Basic Information | |
---|---|
Family ID | F067322 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 125 |
Average Sequence Length | 37 residues |
Representative Sequence | MKTADALMVIYYVVLSGVLVFTLGYLAGWRHAKRRQ |
Number of Associated Samples | 56 |
Number of Associated Scaffolds | 125 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 65.85 % |
% of genes near scaffold ends (potentially truncated) | 19.20 % |
% of genes from short scaffolds (< 2000 bps) | 89.60 % |
Associated GOLD sequencing projects | 49 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (84.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (31.200 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.800 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (72.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 125 Family Scaffolds |
---|---|---|
PF13545 | HTH_Crp_2 | 2.40 |
PF03401 | TctC | 1.60 |
PF09361 | Phasin_2 | 1.60 |
PF09851 | SHOCT | 0.80 |
PF00027 | cNMP_binding | 0.80 |
PF13505 | OMP_b-brl | 0.80 |
PF13192 | Thioredoxin_3 | 0.80 |
PF00496 | SBP_bac_5 | 0.80 |
PF08734 | GYD | 0.80 |
PF04773 | FecR | 0.80 |
PF01145 | Band_7 | 0.80 |
PF12071 | DUF3551 | 0.80 |
PF13185 | GAF_2 | 0.80 |
COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
---|---|---|---|
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.60 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.80 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 84.00 % |
All Organisms | root | All Organisms | 16.00 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 31.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.40% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.20% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_100581182 | 3300000597 | Forest Soil | MKTADALMVIYYVVLSGVLVFTFGYLAGFRHAKRRQ* |
AF_2010_repII_A1DRAFT_101011682 | 3300000597 | Forest Soil | MKNPDALMVVYYVVLSGVLLLALGYLAGWRHAKGR |
Ga0066395_101770512 | 3300004633 | Tropical Forest Soil | MGADRMTTADALMVVYYVVLSGVLVFTLGCLAGWRYAKRRQ* |
Ga0066388_1001189074 | 3300005332 | Tropical Forest Soil | LRADRMKTSDALMVVYYVLLSGVLVFTLGYLAGWRHAKRRQN* |
Ga0066388_1029627971 | 3300005332 | Tropical Forest Soil | MEADRMKTADALMVIYYVVLSGVLVFTLGYLAGWRQAKRRQ* |
Ga0066388_1037101042 | 3300005332 | Tropical Forest Soil | MKNADALMVVYYVVLSGVLVFMLGYFAGWRHAKGGNNSASW* |
Ga0066388_1082315691 | 3300005332 | Tropical Forest Soil | MGSERMKNPDALMVVYYVLLSGVLVFTLGYLAGWRHAKKRQ* |
Ga0066903_1001276837 | 3300005764 | Tropical Forest Soil | MKTADALMVVYYVVLSGVLVFTLGYLSGWRHAKRRQ* |
Ga0066903_1006789654 | 3300005764 | Tropical Forest Soil | WEQIMTNADALMVFYYVVLSGVLVFTLGYFAGHHTKKRQ* |
