Basic Information | |
---|---|
Family ID | F067016 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 126 |
Average Sequence Length | 41 residues |
Representative Sequence | MTKARSAALSARSDGFDDVDGSPECGVYTQMRGIEQVRVG |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 126 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 37.90 % |
% of genes near scaffold ends (potentially truncated) | 93.65 % |
% of genes from short scaffolds (< 2000 bps) | 92.86 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.22 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (73.016 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.254 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.048 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.825 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.12% β-sheet: 0.00% Coil/Unstructured: 80.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 126 Family Scaffolds |
---|---|---|
PF00575 | S1 | 91.27 |
PF00216 | Bac_DNA_binding | 1.59 |
PF00672 | HAMP | 0.79 |
COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
---|---|---|---|
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 73.02 % |
All Organisms | root | All Organisms | 26.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig61857 | Not Available | 787 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10000720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6670 | Open in IMG/M |
3300004092|Ga0062389_103100309 | Not Available | 622 | Open in IMG/M |
3300005557|Ga0066704_10736657 | Not Available | 618 | Open in IMG/M |
3300005561|Ga0066699_10764221 | Not Available | 684 | Open in IMG/M |
3300005577|Ga0068857_100820736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 889 | Open in IMG/M |
3300005591|Ga0070761_10594920 | Not Available | 687 | Open in IMG/M |
3300005610|Ga0070763_10322420 | Not Available | 854 | Open in IMG/M |
3300005713|Ga0066905_100138353 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
3300006034|Ga0066656_10335742 | Not Available | 976 | Open in IMG/M |
3300006047|Ga0075024_100592474 | Not Available | 595 | Open in IMG/M |
3300006052|Ga0075029_100797162 | Not Available | 643 | Open in IMG/M |
3300006059|Ga0075017_101213878 | Not Available | 591 | Open in IMG/M |
3300006174|Ga0075014_100062673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1634 | Open in IMG/M |
3300006354|Ga0075021_10127850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1524 | Open in IMG/M |
3300006606|Ga0074062_12608226 | Not Available | 630 | Open in IMG/M |
3300006852|Ga0075433_11648405 | Not Available | 553 | Open in IMG/M |
3300006854|Ga0075425_100777741 | Not Available | 1098 | Open in IMG/M |
3300006904|Ga0075424_101857828 | Not Available | 637 | Open in IMG/M |
3300007076|Ga0075435_101236134 | Not Available | 654 | Open in IMG/M |
3300009148|Ga0105243_11136615 | Not Available | 791 | Open in IMG/M |
3300009162|Ga0075423_10787084 | Not Available | 1006 | Open in IMG/M |
3300009521|Ga0116222_1136251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 1057 | Open in IMG/M |
3300009545|Ga0105237_11643902 | Not Available | 649 | Open in IMG/M |
3300009672|Ga0116215_1445229 | Not Available | 560 | Open in IMG/M |
3300009824|Ga0116219_10676210 | Not Available | 565 | Open in IMG/M |
3300010043|Ga0126380_11425466 | Not Available | 610 | Open in IMG/M |
3300010154|Ga0127503_10635611 | Not Available | 583 | Open in IMG/M |
3300010337|Ga0134062_10174340 | Not Available | 968 | Open in IMG/M |
3300010343|Ga0074044_10278295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 1102 | Open in IMG/M |
3300010358|Ga0126370_10371271 | Not Available | 1164 | Open in IMG/M |
3300010360|Ga0126372_10914901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 881 | Open in IMG/M |
3300010360|Ga0126372_11488244 | Not Available | 712 | Open in IMG/M |
3300010396|Ga0134126_10962824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 957 | Open in IMG/M |
3300012096|Ga0137389_11777290 | Not Available | 512 | Open in IMG/M |
