NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068364

Metagenome / Metatranscriptome Family F068364

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068364
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 38 residues
Representative Sequence MSRLRKIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKL
Number of Associated Samples 93
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.39 %
% of genes near scaffold ends (potentially truncated) 95.16 %
% of genes from short scaffolds (< 2000 bps) 93.55 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.419 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(41.129 % of family members)
Environment Ontology (ENVO) Unclassified
(59.677 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(44.355 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 45.45%    β-sheet: 0.00%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00196GerE 21.77
PF14026DUF4242 9.68
PF03176MMPL 4.03
PF01569PAP2 2.42
PF00072Response_reg 1.61
PF04264YceI 1.61
PF02687FtsX 1.61
PF03706LPG_synthase_TM 0.81
PF07366SnoaL 0.81
PF09348DUF1990 0.81
PF08352oligo_HPY 0.81
PF01872RibD_C 0.81
PF00069Pkinase 0.81
PF01934HepT-like 0.81
PF00441Acyl-CoA_dh_1 0.81
PF00083Sugar_tr 0.81
PF13577SnoaL_4 0.81
PF06897DUF1269 0.81
PF13401AAA_22 0.81
PF12146Hydrolase_4 0.81
PF13006Nterm_IS4 0.81
PF00027cNMP_binding 0.81
PF00892EamA 0.81
PF132392TM 0.81
PF05598DUF772 0.81
PF00583Acetyltransf_1 0.81
PF13359DDE_Tnp_4 0.81
PF14690zf-ISL3 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 4.03
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 4.03
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.23
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 1.61
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.81
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.81
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.81
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.81
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.81
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 0.81
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.42 %
UnclassifiedrootN/A47.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101510586Not Available710Open in IMG/M
3300005468|Ga0070707_100147067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2293Open in IMG/M
3300005471|Ga0070698_100719213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales941Open in IMG/M
3300005764|Ga0066903_106618966Not Available603Open in IMG/M
3300005764|Ga0066903_107554752All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005841|Ga0068863_101640486Not Available652Open in IMG/M
3300005983|Ga0081540_1250906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia617Open in IMG/M
3300006031|Ga0066651_10764728Not Available522Open in IMG/M
3300009545|Ga0105237_10752868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia981Open in IMG/M
3300009839|Ga0116223_10386892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia824Open in IMG/M
3300010333|Ga0134080_10642135Not Available521Open in IMG/M
3300010359|Ga0126376_11118418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia797Open in IMG/M
3300010361|Ga0126378_12058400All Organisms → cellular organisms → Bacteria → Terrabacteria group651Open in IMG/M
3300010361|Ga0126378_12562107Not Available583Open in IMG/M
3300010361|Ga0126378_12650590All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300010361|Ga0126378_12904042Not Available547Open in IMG/M
3300010376|Ga0126381_101004973All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300010376|Ga0126381_101519424Not Available968Open in IMG/M
3300010376|Ga0126381_101816122Not Available880Open in IMG/M
3300010376|Ga0126381_102413365Not Available754Open in IMG/M
