Metagenome Family F067180

Overview

Basic Information

• Family ID: F067180
• Family Type: Metagenome
• Number of Sequences: 126
• Average Sequence Length: 39 residues
• Representative Sequence: MALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
• Number of Associated Samples: 20
• Number of Associated Scaffolds: 126

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.80 %
• % of genes near scaffold ends (potentially truncated): 34.92 %
• % of genes from short scaffolds (< 2000 bps): 84.92 %
• Associated GOLD sequencing projects: 10
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (92.857 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (69.841 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 43.28%
  β-sheet: 0.00%
  Coil/Unstructured: 56.72%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 126 Family Scaffolds
PF00078	RVT_1	1.59

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
All Organisms	root	All Organisms	7.14 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
cellular organisms	root	All Organisms → cellular organisms	7.14 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	5.56 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.59 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5.56 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.59 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	3.97 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.59 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	3.17 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.59 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	3.17 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	1.59 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	1.59 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.59 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	1.59 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	1.59 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.59 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	1.59 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	1.59 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	1.59 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.79 %
Cephalochordata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata	0.79 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	1.59 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1.59 %
Leptocardii	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii	0.79 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.79 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Amphioxiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes	0.79 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.79 %
Chelicerata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata	0.79 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.79 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.79 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.79 %
Branchiostomidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae	0.79 %
Pycnogonida	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida	0.79 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.79 %
Pantopoda	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda	0.79 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Nymphonidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae	0.79 %
Sarcopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii	0.79 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.79 %
Dipnotetrapodomorpha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha	0.79 %
Nymphon	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.79 %
Tetrapoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Amniota	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota	0.79 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Sauropsida	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida	0.79 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	0.79 %
Sauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	0.79 %
Archelosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Testudinata	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata	0.79 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	0.79 %
Testudines	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Cryptodira	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira	0.79 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Durocryptodira	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira	0.79 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Testudinoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea	0.79 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Emydidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae	0.79 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 28