Ga0066903_1012370721 | 3300005764 | Tropical Forest Soil | MKTADALMVIYYVVLSGVLVFTLGYLAGWRHAKRGQ* |
Ga0066903_1012731642 | 3300005764 | Tropical Forest Soil | MKTADALMAIYYLVLSGVLVFTLGYLAGWRHAKRRQ* |
Ga0066903_1013174001 | 3300005764 | Tropical Forest Soil | MKSADALMVIYYVVLSGVLVFTLGCLAGWRYAKRRQ* |
Ga0066903_1016398852 | 3300005764 | Tropical Forest Soil | MKSADALMLVYYVVLSGVLVFTLGYLAGWRHAKRRQ* |
Ga0066903_1021200453 | 3300005764 | Tropical Forest Soil | MKNPDALMVLYYVVLTGVVVFTLAYLAGWRHAKKRQ* |
Ga0066903_1024072704 | 3300005764 | Tropical Forest Soil | MTTADALMVVYYVVLSGLLVFTLGYLAGWRHAKARQ* |
Ga0066903_1039791732 | 3300005764 | Tropical Forest Soil | MKTADALMVIYYVVLSGVLVFTLGYLAGWRHAKGGQ* |
Ga0066903_1044910352 | 3300005764 | Tropical Forest Soil | MTTADALMMVYYVVLSCALVFTLGYLAGWRHAKRRQ* |
Ga0066903_1048305402 | 3300005764 | Tropical Forest Soil | MKTADALMVIYYLVLSGALVFTLGYLAGWRHAKSSQ* |
Ga0066903_1048308721 | 3300005764 | Tropical Forest Soil | MKTADALMVVYYVVLSGVLVFTLGYLAGWRHAKRGQ* |
Ga0066903_1087461242 | 3300005764 | Tropical Forest Soil | MTTADALMMVYYVVLSGVLVFTLGYLAGWRHAKRQ* |
Ga0126374_105191202 | 3300009792 | Tropical Forest Soil | MKTADALMVIYYVVLSGLLVFTLGYFAGWRHAKRRQ* |
Ga0126373_100627305 | 3300010048 | Tropical Forest Soil | MNARDTLMVVYYVLLSGALVFMLGYLAGWRRTKR* |
Ga0126373_103739783 | 3300010048 | Tropical Forest Soil | MKTSDALMVVYYVLLSGVLVFTLGYLAGWRHAKRRQN* |
Ga0126373_104229071 | 3300010048 | Tropical Forest Soil | MKTADALMVVYYVVLSGALLFMLGYFAGWRHAKGRR* |
Ga0126373_110201882 | 3300010048 | Tropical Forest Soil | MKTADALIVVYYVVLSGVLVFTLGYLAGWRHARSRQ* |
Ga0126373_110849702 | 3300010048 | Tropical Forest Soil | MKTVDALMVVYYVVLSGVIVFTLGYLAGFRNAKRRQ* |
Ga0126373_113775472 | 3300010048 | Tropical Forest Soil | MKPADAWMVIYYVVLSGALVFTLGYLAGWRRAKREQ* |
Ga0126373_123572741 | 3300010048 | Tropical Forest Soil | YAARPNNGADCMKSADALMVIYYVVLSGVLVFTLGCLAGWRYTKGRR* |
Ga0126373_133327262 | 3300010048 | Tropical Forest Soil | MTTADALMVVYYVVLSGVLVFTLGCLAGWRYAKRRQ* |
Ga0126370_112117702 | 3300010358 | Tropical Forest Soil | MKTADALMVVYYVVLSGVLVFTLGYLAGWRHAKSRQ* |
Ga0126370_113218391 | 3300010358 | Tropical Forest Soil | TADALMVVYYVVLSGVLVFTLGCLAGWRYAKRRQ* |
Ga0126372_100409693 | 3300010360 | Tropical Forest Soil | MKNADALMVVYYVVLSGVLLLVLGYLAGWRHAKRRQ* |
Ga0126378_115007302 | 3300010361 | Tropical Forest Soil | MKTADALMVVYYVVLSGALLFMLGYFAGWRHAKRRQ* |
Ga0126378_121961332 | 3300010361 | Tropical Forest Soil | MNTADALMVVYYVVLSGVIVSTLGYLAGWRHARRRQ* |
Ga0126381_1003473014 | 3300010376 | Tropical Forest Soil | MKNPDALMMVYYVVLSGVLVFTLGYLAGWRHAKRQ* |
Ga0126381_1006597242 | 3300010376 | Tropical Forest Soil | MTTADALMVVYYVVLSGLLVFTLGCLAGWRYAKRRQ* |