3300010376|Ga0126381_104614111Not Available531Open in IMG/M
3300010379|Ga0136449_101244929All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300010398|Ga0126383_10503978Not Available1269Open in IMG/M
3300011085|Ga0138581_1085933Not Available649Open in IMG/M
3300012200|Ga0137382_10494011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia869Open in IMG/M
3300012201|Ga0137365_10813198Not Available682Open in IMG/M
3300012205|Ga0137362_10105087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2382Open in IMG/M
3300012354|Ga0137366_10477565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides902Open in IMG/M
3300012356|Ga0137371_10150926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1821Open in IMG/M
3300012960|Ga0164301_11026577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300012971|Ga0126369_10689680Not Available1098Open in IMG/M
3300012971|Ga0126369_11787254All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300012977|Ga0134087_10063848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1479Open in IMG/M
3300015371|Ga0132258_13601361Not Available1059Open in IMG/M
3300016270|Ga0182036_11286740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300016319|Ga0182033_11232989Not Available671Open in IMG/M
3300016341|Ga0182035_12054217Not Available519Open in IMG/M
3300016357|Ga0182032_10742914All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300016357|Ga0182032_10793014Not Available800Open in IMG/M
3300016357|Ga0182032_12071031Not Available500Open in IMG/M
3300016371|Ga0182034_10987667Not Available727Open in IMG/M
3300016404|Ga0182037_10944079Not Available749Open in IMG/M
3300016445|Ga0182038_10320998Not Available1273Open in IMG/M
3300016445|Ga0182038_10669286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria901Open in IMG/M
3300017955|Ga0187817_10105471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium1776Open in IMG/M
3300017955|Ga0187817_10381990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria899Open in IMG/M
3300017955|Ga0187817_10901509Not Available565Open in IMG/M
3300017961|Ga0187778_10491168Not Available814Open in IMG/M
3300018001|Ga0187815_10067094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae1509Open in IMG/M
3300018085|Ga0187772_10109052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1792Open in IMG/M
3300018085|Ga0187772_10428976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria924Open in IMG/M
3300025915|Ga0207693_11002536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium638Open in IMG/M
3300025928|Ga0207700_11715159Not Available554Open in IMG/M
3300027812|Ga0209656_10454767Not Available566Open in IMG/M
3300027874|Ga0209465_10641014All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300031543|Ga0318516_10570715Not Available647Open in IMG/M
3300031544|Ga0318534_10260331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300031549|Ga0318571_10462942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella muralis505Open in IMG/M
3300031561|Ga0318528_10765978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300031564|Ga0318573_10296838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae865Open in IMG/M
3300031572|Ga0318515_10273509All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300031572|Ga0318515_10681271Not Available544Open in IMG/M
3300031668|Ga0318542_10157137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1133Open in IMG/M
3300031680|Ga0318574_10606800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NRRL S-4642Open in IMG/M
3300031681|Ga0318572_10550698All Organisms → cellular organisms → Bacteria → Terrabacteria group687Open in IMG/M
3300031681|Ga0318572_10903776Not Available524Open in IMG/M
3300031681|Ga0318572_10949451Not Available511Open in IMG/M
