SoilDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0137377_1014028633300012211Vadose Zone SoilLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0137384_1029677613300012357Vadose Zone SoilEPIRARGLSYSSAEVYNYVQLVATRYRAELQRKGRR*
Ga0137390_1126119323300012363Vadose Zone SoilGDLRLVMAAYAAGERPISARGLHYSSSEVYAYVRRIAQQYRAELGREGGN*
Ga0137359_1058098223300012923Vadose Zone SoilAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0137407_1129175823300012930Vadose Zone SoilRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR*
Ga0181529_1037411223300014161BogVLTRGLDYSSAEVYAYVQRIGQQYRAELRSKERK*
Ga0181531_1050741123300014169BogLMMAAYAAGEAPVLARGLDYSSAEVSTYVQRIGQQYRAELRRKERK*
Ga0181526_1099849123300014200BogGPVLTRGLDYSSAEVYAYVQRIGQQYRAELRGKERK*
Ga0182013_1020581823300014492BogAAGEGPVLTRGLDYSSAEVYAYVQRIGQQYRAELRGKERK*
Ga0182016_1051413723300014493BogDLRLVMAAYAAGERQIRARGLSYSSEEVYAYVQRIAQQYRAELRRSGVR*
Ga0181525_1028755313300014654BogRPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK*
Ga0181519_1009612943300014658BogRLVIAAYAAGEKPILAGGLDYSSEEVYTHVQRVAQQYRAELRRKGGR*
Ga0182027_1188833123300014839FenIAAYAAGEGPVLTRGLDYSSAEVYAYVQRIGQQYRAELRSKERR*
Ga0182036_1088726413300016270SoilLQALFHGDVRLVLAAYAAGEKPILARGLEYSSEEVYTSVRRTLQQYRAELARKGGR
Ga0182034_1162177213300016371SoilAAGERPIMAQGLDYSSPEVYGYVHRIAEQYRAELRRVGRR
Ga0187802_1028628313300017822Freshwater SedimentIAAYAAGEQPVLARGLDYSSEEVYTYVQRIAQQYRAELRRTGGK
Ga0187856_127424313300017925PeatlandLAELQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR
Ga0187877_123710113300017931PeatlandELQARFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVHRIAQQYRAELRRKGGR
Ga0187808_1050404823300017942Freshwater SedimentLVIAAYAAGEQPVLARGLDYSSEEVYTYVQRIAQQYRAELRRTGGK
Ga0187819_1031454913300017943Freshwater SedimentDLRLVIAAYAAGEGPVLARGLEYSSQEVYTYVQRIGQQYRAELRRKERK
Ga0187819_1075037513300017943Freshwater SedimentYAAGEQPVLARGLDYSSEEVYTYVQRIAQQYRAELRRTGGK
Ga0187847_1051881513300017948PeatlandAYAVGEKPILARGLDYSSEEVFTYVQRVAQQYRAELGRKGGR
Ga0187777_1059464623300017974Tropical PeatlandLRLVMAAYSAGERPVLARGLDYSSQEVYTYVQRIGQQYRAELRRKERK
Ga0187782_1136291823300017975Tropical PeatlandELMGLFHDDLRLVMAAYAAGEKPVLARGLEYSSPEVYRCVQKIAWQYRAELERERGKRQ
Ga0187804_1047538013300018006Freshwater SedimentGDFRLVMAAYAAGEKPILARGLDYSSEEVFTYVQRVAQQYRAELGRKGGR
Ga0187810_1025293213300018012Freshwater SedimentAYAAGEGPVLARGLEYSSQEVYTYIQRVGQQYRAELRRKERK
Ga0187857_1032870213300018026PeatlandAELQALFHGDFRLVVAAYAAGERPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR
Ga0187863_1065434423300018034PeatlandGEKPILARGLDYSSEEVYTHVQRIAQQYRAELRRKGGR
Ga0187883_1015788813300018037PeatlandIAAYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0187855_1007870933300018038PeatlandAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR
Ga0187890_1046488323300018044PeatlandLQAHFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIAQQYRAELRRKGGR
Ga0187771_1115786123300018088Tropical PeatlandAELQALFHGDVRLVLAAYAVGEKPILARGLDYSSEEVYTSVRRTLQQYRAELARKGGR
Ga0066667_1113295613300018433Grasslands SoilELKAHFHVDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIAQQYRAELRRKGGR
Ga0181510_121096523300019240PeatlandQAHFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVLRIVQQYRAELRRKGGR
Ga0182031_132896513300019787BogAAYAAGEGPVLTRGLDYSSAEVYAYVQRIGQQYRAELRSKERK
Ga0210407_1146830513300020579SoilRVVMAAYAAGERPILARGLNCSSSEVYAYVRRIAQQYRAELGRDGGK
Ga0210388_1120752213300021181SoilHGDLRLVMAAYAAGERQICPRGLSYSSQEVYAYVQRIAQQYRAELRRSGGN
Ga0210388_1124213113300021181SoilLRLVMAAYAAGERQIRARGLSYSSEEVYTYVQRIAQQYRAELRRSGGR
Ga0210392_1109980313300021475SoilVAYLAELQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR
Ga0242662_1009525413300022533SoilLQSLFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRFVQQYRAELRRKGGR
Ga0242673_102800413300022716SoilHGDLRLVIAAYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0224562_102285323300022733SoilDLRLVIAAYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0208690_108023723300025434PeatlandAAYAAGERQIRARGLSYSSEEVYAYVQRIAQQYRAELRRSGVR
Ga0207685_1084779023300025905Corn, Switchgrass And Miscanthus RhizosphereAGERPISARGLNYSSSEVYAYVLRMAQQYRAELGREGGK
Ga0207699_1127808623300025906Corn, Switchgrass And Miscanthus RhizosphereYAAGEKPILARGLDYSSEEVFKYVQRVAQQYRAELGRKGGR
Ga0207646_1091789013300025922Corn, Switchgrass And Miscanthus RhizosphereSILARGLDYSSEEVFTYVQRVAQQYRAELGRKGGR
Ga0257161_102577213300026508SoilLQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR
Ga0208094_10448323300027094Forest SoilEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR
Ga0209219_105276323300027565Forest SoilVAYLAELQALFHGDFRLVVAAYAAGEKPILARGLDCSSEEVYTYVQRVAQQYRAELGRKGGR
Ga0209624_1048303713300027895Forest SoilHGDLRLVIAAYAAGERPVLARGLNYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0311329_1029267413300029907BogAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0311341_1064394523300029908BogAGEGPVLTRGLDYSSAEVYAYVQRIGQQYRAELRSKERK
Ga0311369_1147823113300029910PalsaLAELQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYAYVQRIVQQYRAELRRKGGR
Ga0311361_1149583723300029911BogGDFRLVVAAYAAGERPILARGLDYSSEEVYAYVQRIVQQYRAELRRKGGR
Ga0311328_1050768713300029939BogVMAAYAAGERQIRSRGLSYSSEEVYAYVQRIAQQYRAELRRSGGS
Ga0311340_1092992813300029943PalsaRLVIAAYAAGEKPILASGLNYSSEEVYTHVRRIGEQYRAELRRKGGR
Ga0311344_1075269313300030020BogRLVMAAYAAGERQIRARGLSYSSEEVYAYVQRIAQQYRAELRRSGVR
Ga0311370_1092870013300030503PalsaIAGYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0311372_1098435913300030520PalsaGYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0311357_1178691123300030524PalsaAYAAGERKIRPRGLGYSSEEVYTYVQRIAQQYRAELRRSGVR
