NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F067507

Metagenome Family F067507

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067507
Family Type Metagenome
Number of Sequences 125
Average Sequence Length 51 residues
Representative Sequence RAGIAVIKAFLDKNEPAVRSLSIDDQIDNQIVRELEQSGFFNSLYRAK
Number of Associated Samples 112
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.80 %
% of genes near scaffold ends (potentially truncated) 96.00 %
% of genes from short scaffolds (< 2000 bps) 90.40 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.600 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.800 % of family members)
Environment Ontology (ENVO) Unclassified
(29.600 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(32.800 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.63%    β-sheet: 0.00%    Coil/Unstructured: 47.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF09084NMT1 23.20
PF00701DHDPS 6.40
PF04389Peptidase_M28 5.60
PF00903Glyoxalase 3.20
PF09957VapB_antitoxin 1.60
PF04255DUF433 1.60
PF00156Pribosyltran 1.60
PF12697Abhydrolase_6 0.80
PF13384HTH_23 0.80
PF01425Amidase 0.80
PF14706Tnp_DNA_bind 0.80
PF13683rve_3 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 23.20
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 23.20
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 12.80
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 1.60
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.80


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.60 %
UnclassifiedrootN/A18.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16481319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus subtilis1062Open in IMG/M
2170459015|G14TP7Y01DF4HZAll Organisms → cellular organisms → Bacteria665Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2054453All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101345144All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium940Open in IMG/M
3300000559|F14TC_104133651All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10108906All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium582Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1037965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium677Open in IMG/M
3300000955|JGI1027J12803_102316869Not Available1083Open in IMG/M
3300000956|JGI10216J12902_119276413All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300003324|soilH2_10370923All Organisms → cellular organisms → Bacteria1944Open in IMG/M
3300003890|Ga0063162_1196808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium825Open in IMG/M
3300004281|Ga0066397_10094098All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300004780|Ga0062378_10102127All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300005294|Ga0065705_10513173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria768Open in IMG/M
3300005294|Ga0065705_10851242Not Available553Open in IMG/M
3300005295|Ga0065707_11014522All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005332|Ga0066388_104097480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium743Open in IMG/M
3300005471|Ga0070698_100709390All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300005552|Ga0066701_10031001All Organisms → cellular organisms → Bacteria2780Open in IMG/M