3300031682|Ga0318560_10811437Not Available505Open in IMG/M
3300031723|Ga0318493_10660687All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300031744|Ga0306918_10442226All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300031748|Ga0318492_10242164All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300031751|Ga0318494_10084057All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300031751|Ga0318494_10118809All Organisms → cellular organisms → Bacteria → Terrabacteria group1471Open in IMG/M
3300031751|Ga0318494_10731894Not Available579Open in IMG/M
3300031765|Ga0318554_10058367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2123Open in IMG/M
3300031769|Ga0318526_10236909Not Available746Open in IMG/M
3300031777|Ga0318543_10523424All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031778|Ga0318498_10484980All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031779|Ga0318566_10286543Not Available815Open in IMG/M
3300031782|Ga0318552_10721536Not Available509Open in IMG/M
3300031796|Ga0318576_10536163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300031797|Ga0318550_10520491All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300031797|Ga0318550_10580136Not Available539Open in IMG/M
3300031798|Ga0318523_10215086Not Available960Open in IMG/M
3300031798|Ga0318523_10607422Not Available538Open in IMG/M
3300031805|Ga0318497_10222013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1046Open in IMG/M
3300031805|Ga0318497_10846303Not Available513Open in IMG/M
3300031835|Ga0318517_10073968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1466Open in IMG/M
3300031859|Ga0318527_10061215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1491Open in IMG/M
3300031880|Ga0318544_10405654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia530Open in IMG/M
3300031893|Ga0318536_10652363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300031896|Ga0318551_10343610Not Available844Open in IMG/M
3300031910|Ga0306923_10161400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae2560Open in IMG/M
3300031910|Ga0306923_10403991Not Available1554Open in IMG/M
3300031910|Ga0306923_11192645All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300031912|Ga0306921_11208527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300031946|Ga0310910_10307853Not Available1247Open in IMG/M
3300031947|Ga0310909_10791905Not Available783Open in IMG/M
3300031954|Ga0306926_10058819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4618Open in IMG/M
3300031954|Ga0306926_11578457Not Available754Open in IMG/M
3300032001|Ga0306922_10015933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7417Open in IMG/M
3300032001|Ga0306922_10417390All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300032001|Ga0306922_10745003All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300032008|Ga0318562_10209904Not Available1128Open in IMG/M
3300032010|Ga0318569_10462469Not Available592Open in IMG/M
3300032039|Ga0318559_10026994All Organisms → cellular organisms → Bacteria2258Open in IMG/M
3300032039|Ga0318559_10469046Not Available587Open in IMG/M
3300032041|Ga0318549_10431844Not Available593Open in IMG/M
3300032043|Ga0318556_10492504Not Available641Open in IMG/M
3300032052|Ga0318506_10356300Not Available649Open in IMG/M
3300032054|Ga0318570_10458480Not Available582Open in IMG/M
3300032067|Ga0318524_10309355Not Available818Open in IMG/M
3300032068|Ga0318553_10207746All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300032068|Ga0318553_10674568Not Available541Open in IMG/M
3300032076|Ga0306924_10400750All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300032089|Ga0318525_10242120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300032160|Ga0311301_10239934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3012Open in IMG/M