Ga0126381_1006835211 | 3300010376 | Tropical Forest Soil | MNAADTLMVVYYVVLSGVLVFTLGCLAGWRYTKGRR* |
Ga0126381_1015080781 | 3300010376 | Tropical Forest Soil | MNTADALMVVYYVVLSGVMVFTLGYLAGWRHAKRRQN* |
Ga0126381_1037305842 | 3300010376 | Tropical Forest Soil | MTNPDALMVVYYVLLSGVLVFTLGYLAGWRYAKRRQ* |
Ga0126381_1039553021 | 3300010376 | Tropical Forest Soil | DRMKTADALMVVYYVVLSGVLVFTLGYLAGWRHARSRQ* |
Ga0126383_135182971 | 3300010398 | Tropical Forest Soil | MKTADALMVVYYVVLSGVLVFTLGYLAGWRHARSR |
Ga0124850_10066526 | 3300010863 | Tropical Forest Soil | MGADLMTTADALMVVYYVVLSGVLVFTLGCLAGWRYAKRRQ* |
Ga0126375_113648652 | 3300012948 | Tropical Forest Soil | MKTADTLMVVYYVVLSGALVFTLGYLAGWRHAKRRQ* |
Ga0126369_104624312 | 3300012971 | Tropical Forest Soil | MKTADALMVIYYVVLSGVLVFTFGYLAGWRHAKRRQ* |
Ga0126369_107997692 | 3300012971 | Tropical Forest Soil | MNTADALMVIYYLVLSGALVFTLGYLAGWRHAKRRQ* |
Ga0126369_111815522 | 3300012971 | Tropical Forest Soil | MRTADALMVVYYVVLSGVLVFTLGCLAGWRYAKRRQ* |
Ga0126369_117124161 | 3300012971 | Tropical Forest Soil | MKNSDALMVVYYVVLSGVLVFMLGYFAGWRHAKGGNNSASW* |
Ga0126369_129828261 | 3300012971 | Tropical Forest Soil | KTADALMVIYYVVLSGVLVFTFGYLAGFRHAKRRQ* |
Ga0182041_101005214 | 3300016294 | Soil | KTADALMVIYYVVLSGVLVFTLGYLTGWRQAKRRQ |
Ga0182033_111502751 | 3300016319 | Soil | MKTADALMVVYYVVLSGVLVFTLGYFAGWRHAKSRQ |
Ga0182035_102942111 | 3300016341 | Soil | MGADCMTTADALMVVYYVVLSGVLVFTLGCLAGWRYAKRRQ |
Ga0182035_106214702 | 3300016341 | Soil | MGSDRMKNPDALMVVYYVLLSGVLAFTLGYLAGWRHAKKRQ |
Ga0182034_106634201 | 3300016371 | Soil | MNTSDALMVVYYVVLSGVMVFTLGYLAGWRHAKRRQ |
Ga0182040_118182003 | 3300016387 | Soil | SREARADRMTTADTLTVIYYVVLSGVLVFTLGYLAGRRHAKRRQ |
Ga0182037_106732032 | 3300016404 | Soil | LRLALSREARADRTTSADTLMVIYYVVLSGVLVFTLGYLAGWRHAKGRQ |
Ga0182037_108819472 | 3300016404 | Soil | MGSDRMKNPDALMVVYYVLLGGVLVFTLGYLAGWRHAKKRQ |
Ga0182039_107270642 | 3300016422 | Soil | MGADRMKNPDALMVIYYVVLSGVLVFTLDYLAGWRRAKRRQ |
Ga0182038_103871161 | 3300016445 | Soil | MNTADALMMVYYVVLTGVMVFTLGYLAGWRHAKRRQ |
Ga0182038_107721132 | 3300016445 | Soil | MKNPDALMVVYYVVLSGMLVFTLGYLAGWRQAKRRQ |
Ga0210399_102934953 | 3300020581 | Soil | MKTADALMVVYYVLLSGVLVFTLGYLAGWRQAKRR |
Ga0126371_101966081 | 3300021560 | Tropical Forest Soil | MKNPDALMVLYYVVLTGVVVFTLAYLAGWRHAKKRQ |
Ga0126371_102598834 | 3300021560 | Tropical Forest Soil | MKTADALMVVYYVVLSGVLVFTLGYLSGWRHAKRRQ |
Ga0126371_108089803 | 3300021560 | Tropical Forest Soil | MKTADALMVIYYVVLSGLLVFTLGYFAGWRHAKRRQ |
Ga0126371_108996971 | 3300021560 | Tropical Forest Soil | MKTADALMVVYYVVLSGALLFVLGYFAGWRHAKRRQ |