3300005558|Ga0066698_10136032All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300005564|Ga0070664_100242125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1619Open in IMG/M
3300005617|Ga0068859_101580661Not Available724Open in IMG/M
3300005618|Ga0068864_100808242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium922Open in IMG/M
3300005764|Ga0066903_105568561All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium663Open in IMG/M
3300005890|Ga0075285_1004972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1396Open in IMG/M
3300006806|Ga0079220_11294277Not Available610Open in IMG/M
3300006846|Ga0075430_100599069Not Available909Open in IMG/M
3300006853|Ga0075420_100604124All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300006871|Ga0075434_100732255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus subtilis1006Open in IMG/M
3300006894|Ga0079215_10088528All Organisms → cellular organisms → Bacteria1328Open in IMG/M
3300006904|Ga0075424_101857946Not Available637Open in IMG/M
3300006918|Ga0079216_10160070All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300006969|Ga0075419_10560527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium799Open in IMG/M
3300006969|Ga0075419_10644684Not Available747Open in IMG/M
3300006969|Ga0075419_10694701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium721Open in IMG/M
3300009012|Ga0066710_102713338All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium706Open in IMG/M
3300009087|Ga0105107_10555584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium800Open in IMG/M
3300009088|Ga0099830_10360962All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1170Open in IMG/M
3300009137|Ga0066709_103949140All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
3300009147|Ga0114129_10243653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2416Open in IMG/M
3300009147|Ga0114129_11556434All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium811Open in IMG/M
3300009156|Ga0111538_10737710All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1247Open in IMG/M
3300009157|Ga0105092_10742974All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300009167|Ga0113563_10494584All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1331Open in IMG/M
3300010046|Ga0126384_10967820Not Available773Open in IMG/M
3300010046|Ga0126384_12338310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300010047|Ga0126382_10684044All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium858Open in IMG/M
3300010360|Ga0126372_10111507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2087Open in IMG/M
3300010361|Ga0126378_12125506Not Available640Open in IMG/M
3300010366|Ga0126379_11461834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium789Open in IMG/M
3300010376|Ga0126381_103151047Not Available653Open in IMG/M
3300010399|Ga0134127_11245121All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium812Open in IMG/M
3300011437|Ga0137429_1160867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium698Open in IMG/M
3300011440|Ga0137433_1187401All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium675Open in IMG/M
3300012157|Ga0137353_1044893All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium794Open in IMG/M
3300012179|Ga0137334_1145012Not Available537Open in IMG/M
3300012209|Ga0137379_11313473All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300012210|Ga0137378_10765438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium877Open in IMG/M