3300012189|Ga0137388_10770853 | Not Available | 892 | Open in IMG/M |
3300012200|Ga0137382_10857162 | Not Available | 655 | Open in IMG/M |
3300012208|Ga0137376_10402864 | Not Available | 1188 | Open in IMG/M |
3300012209|Ga0137379_10653763 | Not Available | 957 | Open in IMG/M |
3300012211|Ga0137377_11111510 | Not Available | 720 | Open in IMG/M |
3300012398|Ga0134051_1132536 | Not Available | 503 | Open in IMG/M |
3300012927|Ga0137416_12012610 | Not Available | 530 | Open in IMG/M |
3300014200|Ga0181526_10232099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 1177 | Open in IMG/M |
3300014201|Ga0181537_10942411 | Not Available | 585 | Open in IMG/M |
3300014489|Ga0182018_10278541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 914 | Open in IMG/M |
3300014499|Ga0182012_10604371 | Not Available | 705 | Open in IMG/M |
3300014501|Ga0182024_10900630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 1066 | Open in IMG/M |
3300014638|Ga0181536_10024447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 4741 | Open in IMG/M |
3300014657|Ga0181522_10592754 | Not Available | 672 | Open in IMG/M |
3300015371|Ga0132258_11902625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1498 | Open in IMG/M |
3300015372|Ga0132256_102279818 | Not Available | 645 | Open in IMG/M |
3300016270|Ga0182036_10155052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1635 | Open in IMG/M |
3300016422|Ga0182039_10790816 | Not Available | 841 | Open in IMG/M |
3300016445|Ga0182038_10023664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3746 | Open in IMG/M |
3300017942|Ga0187808_10187682 | Not Available | 917 | Open in IMG/M |
3300017946|Ga0187879_10485195 | Not Available | 685 | Open in IMG/M |
3300017959|Ga0187779_10638835 | Not Available | 715 | Open in IMG/M |
3300017972|Ga0187781_11436609 | Not Available | 511 | Open in IMG/M |
3300017975|Ga0187782_10451052 | Not Available | 980 | Open in IMG/M |
3300018006|Ga0187804_10143055 | Not Available | 1004 | Open in IMG/M |
3300018015|Ga0187866_1273830 | Not Available | 599 | Open in IMG/M |
3300018034|Ga0187863_10634635 | Not Available | 602 | Open in IMG/M |
3300018058|Ga0187766_11177959 | Not Available | 554 | Open in IMG/M |
3300018082|Ga0184639_10310978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 827 | Open in IMG/M |
3300018433|Ga0066667_10882731 | Not Available | 768 | Open in IMG/M |
3300019192|Ga0184603_132547 | Not Available | 624 | Open in IMG/M |
3300021088|Ga0210404_10218046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sagittula → Sagittula stellata → Sagittula stellata E-37 | 1028 | Open in IMG/M |
3300021171|Ga0210405_11342155 | Not Available | 523 | Open in IMG/M |
3300021474|Ga0210390_10542280 | Not Available | 978 | Open in IMG/M |
3300021477|Ga0210398_10044095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3685 | Open in IMG/M |
3300024271|Ga0224564_1071940 | Not Available | 689 | Open in IMG/M |
3300025898|Ga0207692_10843613 | Not Available | 601 | Open in IMG/M |
3300025906|Ga0207699_10905646 | Not Available | 651 | Open in IMG/M |
3300025914|Ga0207671_11117235 | Not Available | 619 | Open in IMG/M |
3300025928|Ga0207700_10131917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2041 | Open in IMG/M |
3300026035|Ga0207703_10707085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 958 | Open in IMG/M |
3300026819|Ga0207765_118570 | Not Available | 540 | Open in IMG/M |
3300026895|Ga0207758_1012487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 852 | Open in IMG/M |
3300027108|Ga0207946_100305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → environmental samples → uncultured Microvirga sp. | 1900 | Open in IMG/M |
3300027266|Ga0209215_1049268 | Not Available | 582 | Open in IMG/M |
3300027297|Ga0208241_1012194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1221 | Open in IMG/M |
3300027567|Ga0209115_1078074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 753 | Open in IMG/M |