Ga0126371_113563332 | 3300021560 | Tropical Forest Soil | MTTADALMVVYYVVLSGVLVFTLGCLAGWRYAKRRQ |
Ga0126371_116149021 | 3300021560 | Tropical Forest Soil | MKNADALMVVYYVVLSGVLVFMLGYFAGWRHAKGGNNSASW |
Ga0126371_117143581 | 3300021560 | Tropical Forest Soil | MTTADALMMVYYVVLSCALVFTLGYLAGWRHAKRRQ |
Ga0126371_121121441 | 3300021560 | Tropical Forest Soil | MKNPDALMVVYYVVLSGVLVFTLGYLAGWRHARRRQ |
Ga0126371_122737241 | 3300021560 | Tropical Forest Soil | MTTADALMMVYYVVLSGVLVFTLGYLAGWRHAKRR |
Ga0126371_130305321 | 3300021560 | Tropical Forest Soil | MTNGDALMVVYYVALSGVLVFTLGYFAGWRHAKRRQ |
Ga0126371_134028112 | 3300021560 | Tropical Forest Soil | MNTADTLNVVYYVLLSGALVFALGCLAGWRYTKGKR |
Ga0126371_135319832 | 3300021560 | Tropical Forest Soil | MKTADALMAIYYLVLSGVLVFTLGYLAGWRHAKRRQ |
Ga0209465_102468012 | 3300027874 | Tropical Forest Soil | MKTADALMVVYYVVLSGVLVFTLGYLAGWRQARRQ |
Ga0318516_102137711 | 3300031543 | Soil | MGADRMTTADALMVVYYVVLSGVLVFTLGCLAGWRYAKRRQ |
Ga0318516_103386231 | 3300031543 | Soil | MKTADALMVIYYVVLSGVLVFTFGYLAGFRHAKRRQ |
Ga0318516_105553492 | 3300031543 | Soil | MNTADALMVVYYVVLSGVMVFTLGYLADWRHAKRRQ |
Ga0318516_106730552 | 3300031543 | Soil | MEADRMKTADALMVIYYVVLSGVLVFTLGYLTGWRQAKRRQ |
Ga0318541_103290422 | 3300031545 | Soil | MKTADALMVIYYVVLSGVLVFTLGYLAGWRHAKGRQ |
Ga0318541_104001272 | 3300031545 | Soil | MKSADALMVIYYVVLSGVLVFTLGYLAGWRQAKRRQ |
Ga0318541_105077911 | 3300031545 | Soil | GLLIGADRMKNPDALMVVYYVVLTGVLVFTLGYFAGWRQAKRRQ |
Ga0318538_100119521 | 3300031546 | Soil | MKTSDALMVVYYVLLSGVLVFTLGYLAGWRHAKRRQN |
Ga0318515_104109411 | 3300031572 | Soil | MEADRMKTADALMVIYYVVLSGVLVFTLGYLAGWRHAKGRQ |
Ga0310915_100534122 | 3300031573 | Soil | MKNPDALMVVYYVVLTGVLVFTLGYFAGWRQAKRRQ |
Ga0310915_109799122 | 3300031573 | Soil | MKTADALMVIYYVVLNGVLVFTLGYLAGWRHAKGRQ |
Ga0307480_10137551 | 3300031677 | Hardwood Forest Soil | MKTADTMMLVYYVVLSGVLVFTLGYLAGWRQAKRN |
Ga0318560_101674261 | 3300031682 | Soil | ADRMKTSDALMVVYYVLLSGVLVFTLGYLAGWRHAKRRQN |
Ga0306917_108280012 | 3300031719 | Soil | MTTADALMVVYYVVLSGLLVFTLGYLAGWRHAKARQ |
Ga0306918_102841882 | 3300031744 | Soil | MGADRMKNPDALMVIYYVVLSGVLVFTLGYLAGWRRAKRRQ |
Ga0306918_109540931 | 3300031744 | Soil | MKNPDALMVVYYVVLSGMLVFTLGYLAGWRHAKRRQ |
Ga0318502_105863121 | 3300031747 | Soil | MTTADALMMVYYVVLSGVLVFTLGYLAGWRHAKRQ |
Ga0307477_100260741 | 3300031753 | Hardwood Forest Soil | MKTADALMVIYYVVLSGLLVFTLGYLAGWRHTKRRQ |
Ga0307477_102964623 | 3300031753 | Hardwood Forest Soil | MKTADALMVIYYVVLSGVLVFTLGYLSGWRHAKRRQ |
Ga0318537_101482243 | 3300031763 | Soil | MNTADALMVVYYVVLSGVMVFTLGYLADWRDAKRRQ |
Ga0318521_104308472 | 3300031770 | Soil | MGPDRMKTADALMVIYYVVLNGVLVFTLGYLAGWRHAKGRQ |