3300012349|Ga0137387_10741338All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300012353|Ga0137367_10506893All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium850Open in IMG/M
3300012494|Ga0157341_1039675Not Available541Open in IMG/M
3300012908|Ga0157286_10307761All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300012924|Ga0137413_10544612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia860Open in IMG/M
3300012948|Ga0126375_10854404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium726Open in IMG/M
3300012948|Ga0126375_11826414Not Available531Open in IMG/M
3300012948|Ga0126375_12065825Not Available505Open in IMG/M
3300012961|Ga0164302_10714533Not Available744Open in IMG/M
3300013297|Ga0157378_13174279Not Available510Open in IMG/M
3300013306|Ga0163162_11294147Not Available828Open in IMG/M
3300014326|Ga0157380_11718782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300014872|Ga0180087_1099246Not Available558Open in IMG/M
3300014881|Ga0180094_1025018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1185Open in IMG/M
3300014884|Ga0180104_1154449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium678Open in IMG/M
3300015259|Ga0180085_1073807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium990Open in IMG/M
3300015262|Ga0182007_10085536Not Available1036Open in IMG/M
3300015371|Ga0132258_11912910All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1493Open in IMG/M
3300015372|Ga0132256_100698447All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1130Open in IMG/M
3300015373|Ga0132257_101433825All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium880Open in IMG/M
3300015374|Ga0132255_102062534All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300015374|Ga0132255_104095246All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300015374|Ga0132255_104095253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300017792|Ga0163161_11812361Not Available543Open in IMG/M
3300017966|Ga0187776_10413632All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium905Open in IMG/M
3300018028|Ga0184608_10025527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2185Open in IMG/M
3300018031|Ga0184634_10034508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2021Open in IMG/M
3300018031|Ga0184634_10508746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300018061|Ga0184619_10019468All Organisms → cellular organisms → Bacteria2778Open in IMG/M
3300018074|Ga0184640_10011939All Organisms → cellular organisms → Bacteria3146Open in IMG/M
3300018077|Ga0184633_10178145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1101Open in IMG/M
3300018079|Ga0184627_10202011All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300018082|Ga0184639_10034437All Organisms → cellular organisms → Bacteria2590Open in IMG/M
3300018082|Ga0184639_10404247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium705Open in IMG/M
3300018433|Ga0066667_10941471All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter744Open in IMG/M
3300018469|Ga0190270_12673686All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium562Open in IMG/M
3300019883|Ga0193725_1145601Not Available515Open in IMG/M
3300021073|Ga0210378_10128741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium981Open in IMG/M