3300032180|Ga0307471_103557398Not Available551Open in IMG/M
3300032261|Ga0306920_100943716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1259Open in IMG/M
3300032261|Ga0306920_101927855Not Available830Open in IMG/M
3300032783|Ga0335079_11748546All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300032805|Ga0335078_11348577Not Available810Open in IMG/M
3300033289|Ga0310914_11316923Not Available625Open in IMG/M
3300033805|Ga0314864_0175522Not Available553Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil41.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.03%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.23%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.61%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011085Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10151058613300000364SoilMGIARRAAEIPAGGWTKWLVLGFWLVVVVVAFPLSGK
Ga0070707_10014706723300005468Corn, Switchgrass And Miscanthus RhizosphereMDRLKKIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKLTG
Ga0070698_10071921333300005471Corn, Switchgrass And Miscanthus RhizosphereMSRIRKAAEIPAGSWTKWVVVGFWVAVLLIALPLAGKLKG
Ga0066903_10661896623300005764Tropical Forest SoilMSRLSKIAEIPAGSWTKWVVVGFWVVVLVITFPLSTKLMGAEK
Ga0066903_10755475213300005764Tropical Forest SoilMNKVARRLAEIPAGSWTKWVVMGFWVAVLVVALPLA
Ga0068863_10164048633300005841Switchgrass RhizosphereMKNVARRFAEIPVGSWTKWVVVGFWVVAVAVAYPLSGK
Ga0081540_125090623300005983Tabebuia Heterophylla RhizosphereMSNVARRLAEIPAGSWTKWLVVGFWVVVVAVAYPLAG
Ga0066651_1076472813300006031SoilMNVARKIVEFPAGSWTKWLVVGFWVVVLVIAFPLSSKL
Ga0105237_1075286813300009545Corn RhizosphereMGSLRRIAEIPAGSWTKWLVVGFWLVVLILAFPLSTKLTGAE
Ga0116223_1038689223300009839Peatlands SoilMSRLRKIAEIPAGSWTKWIVVGFWVLMLVILFPLSA
Ga0134080_1064213513300010333Grasslands SoilMNVARKIVEFPAGSWTKWLVVGFWVVVLVIAFPLSSKLTGA
Ga0126376_1111841823300010359Tropical Forest SoilMSKVARRLAEIPAGSWTKWVVMGFWVAVIVVAFPLAG
Ga0126378_1205840013300010361Tropical Forest SoilMNKVARRLAEIPAGSWTKWVVMGFWVAVIVVAFPLA
Ga0126378_1256210723300010361Tropical Forest SoilMSRVRRIAEVPTGSRAKWLVVGFWVVVLVDSFPLSK
Ga0126378_1265059013300010361Tropical Forest SoilMSRLGKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQKKLMGAEK
Ga0126378_1290404213300010361Tropical Forest SoilMSGIRRIAEFPAGSWTKWVVVGFWVVVLVITFPLSKKLNH
Ga0126381_10100497333300010376Tropical Forest SoilMNKVARRLTEIPAGSWTKWVVVGFWVVVLVITFPLSKKLNHA
Ga0126381_10151942423300010376Tropical Forest SoilMNNTVRRLAEIPAGSWTKWVVVGFWVVVLVLAFPLQK
Ga0126381_10181612213300010376Tropical Forest SoilMTKAARRLAEIPGGSWTKWLVMGFWVAVIVVALPL
Ga0126381_10241336533300010376Tropical Forest SoilMNRLRKIAEIPAGSWTKWVVVGVWVVVLVIALPLSSKLTGA
Ga0126381_10461411123300010376Tropical Forest SoilMNKVARRLAEIPAGSWTKWVVVAFWLVVLVIALPLSS
Ga0136449_10124492923300010379Peatlands SoilMNSVKKLAEIPSGSWTKWIVVGFWLVVLVITLPLSSKLTGA*
Ga0126383_1050397823300010398Tropical Forest SoilMSTARRIAEIPAGSWTRWVVVGFWLVMLVVMFPLSG
Ga0138581_108593313300011085Peatlands SoilMSRLRKIAEIPAGSWTKWVVVGFWVAVLVVMFSLSAKLMGAEKND
Ga0137382_1049401123300012200Vadose Zone SoilMSRARRIAEIPAGSWTKWLVVGFWLVVVVVAFPLSNKLMGA
Ga0137365_1081319813300012201Vadose Zone SoilMSRARRIAEIPAGSWTKWLVVGFWLVVVVVAFPLSNKLMGAEK
Ga0137362_1010508743300012205Vadose Zone SoilMSKLRRIAEIPAGSWTKWVVVGFWVVVLVLALPLSGVPAL*
Ga0137366_1047756513300012354Vadose Zone SoilMSGLRRIVEIPAGSWTKWLVVGFWVVVLVVAFPLS
Ga0137371_1015092613300012356Vadose Zone SoilMSRARRIAEIPAGSWTKWLVVGFWLVVEVVAFPLSNKLMGAEK
Ga0164301_1102657713300012960SoilMSKARRIAEIPAGSWTKWLVVGLWAVVLIISFPLA
Ga0126369_1068968023300012971Tropical Forest SoilMNKVARRLAEIPAGSWTKWVVMGFWVAVIVVAFPL