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Trachemys	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Trachemys	0.79 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 29

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Trachemys scripta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Trachemys → Trachemys scripta	0.79 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Level 30

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Trachemys scripta elegans	subspecies	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Trachemys → Trachemys scripta → Trachemys scripta elegans	0.79 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001734|JGI24668J20090_10064873	Not Available	909
3300001734|JGI24668J20090_10067823	Not Available	893
3300001734|JGI24668J20090_10165227	Not Available	619
3300001734|JGI24668J20090_10208586	Not Available	557
3300001741|JGI24671J20093_10054335	Not Available	862
3300001741|JGI24671J20093_10103123	Not Available	684
3300001741|JGI24671J20093_10185190	Not Available	544
3300001741|JGI24671J20093_10206798	Not Available	519
3300001741|JGI24671J20093_10223032	Not Available	502
3300001742|JGI24673J20094_10023388	Not Available	1304
3300001742|JGI24673J20094_10065532	Not Available	905
3300001742|JGI24673J20094_10080984	Not Available	835
3300001742|JGI24673J20094_10210001	Not Available	562
3300001742|JGI24673J20094_10242473	Not Available	526
3300001744|JGI24669J20092_10075979	Not Available	690
3300001744|JGI24669J20092_10095256	Not Available	636
3300001744|JGI24669J20092_10163561	Not Available	519
3300001744|JGI24669J20092_10168464	Not Available	513
3300001746|JGI24672J20091_10055319	Not Available	766
3300001746|JGI24672J20091_10100586	Not Available	622
3300001746|JGI24672J20091_10160053	Not Available	524
3300001746|JGI24672J20091_10167804	Not Available	515
3300002181|JGI24670J26820_11204005	Not Available	519
3300002181|JGI24670J26820_11275707	Not Available	570
3300002181|JGI24670J26820_11330403	Not Available	617
3300002181|JGI24670J26820_11363937	Not Available	651
3300002181|JGI24670J26820_11437153	Not Available	746
3300002181|JGI24670J26820_11470959	Not Available	805
3300003801|Ga0056138_1031337	Not Available	674
3300003829|Ga0056137_1012965	Not Available	931
3300004098|Ga0065184_10270951	Not Available	610
3300004122|Ga0065185_10002807	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	3349
3300027540|Ga0209791_1000401	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	16095
3300027540|Ga0209791_1002280	Not Available	4840
3300027540|Ga0209791_1002939	Not Available	4301
3300027540|Ga0209791_1027839	Not Available	1959
3300027540|Ga0209791_1058060	Not Available	1504
3300027540|Ga0209791_1341184	Not Available	569
3300027540|Ga0209791_1355279	Not Available	549
3300027540|Ga0209791_1383011	Not Available	513
3300027551|Ga0209338_1013376	Not Available	3908
3300027551|Ga0209338_1033038	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2812
3300027551|Ga0209338_1077493	Not Available	1922
3300027551|Ga0209338_1083317	Not Available	1852
3300027551|Ga0209338_1122844	Not Available	1485
3300027551|Ga0209338_1125669	Not Available	1463
3300027551|Ga0209338_1229412	Not Available	948
3300027551|Ga0209338_1233544	Not Available	934
3300027551|Ga0209338_1242787	Not Available	904
3300027551|Ga0209338_1259867	Not Available	851
3300027551|Ga0209338_1278830	Not Available	794
3300027551|Ga0209338_1317922	Not Available	690
3300027551|Ga0209338_1324518	Not Available	675
3300027551|Ga0209338_1375188	Not Available	564
3300027551|Ga0209338_1382329	Not Available	550
3300027551|Ga0209338_1398949	Not Available	517
3300027556|Ga0209743_1040511	Not Available	2000
3300027556|Ga0209743_1041307	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1986
3300027556|Ga0209743_1057245	Not Available	1752
3300027556|Ga0209743_1170119	Not Available	1031
3300027556|Ga0209743_1266081	Not Available	767
3300027556|Ga0209743_1274697	Not Available	748
3300027556|Ga0209743_1335702	Not Available	633
3300027556|Ga0209743_1345703	Not Available	617
3300027556|Ga0209743_1346254	Not Available	616
3300027564|Ga0209428_1071621	Not Available	1788
3300027564|Ga0209428_1089113	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	1612