3300021081|Ga0210379_10098105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1217Open in IMG/M
3300022756|Ga0222622_11405100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300025930|Ga0207701_10080515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2946Open in IMG/M
3300026014|Ga0208776_1000256All Organisms → cellular organisms → Bacteria → Proteobacteria4148Open in IMG/M
3300026020|Ga0208531_1004548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1201Open in IMG/M
3300026298|Ga0209236_1272804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300026324|Ga0209470_1204416All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium832Open in IMG/M
3300026325|Ga0209152_10404701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300026536|Ga0209058_1073126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1829Open in IMG/M
3300027277|Ga0209846_1004080All Organisms → cellular organisms → Bacteria2558Open in IMG/M
3300027379|Ga0209842_1026096All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300027379|Ga0209842_1065052All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300027533|Ga0208185_1125102All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300027815|Ga0209726_10172886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1172Open in IMG/M
3300027840|Ga0209683_10009766All Organisms → cellular organisms → Bacteria3801Open in IMG/M
3300027840|Ga0209683_10259924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium799Open in IMG/M
3300027875|Ga0209283_10956961All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300027909|Ga0209382_10703035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1087Open in IMG/M
3300028802|Ga0307503_10204974All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium936Open in IMG/M
3300031226|Ga0307497_10754534All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium507Open in IMG/M
3300031913|Ga0310891_10311732All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium557Open in IMG/M
3300032000|Ga0310903_10529821Not Available619Open in IMG/M
3300032174|Ga0307470_10580391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus subtilis834Open in IMG/M
3300032261|Ga0306920_101641370Not Available913Open in IMG/M
3300032955|Ga0335076_11149064All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium660Open in IMG/M
3300033407|Ga0214472_10372112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1347Open in IMG/M
3300033412|Ga0310810_10551163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1126Open in IMG/M
3300033480|Ga0316620_12279839All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium538Open in IMG/M
3300033481|Ga0316600_10945402All Organisms → cellular organisms → Bacteria610Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil7.20%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.60%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.20%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.40%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.40%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.40%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.40%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.40%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.40%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.60%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.60%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.60%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.80%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.80%