3300027641|Ga0208827_1098147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 876 | Open in IMG/M |
3300027706|Ga0209581_1153044 | Not Available | 749 | Open in IMG/M |
3300027737|Ga0209038_10217913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300027894|Ga0209068_10742724 | Not Available | 576 | Open in IMG/M |
3300028780|Ga0302225_10376352 | Not Available | 668 | Open in IMG/M |
3300028802|Ga0307503_10237197 | Not Available | 884 | Open in IMG/M |
3300028808|Ga0302228_10487221 | Not Available | 544 | Open in IMG/M |
3300028819|Ga0307296_10815715 | Not Available | 508 | Open in IMG/M |
3300028880|Ga0307300_10355975 | Not Available | 506 | Open in IMG/M |
3300028906|Ga0308309_11612682 | Not Available | 552 | Open in IMG/M |
3300030580|Ga0311355_10546678 | Not Available | 1102 | Open in IMG/M |
3300031446|Ga0170820_12029321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 791 | Open in IMG/M |
3300031446|Ga0170820_13830580 | Not Available | 617 | Open in IMG/M |
3300031525|Ga0302326_12582807 | Not Available | 635 | Open in IMG/M |
3300031544|Ga0318534_10502314 | Not Available | 693 | Open in IMG/M |
3300031545|Ga0318541_10216489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 1061 | Open in IMG/M |
3300031545|Ga0318541_10490443 | Not Available | 687 | Open in IMG/M |
3300031561|Ga0318528_10168665 | Not Available | 1168 | Open in IMG/M |
3300031668|Ga0318542_10098964 | Not Available | 1405 | Open in IMG/M |
3300031679|Ga0318561_10203453 | Not Available | 1074 | Open in IMG/M |
3300031718|Ga0307474_10101400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2152 | Open in IMG/M |
3300031723|Ga0318493_10803021 | Not Available | 530 | Open in IMG/M |
3300031748|Ga0318492_10711042 | Not Available | 538 | Open in IMG/M |
3300031763|Ga0318537_10040551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1674 | Open in IMG/M |
3300031777|Ga0318543_10140510 | Not Available | 1057 | Open in IMG/M |
3300031793|Ga0318548_10081551 | Not Available | 1530 | Open in IMG/M |
3300031823|Ga0307478_10515600 | Not Available | 997 | Open in IMG/M |
3300031890|Ga0306925_11689709 | Not Available | 611 | Open in IMG/M |
3300031941|Ga0310912_10344050 | Not Available | 1157 | Open in IMG/M |
3300031946|Ga0310910_10035523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3424 | Open in IMG/M |
3300031954|Ga0306926_10465611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1556 | Open in IMG/M |
3300031954|Ga0306926_11866626 | Not Available | 680 | Open in IMG/M |
3300032025|Ga0318507_10471235 | Not Available | 547 | Open in IMG/M |
3300032065|Ga0318513_10286820 | Not Available | 799 | Open in IMG/M |
3300032066|Ga0318514_10167427 | Not Available | 1144 | Open in IMG/M |
3300032066|Ga0318514_10723785 | Not Available | 529 | Open in IMG/M |
3300032515|Ga0348332_10113985 | Not Available | 911 | Open in IMG/M |
3300032828|Ga0335080_11401221 | Not Available | 695 | Open in IMG/M |
3300032896|Ga0335075_11338754 | Not Available | 609 | Open in IMG/M |
3300034124|Ga0370483_0277208 | Not Available | 576 | Open in IMG/M |
3300034163|Ga0370515_0043541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 1996 | Open in IMG/M |
3300034163|Ga0370515_0389256 | Not Available | 588 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.25% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.97% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.97% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.17% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.17% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.17% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.17% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.17% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.38% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.38% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.38% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.38% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.59% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.59% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.79% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.79% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.79% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.79% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.79% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.79% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026819 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes) | Environmental | Open in IMG/M |