3300027564|Ga0209428_1209322	Not Available	975
3300027564|Ga0209428_1235026	Not Available	898
3300027564|Ga0209428_1268574	Not Available	805
3300027564|Ga0209428_1293560	Not Available	744
3300027564|Ga0209428_1315011	Not Available	698
3300027564|Ga0209428_1316777	Not Available	694
3300027564|Ga0209428_1335494	Not Available	657
3300027564|Ga0209428_1336723	Not Available	655
3300027564|Ga0209428_1342951	Not Available	643
3300027564|Ga0209428_1415814	Not Available	520
3300027584|Ga0209637_1054965	Not Available	2099
3300027584|Ga0209637_1117846	Not Available	1447
3300027584|Ga0209637_1138731	Not Available	1316
3300027584|Ga0209637_1186352	Not Available	1090
3300027584|Ga0209637_1260552	Not Available	852
3300027584|Ga0209637_1262450	Not Available	847
3300027584|Ga0209637_1263701	Not Available	843
3300027584|Ga0209637_1302029	Not Available	745
3300027584|Ga0209637_1328330	Not Available	688
3300027584|Ga0209637_1368110	Not Available	611
3300027584|Ga0209637_1413087	Not Available	534
3300027584|Ga0209637_1428905	Not Available	510
3300027585|Ga0209150_1028794	Not Available	2037
3300027585|Ga0209150_1080091	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Trachemys → Trachemys scripta → Trachemys scripta elegans	1385
3300027585|Ga0209150_1235763	Not Available	785
3300027613|Ga0209122_1030069	Not Available	2275
3300027613|Ga0209122_1119411	Not Available	1265
3300027613|Ga0209122_1219698	Not Available	886
3300027613|Ga0209122_1271126	Not Available	756
3300027620|Ga0209260_10202303	Not Available	642
3300027626|Ga0209149_1010066	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6765
3300027626|Ga0209149_1035604	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	4077
3300027626|Ga0209149_1047096	Not Available	3554
3300027626|Ga0209149_1056662	Not Available	3218
3300027626|Ga0209149_1071747	Not Available	2807
3300027626|Ga0209149_1101129	Not Available	2253
3300027626|Ga0209149_1112184	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2091
3300027626|Ga0209149_1149331	Not Available	1665
3300027626|Ga0209149_1163404	Not Available	1533
3300027626|Ga0209149_1166759	Not Available	1504
3300027626|Ga0209149_1166761	Not Available	1504
3300027626|Ga0209149_1184538	Not Available	1363
3300027626|Ga0209149_1230699	Not Available	1070
3300027626|Ga0209149_1242988	Not Available	1007
3300027626|Ga0209149_1264533	Not Available	905
3300027626|Ga0209149_1287619	Not Available	807
3300027626|Ga0209149_1298324	Not Available	764
3300027626|Ga0209149_1303036	Not Available	747
3300027626|Ga0209149_1334807	Not Available	640
3300027626|Ga0209149_1351406	Not Available	588
3300027626|Ga0209149_1366261	Not Available	543
3300027626|Ga0209149_1381562	Not Available	503
3300027632|Ga0209339_1024192	Not Available	4152
3300027632|Ga0209339_1219159	Not Available	1133
3300027632|Ga0209339_1234194	Not Available	1065
3300027632|Ga0209339_1240518	Not Available	1037
3300027632|Ga0209339_1323986	Not Available	744
3300027632|Ga0209339_1376999	Not Available	607

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	69.84%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	30.16%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	69.84%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	30.16%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	69.84%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	30.16%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001734	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1	Host-Associated
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated
3300001744	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2	Host-Associated
3300001746	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2	Host-Associated
3300002181	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3	Host-Associated
3300003801	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1	Host-Associated
3300003829	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI	Host-Associated
3300004098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (version 2)	Host-Associated
3300004122	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (version 2)	Host-Associated
3300027540	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes)	Host-Associated
3300027551	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes)	Host-Associated
3300027556	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 (SPAdes)	Host-Associated
3300027564	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes)	Host-Associated
3300027584	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes)	Host-Associated