Hot Spring SedimentsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments0.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.80%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.80%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.80%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2170459015Litter degradation PV4EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003890Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cmEnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300026014Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes)EnvironmentalOpen in IMG/M
3300026020Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_037751002088090014SoilIKAFLDKNEPAVRSLSIDDQIDNQWVRELEQSGFFNSLYYAK
4PV_014010202170459015Switchgrass, Maize And Mischanthus LitterYMPNIPYPSRAGIAVIKAFLDKNEPAVRSLSIDNQIDNQIIRELEQSGFFANLQRAK
ICChiseqgaiiDRAFT_205445323300000033SoilNEPAVRPLSIDDQVDNQFVRELEQSGFFTALQRAK*
INPhiseqgaiiFebDRAFT_10134514423300000364SoilAGIAAIKAFLDKNEPAVRPLSIDDQIDNQIVRELEQNGFFSSLYRIK*
F14TC_10413365113300000559SoilNYPRYMPNVPYPSRAGIAVIKGFLERTEPALRQLSIDDQLDIQLVRELEQSGFFNSLYHAK*
AF_2010_repII_A001DRAFT_1010890623300000793Forest SoilMPNVPYPTRAGIAVIKSFLEKSEPALRQLSIDDQIDVQLVRELEQSGFFSALHKNK*
AP72_2010_repI_A100DRAFT_103796523300000837Forest SoilYMPKIPYPSRAGIAVIKAFLDKNEPAVRALSIDDQIDNQFVRELEQSGFFSSLYRAK*
JGI1027J12803_10231686923300000955SoilIAVIKAFLDKNEPAVRPLSIDDQIDNQIVRELEQNGFFSSLYRIK*
JGI10216J12902_11927641313300000956SoilQKDYPRYMPKVPYPSRAGIAVIKAFLDKNEPAVRSLAIDDQIDNQIVRELERSGFFSRLYR*
soilH2_1037092313300003324Sugarcane Root And Bulk SoilPAIPYPSRPGIAVIKSSLDKTEPTVRALSIDDQIENRFVREMEESGFLNEISRAK*
Ga0063162_119680823300003890Hot Spring SedimentsPSRAGIAVIKSFLDKNEPAVRRLSIDDQIDDQFVRELEESGFFANLQRGK*
Ga0066397_1009409823300004281Tropical Forest SoilIPYPSRAGIAVIKAFLDKNEPAVRPLAIDDQIDNQIIRELEQSGFFANLQRAK*
Ga0062378_1010212723300004780Wetland SedimentLNYVPRVPYPNRAGIALIKSFLEKSEPQLRPLSVDDQIDSSILRGLEQSGFFKALYPAK*
Ga0065705_1051317323300005294Switchgrass RhizosphereYPRYMPKIPYPGRAGIAVIKAFLDKNEPAVRSLSIDDQIDNQIVRELEQSGFFNSLYRAK
Ga0065705_1085124213300005294Switchgrass RhizosphereAGIAVIKSFLDKTEPAVRPLSIDDQIDNQIVRELEQSGFFTYLQRGK*
Ga0065707_1101452223300005295Switchgrass RhizosphereRAGIAVIKAFLDKNEPAVRSLSIDDQIDNQIVRELEQSGFFNSLYRAK*
Ga0066388_10409748023300005332Tropical Forest SoilVIKAFLDKNEPAVRPLSIDGQIDNQIVGELEQSGFFSNLHHAK*
Ga0070698_10070939013300005471Corn, Switchgrass And Miscanthus RhizospherePYPGRAGIAVIKSFLDKNEPAVRPLSIDDQIDNQIVRELEQSGFFSNLQRTK*
Ga0066701_1003100113300005552SoilIEETQKNYPRYMPNVPYPSRAGIAVIKGFLERTEPALRQLAIDDQIDIQAVRELEQSGFFNSLSRAR*
Ga0066698_1013603213300005558SoilLERTEPALRQLAIDDQIDIQAVRELEQSGFFNSLSRAR*
Ga0070664_10024212533300005564Corn RhizosphereFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFINNLYRSK*
Ga0068859_10158066123300005617Switchgrass RhizosphereAGIAVIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFINNLYRSK*
Ga0068864_10080824213300005618Switchgrass RhizosphereETQKDYQRYMPKIPYPSRAGIAVIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFINNLYRSK*
Ga0066903_10556856113300005764Tropical Forest SoilVIKSFLEKSEPALRQLSIDDQIDVQLVRELEQSGFFSALYKNK*