Ga0311355_1050458723300030580PalsaAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR
Ga0265461_1063163423300030743SoilAAYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0265750_101582613300030813SoilAYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0311335_1123458913300030838FenYAAGERPILARGLNYSSSEVYAYVRRIAQQYRAELGREGGK
Ga0265770_108067813300030878SoilGDLRLVIAAYAAGERPVLARGLDYSSEEVYTYVQRVGQQYRAELRRTGGK
Ga0170823_1530568713300031128Forest SoilPILARRLDYSSKEVYTYVQRVAQQYRAELGRKGGR
Ga0170824_11643972223300031231Forest SoilAYLAELQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYAYVQRIVQQYRAELRRKGG
Ga0302324_10101576213300031236PalsaVAYLAELQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYAYVQRIVQQYRAELRRKGGR
Ga0302324_10353663013300031236PalsaAGEQPVLARGLAYSSKEVYSYVQRIAQQYRAELRRTGGK
Ga0302320_1091304823300031524BogLFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYAYVQRIVQQYRAELRRKGGR
Ga0302320_1148660513300031524BogGDLRLVIAAYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0302326_1142506823300031525PalsaVAYLAELQKLFHRDLRLVIAAYAAGEKPILAGGLDYSSDEVYTHVQRVAQQYRAELRRKGGR
Ga0302326_1151605013300031525PalsaAYAAGERPVLARGLNYSSQEVYTYVQRIGQQYRAELRRKERR
Ga0310915_1126351623300031573SoilLRLVMAAYAAGERPIMAQGLDYSSPEVYGYVHRIAEQYRAELRRVGRR
Ga0310686_11554283013300031708SoilAYAAGERQIRPRGLSYSSEEVYAYVQRIAQQYRAELRRSGVR
Ga0307474_1093163313300031718Hardwood Forest SoilAAYVAGERQIRARGLSYSSEEVYTYVQRIAQQYRAELRRSGGG
Ga0307473_1129841523300031820Hardwood Forest SoilELQALFHGDFRLVMAAYAAGEKPILARGLDYSSEEVYTYVQRVAQQYRAELGRKGGR
Ga0302315_1015127933300031837PalsaYAAGERPVLARGLDYSSEEVYTYVQRIGQQYRAELRRTGGK
Ga0306925_1028800113300031890SoilGDLRLVMAAYAAGEGPVLARGLDYSSQEVYTYVQRIGQQYRAELRRRERK
Ga0306926_1297099313300031954SoilAYAAGERPILARGLDYSSEEVYTYVQRVAQQYRAELGRKGGR
Ga0318533_1145303013300032059SoilPILARGLDYSSEEVYTSVRRTLQQYRAELARKGGR
Ga0306924_1202041423300032076SoilHGDLRLVMAAYAAGERPVLARGLDYSSQEVYTYVQRIGQQYRAELRRKERK
Ga0307472_10016069533300032205Hardwood Forest SoilAELQALFHGDFRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR
Ga0348332_1223868923300032515Plant LitterRLVVAAYAAGEKPILARGLDYSSEEVYTYVQRIVQQYRAELRRKGGR
Ga0335078_1038495913300032805SoilLVVAAYAAGERPIIAKGLGYSSPEVYGYVQEIARQYRIELARARGRVQ
Ga0335081_1024961613300032892SoilMAAYAVGEAPVLARGLDYSSQEVYTYVHRIGQQYRAELRRTERK
Ga0335069_1026985613300032893SoilGEKPILARGLDYSSEEVFTYVQRVAQQYRAELGRKGGR
Ga0335069_1075458913300032893SoilGEGPVLARGLEYSSQDVYTYVQRIGQQYRAELRRKERR
Ga0335072_1016771533300032898SoilLIVAAYAAGEKPILARGLSYSSEEVYRYVQRIAQEYGAELSRDERR
Ga0334790_112143_1_1353300033887SoilVAAYAAGEKPILARGLDYSSEEVYTYVQRIAQQYRAELRRKGER


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.