Ga0318546_102783221 | 3300031771 | Soil | GRMNTADALMVVYYVVLSGVMVFTLGYLADWRHAKRRQ |
Ga0318543_104227073 | 3300031777 | Soil | GADRMTTADALMVVYYVVLSGVLVFTLGCLAGWRYAKRRQ |
Ga0318508_10188232 | 3300031780 | Soil | MKTADALMVIYYVVLSGVLVFTFGYLAGWRHAKRSQ |
Ga0318508_12072602 | 3300031780 | Soil | MNTADALMVVYYVVLSGVLVFTLGYLAGWRHAKRRQ |
Ga0318552_105074682 | 3300031782 | Soil | MKSADALMVIYYVVLSGVLVFTLGYLAGWRQAKRR |
Ga0318529_103897172 | 3300031792 | Soil | MKTADALMVIYYVVLSGVLVFTLGYLAGWRHAKRRQ |
Ga0318503_101886902 | 3300031794 | Soil | MKTSDALMVVYYMLLSGVLVFTLGYLAGWRHAKRRQN |
Ga0318568_105753533 | 3300031819 | Soil | RMNTADALMVVYYVVLSGVMVFTLGYLADWRHAKRRQ |
Ga0310917_100919087 | 3300031833 | Soil | DRMNTADALMVVYYVVLSGVMVFTLGYLADWRDAKRRQ |
Ga0318527_104258391 | 3300031859 | Soil | MKNPDALMMVYYVVLSGVLVFTLGYLAGWRHAKRQ |
Ga0306919_104185032 | 3300031879 | Soil | MNSADTLMVIYYVVLSGVLVFTLGYLAGWRHAKRRQ |
Ga0306919_107702351 | 3300031879 | Soil | MNTADTLNAVYYVLLSGALVFALGCLAGWRYTKGKR |
Ga0306919_112316122 | 3300031879 | Soil | MKNADTLMVFYYVVLSSVLVFTLGYFAGWRHAKRRQ |
Ga0306925_104123462 | 3300031890 | Soil | MTTADTLTVIYYVVLSGVLVFTLGYLAGRRHAKRRQ |
Ga0306925_106172573 | 3300031890 | Soil | MSTADTLNVVYYVLLSGALVFALGCLAGWRYTKGKR |
Ga0306925_111361272 | 3300031890 | Soil | MKNPDALMVVYYVVLSGMLVFTLGYLAGWRHAKRR |
Ga0318551_104723862 | 3300031896 | Soil | LQLRWALSREARADRMTTADTLTVIYYVVLSGVLVFTLGYLAGRRHAKRRQ |
Ga0310913_101125701 | 3300031945 | Soil | MNTADALMVVYYVVLSGVMVFTLGYLADWRHAKRKQ |
Ga0310913_109900751 | 3300031945 | Soil | MEADRMKTADALMVIYYVVLSGVLVFTLGYLTGWRQAKR |
Ga0306922_104478623 | 3300032001 | Soil | MKTADALMVIYYLVLSGALVFTLGYLAGWRHAKRRQ |
Ga0310911_100884471 | 3300032035 | Soil | DGLLIGADRMKNPDALMVVYYVVLTGVLVFTLGYFAGWRQAKRRQ |
Ga0310911_105968921 | 3300032035 | Soil | MGADCMTTADALMVVYYVVLSGVLVFTLGYLAGWRHAKSRQ |
Ga0318533_113389821 | 3300032059 | Soil | TMGSDRMKNPDALMVVYYVLLSGVLVFTLGYLAGWRHAKKRQ |
Ga0307471_1010981672 | 3300032180 | Hardwood Forest Soil | MGADRMKTADTMMLVYYVVLSGVLVFTLGYLAGWRQAKRN |
Ga0306920_1009155852 | 3300032261 | Soil | MKTAGALMVVYYVVLSGAPVFTLGYLAGWHHAKRRQ |
Ga0306920_1015866222 | 3300032261 | Soil | MKNPDALMVVYYVLLSGVLVFTLGYLAGWRHAKKRQ |
Ga0306920_1018002182 | 3300032261 | Soil | MNTADALMVVYYVVLSGVLVFTLGYLAGWRHAKSRQ |
Ga0306920_1019332161 | 3300032261 | Soil | MKNPDALMVIYYVVLSGVLVFTLGYLAGWRRAKRRQ |
Ga0306920_1026304792 | 3300032261 | Soil | MTTADALMMVYSVVLSGVLVFTLGYLAGWRHAKRQ |
Ga0306920_1033108122 | 3300032261 | Soil | MKTADALMVVYYVVLSGVLVFTLGYLAGWRHAKSRQ |
Ga0306920_1044122641 | 3300032261 | Soil | MKSADALMLVYYVVLSGVLVFTLGYLAGWRHAKSRQ |
⦗Top⦘ |