Ga0075285_100497213300005890Rice Paddy SoilKAFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFFTALQRAK*
Ga0079220_1129427713300006806Agricultural SoilIAVIKSFLDKNEPAVRPLSIDDQIDNQFVREMEQSGFINNLYRAK*
Ga0075430_10059906913300006846Populus RhizospherePSRAGIAVIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFINNLYRAK*
Ga0075420_10060412423300006853Populus RhizosphereVEETQKNYPRYMPAVPYPSRAGIVVIKSFLDKTEPAVRPLSIDDQIDNQIVRDLEQSGFFGALRGK*
Ga0075434_10073225513300006871Populus RhizosphereEPAVRSLSIDDQIDNQWVRELEQSGFFNSLYYAK*
Ga0079215_1008852843300006894Agricultural SoilYPRYMPAVPYPSRAGIAVIKSFLDKTEPAVRPLSIDDQIDNHMVRELEQSGFFNNLPRLK
Ga0075424_10185794623300006904Populus RhizosphereDETQKNYPRYMPTVPYPSRAGIAVIKEFMERTDPALRQLSLDDQIDTQWVRELEQSGFFNALYSAK*
Ga0079216_1016007013300006918Agricultural SoilMPDIPYPSRAGVAVIKSFLEKTEPGLQKLSLDEQMDMTIVRELEQSGFFSALQRAK*
Ga0075419_1056052713300006969Populus RhizosphereGIAVIKAFLDKNEPAVRSLSIDDQIDNQIVRELEQSGFFNTLYHAK*
Ga0075419_1064468423300006969Populus RhizospherePSRAGIAVIKSFLDKTDAAVRPLSIDDQIDNQIVRELEQSGFINGAYRSK*
Ga0075419_1069470113300006969Populus RhizosphereGIAVIKAFLDKNEPAVRSLSIDDQIDNQIVRELEQSGFFNSLYHAK*
Ga0066710_10271333813300009012Grasslands SoilRAGIAVIKGFLERTEPALRQLAIDDQIDIQAVRELEQSGFFSSLQRAK
Ga0105107_1055558423300009087Freshwater SedimentLFCASDASRPGIAVIKAFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFFTALQRAK*
Ga0099830_1036096243300009088Vadose Zone SoilRYMPNVPYPTRTGIAVIKAFLERTEPALRQLSIDDQIDTSIVRALEQSGFFKELYRDK*
Ga0066709_10394914013300009137Grasslands SoilGFLERTEPALRQLAIDDQIDIQAVRELEQSGFFNSLSRAR*
Ga0114129_1024365313300009147Populus RhizospherePYPSRAGIAVIKAFLDKNEPSVRPLSVDDQIDPQFVRELEQSGFFTALERAR*
Ga0114129_1155643413300009147Populus RhizosphereNEPAVRSLSIDDQIDNQIVRELEQSGFFNSLYHAK*
Ga0111538_1073771013300009156Populus RhizosphereDETQKDYQRYMPKIPYPSRAGIAVIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFINNLYRAK*
Ga0105092_1074297413300009157Freshwater SedimentQKDYPRYMPKIPYPGRAGIAVIKAFLDKNEPAVRSLSIDDQIDNQIVRELEQSGFFNNLYRAR*
Ga0113563_1049458423300009167Freshwater WetlandsRTYLNYVPRVPYPTRTGIALIKAFLEKSEPQLKPLSVDDQIDNSFVRGLEQSGFFASLYPAK*
Ga0126384_1096782033300010046Tropical Forest SoilLDKNEPAVRALSIDDQIDNQFVRELEQSGFFSSLHRAK*
Ga0126384_1233831023300010046Tropical Forest SoilIAVIKAFLDKNEPAVRALSIDDQIDNQFVRELEQSGFFSSLHRAK*
Ga0126382_1068404423300010047Tropical Forest SoilPNLPYPTRPGIAVIKSFLERNEPALRQLSIDGQLDIQLIRELEQSGFFSRLYAK*
Ga0126372_1011150713300010360Tropical Forest SoilVFLDKNEPAVRALSIDDQIDNQFVRELEQSGFFSSLYRAK*
Ga0126378_1212550623300010361Tropical Forest SoilEPAVRALSIDDQIDNQFVRELEQSGFFSSLHRAK*
Ga0126379_1146183433300010366Tropical Forest SoilYPSRAGIAVIKAFLDKNEPAVRALSIDDQIDNQFVRELEQSGFFSSLHRAK*
Ga0126381_10315104713300010376Tropical Forest SoilIKAFLDKNEPAVRALSIDDQIDNQFVRELEQSGFFSSLYRAK*
Ga0134127_1124512113300010399Terrestrial SoilPRYMPMVPYPSRAGIAVIKSFLDKNEPAVRPLSIDDQIDNQIVRELEQSGFINNAYHSK*
Ga0137429_116086713300011437SoilPNRAGIALIKTFLEKSEPQLRPLSVDDQIDGSIVRALEQSGFFSSLYSTR*
Ga0137433_118740123300011440SoilYMPTVPYPTRAGIAVIKAFLERTEPALRQLSIDDQIDIQLVRELEQEGFFSRLYAK*
Ga0137353_104489313300012157SoilPRYMPNIPYPSRAGIAVIKAFMEKSDPALRQLSVDDQIDMQFVRELEQSGFFSSPYRAR*
Ga0137334_114501213300012179SoilNRAGIALIKTFLEKSEPQLRPLSVDDQIDGSIVRALEQSGFYSSLYSTR*
Ga0137379_1131347313300012209Vadose Zone SoilMPNVPYPSRAGIAVIKGFLERTEPALRQLAIDDQIDIQAVRELEQSGFFNSLSRAR*
Ga0137378_1076543813300012210Vadose Zone SoilIPYPSRAGIAVIKAFLDKNEPAVRPLSIDGQIDNQIVRELEQSGFFNSLYRAK*