Ga0126369_1178725423300012971Tropical Forest SoilMNGVRKLAEIPAGSWTKWVVLGFWVIVLVITLPLSSKLI
Ga0134087_1006384823300012977Grasslands SoilMNVARKIVEFPAGSWTKWLVVGFWVVVLVIEVISAK*
Ga0132258_1360136113300015371Arabidopsis RhizosphereMKNVAQRFAEIPVGSWTKWVVVGFWVVAVAVAYPLSGKLTGA
Ga0182036_1128674023300016270SoilMSRLSKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQ
Ga0182033_1123298923300016319SoilVSTLRKIAEIPAGSWTKWLVVGFWVAVLAVASPLAIKL
Ga0182035_1205421713300016341SoilMSKLGKIAEIPAGRWTKWLVVGFWVVMVAVLYPLSSKLTAA
Ga0182032_1074291413300016357SoilMSKLSKIAEIPAGSWTKWLVVGVWLVVVAVLYPLSTKLMGAEKN
Ga0182032_1079301423300016357SoilMSRLRTIAAIPAGSWTKWAVVGFWLVVLVVAHPLQSKLTALAGEMA
Ga0182032_1207103123300016357SoilMNKVARRLAEIPAGSWTKWVVMGFWVAVIVVALPLAGKLQHAYNNN
Ga0182034_1098766723300016371SoilMNRLRKIAEIPAGSWTKWVVVGVWVVVLVIALPLSS
Ga0182037_1094407933300016404SoilVSTLRKIAEIPTGSGTKWLVVGFWVVVLVAAFPLSK
Ga0182038_1032099823300016445SoilMSRLRRVAEIPAGSWTKWVVVGFWLAVLVLALPLSSKLSG
Ga0182038_1066928633300016445SoilMNKVGRRLVGIPAGSWTKWLVVGFWLVVVVVAYPLQSKLSGVEKAA
Ga0187817_1010547143300017955Freshwater SedimentMSRLGKIAEIPAGSWTKWVVVGFWVLMLVILFPLSTKLN
Ga0187817_1038199013300017955Freshwater SedimentMSRLRKIAEIPAGSWTKWLVVGVWLVVIVLAFPLSSKLTGA
Ga0187817_1090150913300017955Freshwater SedimentMSRLRKIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKL
Ga0187778_1049116813300017961Tropical PeatlandMSRLRTIAAIPAGSWTKWLAVGFWVAVLVVMFPLSAKL
Ga0187815_1006709413300018001Freshwater SedimentMSRLGKIAEIPAGSWTKWIVVGFWVVVLVLAFPLSKKLT
Ga0187772_1010905213300018085Tropical PeatlandMSRLRKITLIPAGSWTQRVVVGSWVLMLVTLSRCQHS
Ga0187772_1042897623300018085Tropical PeatlandMSRLRNVAEIPAGSWTKWVVVGFWVVVLVVMFPLS
Ga0207693_1100253613300025915Corn, Switchgrass And Miscanthus RhizosphereMSRLRKIAEFPAGSWTKWVVVGVWVVVLVILFPLSKKI
Ga0207700_1171515913300025928Corn, Switchgrass And Miscanthus RhizosphereMKNVARRFAEIPAGSWTKWVVVGFWVVAVAVAYPLSGKLT
Ga0209656_1045476723300027812Bog Forest SoilMSRLGKIAEIPAGSWTKWVVVGFWVLMLVILFPLSTKLNGAEKNDAK
Ga0209465_1064101413300027874Tropical Forest SoilMKNVARRLTEIPAGSWTKWVVVGFWLVVLVIAAPLS
Ga0318516_1057071513300031543SoilMSRLRKIAEIPAGSWTKWLVVGCWLVVVVVAYPLQSKLMG
Ga0318534_1026033123300031544SoilMSRLRKIAEIPAGSWTKWLVVGFWLVVVVVAYPLQSKLSGVEKAA
Ga0318571_1046294213300031549SoilMSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSSKLTG
Ga0318528_1076597813300031561SoilMSSLRRIAEIPAGSWTKWVVVGFWLVILVLAFPLSSKL
Ga0318573_1029683813300031564SoilMSKLSKIAEIPAGSWTKWLVVGVWLVVVAVLYPLSTK
Ga0318515_1027350933300031572SoilMSNVARRLAEIPAGSWTKWLVVGFWVVVVAVAYPL
Ga0318515_1068127113300031572SoilMSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSTRLT
Ga0318542_1015713723300031668SoilMSRLSKIAEIPAGSWTKWVVVGFWVVMLVILAPLSTKLMGA
Ga0318574_1060680013300031680SoilVRRIAEIPSGSRTRWLVVGFWLVVVVLAGPLSGKLT
Ga0318572_1055069813300031681SoilMSRLSRIAAIPAGSWTKWVVMGFWLVVLVVAYPLSSK
Ga0318572_1090377613300031681SoilMSRLRRIAEIPAGSWTRWVVVGFWLAVLVLALPLSS
Ga0318572_1094945113300031681SoilMNRLRKIAEIPAGSWTKWVVVGVWAVVLVIALPLS
Ga0318560_1081143713300031682SoilMSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSSKLT
Ga0318493_1066068713300031723SoilVSTLRKIAEIPAGSWTKWLVVGFWVAVLAVASPLAIKLKHAEKN
Ga0306918_1044222613300031744SoilMSRLSKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQKKLM
Ga0318492_1024216433300031748SoilMSKLSKIAEIPAGSWTKWLVVGVWVVVVAVLYPLSTKLM
Ga0318494_1008405713300031751SoilMNGVKKLADIPAGSWTKWVVMGFWVVVLVIALPLSSKLMG
Ga0318494_1011880923300031751SoilMSRLRKIAEIPAGSWTKWLVVGFWLVVVVVAYPLQSKLSG
Ga0318494_1073189423300031751SoilMSRLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSS
Ga0318554_1005836713300031765SoilMSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLST
Ga0318526_1023690913300031769SoilMSKLRRIAEIPAGTWTKWVVVGFWLAVLVLALPLSS