3300027585	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)	Host-Associated
3300027613	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes)	Host-Associated
3300027620	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI (SPAdes)	Host-Associated
3300027626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes)	Host-Associated
3300027632	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24668J20090_100648733	3300001734	Marine Gutless Worms Symbiont	LPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG*
JGI24668J20090_100678231	3300001734	Marine Gutless Worms Symbiont	VTHLPMKFGADIFIQSGVIDIFPKLKMVCAAIVDLFG*
JGI24668J20090_101652271	3300001734	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQSGVIDIFPQFKMAAAAILELLG*
JGI24668J20090_102085861	3300001734	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIYIFLKLKMVAAAILDLFG*
JGI24671J20093_100543352	3300001741	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDILQKLKMVAAAILDLFG*
JGI24671J20093_101031231	3300001741	Marine Gutless Worms Symbiont	ALMRLPMKFGADIFIQSGIIDICPKLKMAAAAILDLLG*
JGI24671J20093_101851902	3300001741	Marine Gutless Worms Symbiont	CMAVLHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG*
JGI24671J20093_102067982	3300001741	Marine Gutless Worms Symbiont	MTVMHLPMKFGADIFIQSGVIDIFQKLKMVAAAILDLFG*
JGI24671J20093_102230322	3300001741	Marine Gutless Worms Symbiont	MAVMHLPIKFGADIFIQAGVIDIFLKLKMAAAAILEFYVM*
JGI24673J20094_100233883	3300001742	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVINIFQKLKMVAAAILDLFG*
JGI24673J20094_100655322	3300001742	Marine Gutless Worms Symbiont	MALMRLPTKFGADIFIQSGVINIFPKLMMAAAAILELLG*
JGI24673J20094_100809842	3300001742	Marine Gutless Worms Symbiont	MAVTHLPMKFGADIFIQSGVIDIFPKLKMVCAAIVDLFG*
JGI24673J20094_102100011	3300001742	Marine Gutless Worms Symbiont	MHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLLR*
JGI24673J20094_102424731	3300001742	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKTMAAAILDLFG*
JGI24669J20092_100759792	3300001744	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFTKLKMAAAAILKLLG*
JGI24669J20092_100952562	3300001744	Marine Gutless Worms Symbiont	LPMKFGADIFIQSGVIDIFRKLKMLAAAILDLFG*
JGI24669J20092_101635612	3300001744	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAGAAILELFG*
JGI24669J20092_101684641	3300001744	Marine Gutless Worms Symbiont	LMHLPTKFGADIFIQSGVIDIFPKLKMAAAAILGLFG*
JGI24672J20091_100553192	3300001746	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAIVDLFG*
JGI24672J20091_101005862	3300001746	Marine Gutless Worms Symbiont	MALXRLPMKFGADIXIQSGVIDIFPKLKMAAAAILELLG*
JGI24672J20091_101600531	3300001746	Marine Gutless Worms Symbiont	MALVRLSMKFGADIFIRSGVIDIFPKLKVAAAAILELLG*
JGI24672J20091_101678041	3300001746	Marine Gutless Worms Symbiont	MALVRLSMKFGADIFIQSGVIDIFPKLKMAAAAILEL
JGI24670J26820_112040052	3300002181	Marine Gutless Worms Symbiont	SRGHLCMALVRLPMKFGAYIFIQSGVIDIFPQFKMAAAAILELLG*
JGI24670J26820_112757071	3300002181	Marine Gutless Worms Symbiont	AVMHLHIKFGADIFIQSGVIHIFLKLKMAAATIIDFQVM*
JGI24670J26820_113304031	3300002181	Marine Gutless Worms Symbiont	HLPMKFGADIFIQSGVIDIFRKLKMVAAAIVDLFG*
JGI24670J26820_113639371	3300002181	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFFQSRVIDIFPKLMMAAAAILETLG*
JGI24670J26820_114371531	3300002181	Marine Gutless Worms Symbiont	RGHFCMALVRLPMKFGADIFIQSGVIDIFSKIKMAAAAILDLFG*
JGI24670J26820_114709591	3300002181	Marine Gutless Worms Symbiont	RGHLRMAVMHLSIKFGADIFIQAGVIDIFPKLKMAAAAILEFYVM*
Ga0056138_10313371	3300003801	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG*
Ga0056137_10129651	3300003829	Marine Gutless Worms Symbiont	VHLRMAVMHLHIKFGADIFIQSGVIDIFPKLKMAAVAILDFQLM*
Ga0065184_102709512	3300004098	Marine Gutless Worms Symbiont	MAVMHLIMKFGADIFIQSGVIDSFRKLQMVAAAILDLFG*
Ga0065185_100028078	3300004122	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGIIDICPKLKMAAAAILDLLG*
Ga0209791_10004013	3300027540	Marine Gutless Worms Symbiont	MALLRLPMKFGPDIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209791_10022802	3300027540	Marine Gutless Worms Symbiont	MALLRLPMKFGAYIFIQSGVIHIFPKLKMAAAAILELLE
Ga0209791_10029391	3300027540	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209791_10278392	3300027540	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFPKLNMAAAAIVELLG
Ga0209791_10580602	3300027540	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDILQKLKMVAAAILDLFG
Ga0209791_13411842	3300027540	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFSKLKMAAAAILELLG
Ga0209791_13552791	3300027540	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSRVIDIFPKLKMAAAAILELLG
Ga0209791_13830111	3300027540	Marine Gutless Worms Symbiont	RGHLCMALLRLPMKFGAYIFIQSGVIDIFPKLKMAAAAILELFG
Ga0209338_10133765	3300027551	Marine Gutless Worms Symbiont	MAAMHLPMIFGADIFIQSGVIDIFLKLKMAAAAILDLFG
Ga0209338_10330385	3300027551	Marine Gutless Worms Symbiont	MVVMHLPMKFGADIFIQSGVIDIFPKLKMAAAAILNLFG
Ga0209338_10774933	3300027551	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFPKLKMVAAAILDLFG
Ga0209338_10833172	3300027551	Marine Gutless Worms Symbiont	MALVRLSMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209338_11228441	3300027551	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQSGVIDIFPQFKMAAAAILELLG
Ga0209338_11256692	3300027551	Marine Gutless Worms Symbiont	MAMLRLPMKFGADTFIQSGVIDIFPKLKMAAAVILELLG
Ga0209338_12294121	3300027551	Marine Gutless Worms Symbiont	MKFGADIFIQSGVIYIFLKLKMVAAAILDLFGXVMGPQAS
Ga0209338_12335441	3300027551	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAIVDLFG
Ga0209338_12427872	3300027551	Marine Gutless Worms Symbiont	MAVMHLPIKFGARIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209338_12598671	3300027551	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFSKIKMAAAAILDLFG
Ga0209338_12788301	3300027551	Marine Gutless Worms Symbiont	MALLRLLMKFGADIFMQSVVTDIFPKLKMAAAAILELLG
Ga0209338_12988591	3300027551	Marine Gutless Worms Symbiont	MASLHLSMKFGADIFIQSGVIDILPKLTMAAAAILDLFA
Ga0209338_13179221	3300027551	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAVAILDF
Ga0209338_13245182	3300027551	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLE
Ga0209338_13751882	3300027551	Marine Gutless Worms Symbiont	MAVMHLPMKIGADIFIQSGVIDIFLKLKMVAAAILDLFG
Ga0209338_13823291	3300027551	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLGXA
Ga0209338_13989491	3300027551	Marine Gutless Worms Symbiont	MALLRLPLKLGADIFIQSGVIDIFPKLKMAAAAIL
Ga0209743_10405112	3300027556	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209743_10413072	3300027556	Marine Gutless Worms Symbiont	MAVMHLPVKFGADIFIQSGVIDIFPKLKMVAAAILDL
Ga0209743_10572453	3300027556	Marine Gutless Worms Symbiont	MAVTHLPMKFGADIFIQSGVIDIFPKLKMVCAAIVDLFG
Ga0209743_11701191	3300027556	Marine Gutless Worms Symbiont	MAVTRLPMKFGADIFIQCGVIDISSKLKMVVAAILDLFG
Ga0209743_12660811	3300027556	Marine Gutless Worms Symbiont	MALVRLPTKFGADIFIQSGVIDIFPKLKLAAAAILELLG
Ga0209743_12746971	3300027556	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQFGVIDIFPKLKMAAAAILELLG
Ga0209743_13357021	3300027556	Marine Gutless Worms Symbiont	RGHLCMAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209743_13457031	3300027556	Marine Gutless Worms Symbiont	AVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAIVDLFG
Ga0209743_13462541	3300027556	Marine Gutless Worms Symbiont	LVRLPMKFGADIFIQSGVIDIFSKLKMAAAAILELLG
Ga0209428_10716211	3300027564	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFPKLKMAAAAILDLVG
Ga0209428_10891131	3300027564	Marine Gutless Worms Symbiont	RGHLCMALIRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209428_12093221	3300027564	Marine Gutless Worms Symbiont	MKFGADIFIQSGVIDIFRKLKMVAAAILDLFGXAVGPP
Ga0209428_12350261	3300027564	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGIIDICPKLKMAAAAILDLLG
Ga0209428_12685741	3300027564	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDILPKLKMAAAAMLDLFG
Ga0209428_12935601	3300027564	Marine Gutless Worms Symbiont	GHLCMALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209428_13150111	3300027564	Marine Gutless Worms Symbiont	GNLCMALVRLSMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209428_13167772	3300027564	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQSGVIDIFPKLKMVAAAFLEL
Ga0209428_13354941	3300027564	Marine Gutless Worms Symbiont	WSRSHASSMKFSADIFIQSGVIDIFPKLKMVAAAILDLFG
Ga0209428_13367232	3300027564	Marine Gutless Worms Symbiont	MALVRLPMKFGADICIQSRVIDIFPKLKMAAAAILELLG
Ga0209428_13429511	3300027564	Marine Gutless Worms Symbiont	VALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209428_14158141	3300027564	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAIL
Ga0209637_10549651	3300027584	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVINIFQKLKMVAAAILDLFG
Ga0209637_11178461	3300027584	Marine Gutless Worms Symbiont	MAVMHLSIKFGAYILIQAGVIDIFPKLKMAAAAILEFYVMXIWLFRRV
Ga0209637_11387312	3300027584	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKTMAAAILDLFG
Ga0209637_11863521	3300027584	Marine Gutless Worms Symbiont	MALIRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209637_12605521	3300027584	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQCGVIDIFTKLKMAVAAILELFG
Ga0209637_12624501	3300027584	Marine Gutless Worms Symbiont	MAVMHLPMKFGEDIFIQSGVIDIFQKLKMVAAAILDLFG
Ga0209637_12637011	3300027584	Marine Gutless Worms Symbiont	MALMHLPTKFGADIFIQSGVIDIFPKLKMAAAAILDLFG
Ga0209637_13020291	3300027584	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILKLLG
Ga0209637_13283301	3300027584	Marine Gutless Worms Symbiont	MTLVRLPMKFGAYIFIQSGVIDIFPKLKMAAAAILKLLG
Ga0209637_13681101	3300027584	Marine Gutless Worms Symbiont	MHLSIKFGADIFIRSGVIDIFPKLKMTAASILDLLG
Ga0209637_14130872	3300027584	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGVIDVFPKLKMAAAAILELLG
Ga0209637_14289052	3300027584	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFLKLKMVAAAILDLFG
Ga0209150_10287942	3300027585	Marine Gutless Worms Symbiont	MALVRLSMKFGADIFIQSGVIDIFPKLKMAAAAILDLGIAWVGPHT
Ga0209150_10800913	3300027585	Marine Gutless Worms Symbiont	MTVMHLPMKFGADIFIQSGVIDIFQKLKMVAAAILDLFG
Ga0209150_12357632	3300027585	Marine Gutless Worms Symbiont	MKFGADIFIQSGVIDIFRKLKMVAAAILDLFGXAMGP
Ga0209122_10300691	3300027613	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIHSGVIDIFPKLKMAAAAILELLG
Ga0209122_11194112	3300027613	Marine Gutless Worms Symbiont	MALMHLPTKFGADIFIQSGVIDIFPKLKMAAAAILGLFG
Ga0209122_12196982	3300027613	Marine Gutless Worms Symbiont	IATMHLPMKFGADIFIQSGVIDIFRKLKMVTAAILDLFG
Ga0209122_12711261	3300027613	Marine Gutless Worms Symbiont	MALLRLPMKFSADTFIQSGVIDIFPKSMMAAAVILELLG
Ga0209260_102023032	3300027620	Marine Gutless Worms Symbiont	RLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_10100665	3300027626	Marine Gutless Worms Symbiont	MALVRHPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_10356041	3300027626	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_10470965	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILDF
Ga0209149_10566626	3300027626	Marine Gutless Worms Symbiont	MAVVHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209149_10717471	3300027626	Marine Gutless Worms Symbiont	MALMRLPTKFGADIFIQSGVINIFPKLMMAAAAILELLG
Ga0209149_11011292	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFLKLKMAAAAILELLG
Ga0209149_11121843	3300027626	Marine Gutless Worms Symbiont	MALLCFPMKFGADIFIQSGVIDFFPKLKMAAAAILELLG
Ga0209149_11493311	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFMQSVVTDIFPKLKMAAAAILELLG
Ga0209149_11634041	3300027626	Marine Gutless Worms Symbiont	LLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_11667591	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGAYIFIQSGVIDIIPKLKMAAAAILELLG
Ga0209149_11667612	3300027626	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQSGVIDIFPKLKMVAAAFLELLG
Ga0209149_11845381	3300027626	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIYIFLKLKMVAAAILDLFR
Ga0209149_12306991	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFTQSGVIVFFPKLKMAAAAILELLG
Ga0209149_12429881	3300027626	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFPKLEMAAAAILELL
Ga0209149_12645331	3300027626	Marine Gutless Worms Symbiont	MALMRLLMKFGADIFIQSGVIDIFPKLKMAAAAMLELLG
Ga0209149_12876191	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGAYIFIQSGVIDIFPKVNMAAAAILELLGXAMGPPTK
Ga0209149_12983242	3300027626	Marine Gutless Worms Symbiont	MAVMHLPVKFGADIFFQSGVIDIFPKMAAAAILDFQIM
Ga0209149_13030361	3300027626	Marine Gutless Worms Symbiont	MDVMHLPMKFGADIFIQSGVIYIFLKLKMVAAAILDLFG
Ga0209149_13348071	3300027626	Marine Gutless Worms Symbiont	MHLPVKFGADIFIQSGVIDIFQKLKMVAAAILDLFG
Ga0209149_13514061	3300027626	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAIL
Ga0209149_13662611	3300027626	Marine Gutless Worms Symbiont	MALLRFPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_13815622	3300027626	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209339_10241921	3300027632	Marine Gutless Worms Symbiont	MHLSMKFGAAIFVQSGVIDIFRKLKMVAAAILDLFG
Ga0209339_12191591	3300027632	Marine Gutless Worms Symbiont	TVLIATMHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209339_12341941	3300027632	Marine Gutless Worms Symbiont	CMAVVHIPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209339_12405181	3300027632	Marine Gutless Worms Symbiont	MAFLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILE
Ga0209339_13239862	3300027632	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQFRVIDIFPKLKMAAAAILELLG
Ga0209339_13769992	3300027632	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFFQSRVIDIFPKLMMAAAAILETLG