Ga0137387_1074133813300012349Vadose Zone SoilRTEPALRQLAIDDQIDIQAVRELEQSGFFNSLSRAR*
Ga0137367_1050689323300012353Vadose Zone SoilYPRYMPKVPYPSRAGIAVIKAFLDKNEPAVRSLSIDDQIDNQIVRELEQSGFFNSLYHAK
Ga0157341_103967523300012494Arabidopsis RhizosphereGIAVIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFINNLYRSK*
Ga0157286_1030776123300012908SoilKDYQRYMPKVPYPSRAGIAVIKSFLDKNEPGVRPLSIDDQIDNQFVRELEQSGFINNLYRSK*
Ga0137413_1054461213300012924Vadose Zone SoilKNYPRYMPMIPYPSRAGIAVIKSFLDKTDAAVRPLSIDDQIDNQIVRELEQGGFINSAYRAK*
Ga0126375_1085440423300012948Tropical Forest SoilTQKNYPRYMPNVPYPTRSGIAVIKSFLERNEPALRQLAIDDQLDIQLIRELEQSGFFSKLHAR*
Ga0126375_1182641413300012948Tropical Forest SoilNEPAVRPLAVDGQIDNQIVRDLEQSGFIANLERRK*
Ga0126375_1206582513300012948Tropical Forest SoilIAVIKAFLDKNEPAVRALSIDDQIDNQFVRELEQSGFFSSLYRAK*
Ga0164302_1071453323300012961SoilSRAGIAVIKSFLDKTDAAVRPLSIDDQIDNQIVRELEQSGFINGAYRAK*
Ga0157378_1317427913300013297Miscanthus RhizospherePSRAGIAVIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFINNLYRSK*
Ga0163162_1129414713300013306Switchgrass RhizospherePSRAGIAVIKSFLDKTDAAVRPLSIDDQIDNQIVRELEQGGFINSAYRSK*
Ga0157380_1171878233300014326Switchgrass RhizosphereETQKDYQRYMPKIPYPSRAGIAVIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFITNLYRSK*
Ga0180087_109924613300014872SoilYLNYVPRVPYPNRAGIALIKTFLEKSEPQLRPLSVDDQIDGSIVRGLEQSGFFSSLYSTR
Ga0180094_102501813300014881SoilQKSYPRYMPNIPYPSRAGIAVIKAFMEKSDPALRQLSVDDQIDMRFVRELEQSGFFSSPYRAR*
Ga0180104_115444913300014884SoilPSRAGIAVIKAFMEKSDPALRQLSVDDQIDMQFVRELEQSGFFSSPYRAR*
Ga0180085_107380713300015259SoilQKSYPRYMPNIPYPSRAGIAVIKAFMEKSEPALRQMSVDDQIDMQFVRELEQSGFFSSPYRAR*
Ga0182007_1008553613300015262RhizosphereIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFINNLYRSK*
Ga0132258_1191291013300015371Arabidopsis RhizospherePGRAGIAVIKAFLDKNEPAVRTLSIDDQIDNQFVRELEQSGFFSSLYHAK*
Ga0132256_10069844713300015372Arabidopsis RhizosphereAGIAVIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFITNLYRSK*
Ga0132257_10143382513300015373Arabidopsis RhizosphereKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFITNLYRSK*
Ga0132255_10206253413300015374Arabidopsis RhizosphereKNEPAVRTLSIDDQIDNQFVRELEQSGFFSSLYR*
Ga0132255_10409524623300015374Arabidopsis RhizospherePRYMPKIPYPGRAGIAVIKAFLDKNEPAVRTLSIDDQIDNQFVRELEQSGFFSSLYHAK*
Ga0132255_10409525323300015374Arabidopsis RhizospherePRYMPKIPYPGRAGIAVIKAFLDKNEPAVRTLSIDDQIDNQWVRELEQSGFFNSLYHAK*
Ga0163161_1181236113300017792Switchgrass RhizospherePSRAGIAVIKSFLDKTDAAVRPLSIDDQIDNQIVRDLEQSGFINGAYRSK
Ga0187776_1041363213300017966Tropical PeatlandNEPAVRSLSIDDQIDNQFVRELEQSGFINSLYRTK
Ga0184608_1002552713300018028Groundwater SedimentETQKNYPRYMSNIPYPSRVGIAVIKAFLEKTEAALQKLSIDDQIDVQLVRELEQSGFFSNLQRAK
Ga0184634_1003450813300018031Groundwater SedimentRYMPNIPYPSRVGIAVIKAFLEKTEPALQKLSVDDQIDMQFVRELEQSGFFSGLQRAK
Ga0184634_1050874613300018031Groundwater SedimentRYMPNIPYPSRVGIAVIKAFLEKTEPALQKLSVDDQIDMQLVRELEQSGFFSGLERAK
Ga0184619_1001946813300018061Groundwater SedimentLEKTEPALQKLSIDDQIDVQLVRELEQSGFFSGLQRAK
Ga0184640_1001193913300018074Groundwater SedimentMPNVPYPTRAGIAVIKGFLEKTEPALRQLSIDDQIDMQFVRELEQSGFFSTR
Ga0184633_1017814523300018077Groundwater SedimentGIAVIKAFLEKSEPALRQLSIDDQIDNQWVRELEQGGFFTSPYHAR
Ga0184627_1020201143300018079Groundwater SedimentVPYPGRAGIAVIKSFLDKNEPAVRRLSIDDQIDNQIVRELEQSGFFSNLQRGK