Ga0318543_1052342423300031777SoilMNGVKKLAEIPAGSWTKWVVLGFWVVVLVITLPLSSKLM
Ga0318498_1048498013300031778SoilMNGVKKLADIPAGSWTKWVVMGFWVVVLVIALPLSS
Ga0318566_1028654313300031779SoilMNKVGRRLAEIPAGSWTKWIVVGFWLVVLLIALPLSGKL
Ga0318552_1072153613300031782SoilMSRLRKIAEIPAGSWTKWLVVGLWLVVVAVAYPLQS
Ga0318576_1053616313300031796SoilMSSLRRIAEIPAGSWTKWVVVGFWLVILVLAFPLSS
Ga0318550_1052049113300031797SoilMNGVKKLADIPAGSWTKWVVMGFWVVVLVIALPLSSK
Ga0318550_1058013613300031797SoilMNKVGRRLAGIPAGSWTKWLVVGFWVVIFAVAYPLAGKLG
Ga0318523_1021508623300031798SoilMSRLRNIAEIPAGSWTKWVVVGFWVVVLVLAFPLQKKLTGAEKN
Ga0318523_1060742213300031798SoilMSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSTRL
Ga0318497_1022201333300031805SoilMSKLSKIAEIPAGSWTKWLVVGVWVVVVAVLYPLSTK
Ga0318497_1084630323300031805SoilMSRPRNIAEIPAGSWTKWVVVGFWVVVLVLAFPLS
Ga0318517_1007396843300031835SoilMSKVARRLAGIPAGSWTKYAVVGFWVVVLVVAFPLAGKLGHAYKN
Ga0318527_1006121513300031859SoilMSKAARRLAEIPGGSWTKWLVMGFWVAVMVVAFPLSAK
Ga0318544_1040565423300031880SoilMSSLRKIAEIPAGSWTKWVVVGFWLVILVLAFPLS
Ga0318536_1065236313300031893SoilMSWLRKAAEIPAGSWTKWVVVGFWVAVLVITFPLAG
Ga0318551_1034361023300031896SoilMNGLKKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQKKLTGAE
Ga0306923_1016140023300031910SoilMNGLKKIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKL
Ga0306923_1040399113300031910SoilMSKLGKIAEIPAGSWTKWLVVGFWVVMVAVLYPLSSKLTAA
Ga0306923_1119264513300031910SoilMSKVVRRLAEIPAGSWTKWVVMGFWVAAVVVALPLAGKLMHA
Ga0306921_1120852723300031912SoilMSKLGKIAEIPAGRWTKWLVVGFWVVMVAVLYPLSSKL
Ga0310910_1030785313300031946SoilMSKLRRIAEIPAGTWTKWVVVGFWLAVLVLALPLSSKL
Ga0310909_1079190513300031947SoilMSAVARRLAGIPAGSWTKWLVVGFWVVVVVAAYPLQNK
Ga0306926_1005881913300031954SoilMSRLRTIAAIPAGSWTKWVVVGFWLVVLVVAYPPQS
Ga0306926_1157845723300031954SoilMSRLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSSTL
Ga0306922_1001593373300032001SoilMSRLSKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQK
Ga0306922_1041739023300032001SoilMSLRRIAEIPAGSWTKWVVVGFWLVILVLAFPLSS
Ga0306922_1074500313300032001SoilMDKVARRIAGIPAGSWTKWLVVGFWVVVVLVAYPL
Ga0318562_1020990423300032008SoilMSKLRRIAEIPAGTWTKWVVVGFWLAVLVLALPLSSK
Ga0318569_1046246913300032010SoilMNKVGRRLAGIPAGSWTKWLVVGFWVVIFAVAYPLAGKLGH
Ga0318559_1002699413300032039SoilMSAVARRLAGIPAGSWTKWLVVGFWVVVVVAAYPLSGK
Ga0318559_1046904623300032039SoilMSTLRKIAEIPAGSWIKWLVVGFWVAVLVAAFPLSK
Ga0318549_1043184413300032041SoilMNKVGRRLAEIPAGSWTKWIVVGFWLVVLLIALPLS
Ga0318556_1049250423300032043SoilVSTLRKIAEIPAGSWTKWLVVGFWVAVLAVASPLAIKLKH
Ga0318506_1035630013300032052SoilMSKVVRRLAEIPAGSWTKWVVMGFWLVVVVVAAPLAG
Ga0318570_1045848013300032054SoilMNKVGRRLVGIPAGSWTKWLVVGFWVVIFAVAYPLA
Ga0318524_1030935533300032067SoilMNKVGRRLAEIPAGSWTKWLVVGFWVVIFVVAYPLSG
Ga0318553_1020774613300032068SoilVSTLRRIAEIPTGSWTKWLVVGFWVVVLVVAFPLSKKLNGAE
Ga0318553_1067456813300032068SoilMNRLRKIAEIPAGSWTKWVVVGVWAVVLVIALPLSSKLT
Ga0306924_1040075023300032076SoilMSRLRNIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKLTGA
Ga0318525_1024212023300032089SoilMSRLSRIAAIPAGSWTKWVVMGFWLVVLVVAYPLSGKLT
Ga0311301_1023993443300032160Peatlands SoilMSRLRKIAEIPAGSWTKWIVVGFWVLMLVILFPLSAKLQGAEK
Ga0307471_10355739813300032180Hardwood Forest SoilMSKIARRLAEIPAGSWTKWLVVGFWLVVVVVAYPLQSKLNGVEK
Ga0306920_10094371613300032261SoilMSTLKKLAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKLTGAEK
Ga0306920_10192785513300032261SoilMNNTARRLAEIPAGSWTKWVVVGFWVLMLVLLYPLSAKLQH
Ga0335079_1174854623300032783SoilMNRIGRLAEIPAGSWTKWVVVGFWVVVLVIMAPLSSK
Ga0335078_1134857713300032805SoilMSTLKKLAEIPAGSWTKWVVVGFWVVVLVLAFPLSKK
Ga0310914_1131692313300033289SoilMSRLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSSK
Ga0314864_0175522_3_1073300033805PeatlandMSTLRRIAEVPAGSWTKWVVVGFWVVVLVLAFPLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.