Ga0184639_1003443713300018082Groundwater SedimentRYMPNIPYPSRVGIAVIKAFLEKTEPALQKLSVDDQIDMQLVRELEQSGFFSGLQRAK
Ga0184639_1040424723300018082Groundwater SedimentPRVPYPNRAGIALIKTFLEKSEPQLRPLSVDDQIDGSIVRGLEQSGFFSSLYFTR
Ga0066667_1094147123300018433Grasslands SoilIEETQKNYPRYMPNVPYPSRAGIAVIKGFLERTEPALRQLAIDDQIDIQAVRELEQSGFFNSLSRAR
Ga0190270_1267368613300018469SoilYVPRVPYPTRAGIALIKTFLEKSEPALRPLSVDDQIDGSIVRGLEQSGFFSALYPGR
Ga0193725_114560123300019883SoilKTDAAVRPLSIDDQIDNQIVRELEQGGFINSAYRSK
Ga0210378_1012874123300021073Groundwater SedimentVEETQKNYPRYMPNIPYPSRVGIAVIKAFLEKTEPALQKLSIDDQIDVQLVRELEQSGFFSNLQRAK
Ga0210379_1009810513300021081Groundwater SedimentPSRAGIAVIKAFMEKSDPALRQLSVDDQIDMQFVRELEQSGFFSSPYRAR
Ga0222622_1140510023300022756Groundwater SedimentMVPYPSRAGIAVIKSFLDKNEPAVRPLSIDDQIDNQIVRELEQSGFINNAYHSK
Ga0207701_1008051543300025930Corn, Switchgrass And Miscanthus RhizosphereVPYPSRAGIAVIKSFLDKTDAAVRPLSIDDQIDNQIVRELEQSGFINGAYRSK
Ga0208776_100025653300026014Rice Paddy SoilYPRYMPNVPYPSRLGIAVIKAFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFFTALQRAK
Ga0208531_100454813300026020Rice Paddy SoilGIAVIKAFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFFTALQRAK
Ga0209236_127280413300026298Grasslands SoilFLDKNEPAVRPLSIDGQIDNHIVRELEQSGFFSNVQRAK
Ga0209470_120441623300026324SoilYPRYMPKVPYPSRAGIAVIKAFLDKNEPAVRPLSIDGQIDNHIVRELEQSGFFSNVQRAK
Ga0209152_1040470113300026325SoilRTEPALRQLAIDDQIDIQAVRELEQSGFFNSRSRAR
Ga0209058_107312633300026536SoilLERTEPALRQLAIDDQIDIQAVRELEQSGFFNSLSRAR
Ga0209846_100408013300027277Groundwater SandPYPGRAGIAVIKAFLDKNEPAVRSLSIDNQIDNEIVRELEQSGFFNSLYQAK
Ga0209842_102609643300027379Groundwater SandGRAGIAVIKAFLDKNEPAVRSLSIDDQIDNQIVRELEQGGFFNSLYQAK
Ga0209842_106505223300027379Groundwater SandGRAGIAVIKAFLDKNEPAVRSLSIDDQIDNQIVRDLEQGGFFNSLYHSK
Ga0208185_112510213300027533SoilKNYPRYMPNVPYPSRAGIAVIKAFLERTEPALRQLSIDDQIDIQLVRELEQNGFFNSLYHAK
Ga0209726_1017288613300027815GroundwaterDALVQEETQRTYLNYVPRVPYPNRAGIALIKTFLEKSEPQLRPLAVDDQIDSSIVRGLEQSGFFNALYPAK
Ga0209683_1000976613300027840Wetland SedimentYPTRAGIALIKTFLEKNEPQLRPLSVDDQIDGSILRGLEQSGFFAALYPAK
Ga0209683_1025992423300027840Wetland SedimentVPYPNRAGIALIKSFLEKSEPQLRPLSVDDQIDSSILRGLEQSGFFKALYPAK
Ga0209283_1095696113300027875Vadose Zone SoilIAVIKAFLERTEPALRQLSIDDQIDVQLVRELEQSGFFNGLYQRK
Ga0209382_1070303513300027909Populus RhizosphereVVIKSFVDKTEPSVRPLSIDDQIDNQIVRELEQSGFFGALRGK
Ga0307503_1020497413300028802SoilETQRTYLNYVPRVPYPNRAGIALIKTFLEKSEPQLRPLSVDDQIDGSIVRGLEQSSFFAGLYPAK
Ga0307497_1075453423300031226SoilYVPRVPYPTRAGIALIKTFLEKSEPQLKPLSVDDQIDNSFVRGLEQSGFFNALYPAK
Ga0310891_1031173223300031913SoilNYVPRVPYPTRAGIALIKTFLEKSEPQLRPLSVDDQIDGSIVRGLEQSGFFSALYPGR
Ga0310903_1052982113300032000SoilIAVIKSFLDKTDAAVRPLSIDDQIDNQIVRELEQGGFINGAYRSK
Ga0307470_1058039113300032174Hardwood Forest SoilLDKNEPAVRSLSIDDQIDNQWVRELEQSGFFNSLYYAK
Ga0306920_10164137013300032261SoilAVIKAFLDKNEPAVRPLSIDEQIDNQMIRELDQSGFISSVYRSK
Ga0335076_1114906423300032955SoilFMEKSEPALRQLSIDDQIDVQIVRELDQSGFFSALYKNK
Ga0214472_1037211213300033407SoilIAVIKGFLEKTEPALRQLSIDDQIDMQFVRELEQSGFFSSPYRAR
Ga0310810_1055116313300033412SoilIAVIKSFLDKNEPAVRPLSIDDQIDNQFVRELEQSGFINNLYRGK
Ga0316620_1227983923300033480SoilIPYPSRAGIAVIKAFLDKNEPAVRPLSIDDQIDNQTVRELEQNGFFSSLYRTQ
Ga0316600_1094540213300033481SoilKTEPALRKLSIDDQIDNRFVREMEESGFLREVNRTK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.