3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
3300027108 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 (SPAdes) | Environmental | Open in IMG/M |
3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0857.00004180 | 2166559005 | Simulated | MTKARLAALSARSDGLDDINGGPECSVYTQMRGIEQVSVGSGLER |
AF_2010_repII_A001DRAFT_100007208 | 3300000793 | Forest Soil | MTKTPLSAFSARSNSLDYLDGGPERGVYTQMRGIEQVRVRSRF* |
Ga0062389_1031003091 | 3300004092 | Bog Forest Soil | MTKARSTTPSARSGSLDDINGGPERRVYTQMGGVEQVRIG |
Ga0066704_107366571 | 3300005557 | Soil | MTETRSAALPACSDGFDDVDGGPECGVYIQMRGVEQVR |
Ga0066699_107642211 | 3300005561 | Soil | MTKARSAAPSARPGGLDNVDGGLERRVYSQMRGIEQVRVRR |
Ga0068857_1008207362 | 3300005577 | Corn Rhizosphere | MTKARSAALSARSDSLDDVNGGPECGVYTQMRGIEQV |
Ga0070761_105949202 | 3300005591 | Soil | MTKALSTTLSACSNGLDDSNGGPERRVYTQMRGIEQVRVGRG |
Ga0070763_103224201 | 3300005610 | Soil | MTKARSAALSARSDGFDDFDSGPECGVYIQMRGIEQV |
Ga0066905_1001383531 | 3300005713 | Tropical Forest Soil | MTETRSAALPACSDGFDDIDGGPERGVYIQMRGVEQVRVRRGFERGDG |
Ga0066656_103357423 | 3300006034 | Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQMRGVEQVRVRREF |
Ga0075024_1005924741 | 3300006047 | Watersheds | MTKARSAALSARSDGLDDINGGPECGVYTQMRGIEQV |
Ga0075029_1007971622 | 3300006052 | Watersheds | MTKTPLTAPSARSNSLDDIDGGPECGVYTQMRGIEQVRVGR |
Ga0075017_1012138781 | 3300006059 | Watersheds | MTKARSAALSARSDGLDDINGGPECGVYTQMRGIE |
Ga0075014_1000626731 | 3300006174 | Watersheds | MTKARSAALSARSDGLDDINGGPECGVYTQMRGIEQVSVGSGLERRGAP |
Ga0075021_101278501 | 3300006354 | Watersheds | MTKALSLALSARSDGFDDVDGSPECGVYTQMRGIEQVRVGR |
Ga0074062_126082262 | 3300006606 | Soil | MTKARSAALSARSDGLDDINGGPECGVYTQMCGIEQVSVGSGLERRGAPPR |
Ga0075433_116484051 | 3300006852 | Populus Rhizosphere | MTETRSAALPACSDGFDNIDGGPERGVYIQMRGIEQVRIR |
Ga0075425_1007777411 | 3300006854 | Populus Rhizosphere | MTETRSAALPACSDGFDNIDGGPERGVYIQMRGIEQVRI |
Ga0075424_1018578282 | 3300006904 | Populus Rhizosphere | MTKSRSAALSARSDGFDDVDGSPECGVYTQMRGIEQV |
Ga0075435_1012361342 | 3300007076 | Populus Rhizosphere | MTKTPLTAPSARSNSLDDIDGGPECGVYTQMRGIEQVRVRR |
Ga0105243_111366152 | 3300009148 | Miscanthus Rhizosphere | MTRARLAALSARSDGLDDINGGPECGVYTQMRGIEQVSVG |
Ga0075423_107870842 | 3300009162 | Populus Rhizosphere | MTETRSAALPACSDGFDDVDGGPECGVYIQMRGVEQVRVGG |
Ga0116222_11362511 | 3300009521 | Peatlands Soil | MTKALSTALSAHSDDFDDIDGGPERGVYTQMRGIEQ |
Ga0105237_116439021 | 3300009545 | Corn Rhizosphere | MTKARSAALSARSDGLDDVNGGPECGVYTQMRGVEQVSVGSG |
Ga0116215_14452291 | 3300009672 | Peatlands Soil | MTKALSTALSARSNGFDDIDGGPERRVYTQMRGIEQVRV |
Ga0116219_106762101 | 3300009824 | Peatlands Soil | MTKALSTALSARSNGLDDIDGGPERRVYTQMRGIEQVRVG |
Ga0126380_114254661 | 3300010043 | Tropical Forest Soil | MTKALLLALSARSDGFDDVDGSPECGVYTQMRGIEQVRVGRGL |
Ga0127503_106356111 | 3300010154 | Soil | MTKARLAALSARSDGLDDINGGPECSVYTQMRGIEQVS |
Ga0134062_101743401 | 3300010337 | Grasslands Soil | MTETRSAALPACSDGFDDVDGGPECGVYIQMRGVEQVRIRRR |
Ga0074044_102782952 | 3300010343 | Bog Forest Soil | MTKTLSAAFSARSDGFDDSDGSPECRVYTQMRRIEQVCVR |
Ga0126370_103712712 | 3300010358 | Tropical Forest Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGVEQVRV |
Ga0126372_109149012 | 3300010360 | Tropical Forest Soil | MTGARSAADPACSDGFDNVDGGPERGVYIQMRGVE |
Ga0126372_114882441 | 3300010360 | Tropical Forest Soil | MTKSRSDALSARSDGFDDVDGSPECGVYTQMRGIEQVRVVSGLQGG |
Ga0134126_109628241 | 3300010396 | Terrestrial Soil | MTKARSAALSARSDGLDDVNGGPECGVYTQMRGIEQVS |
Ga0137389_117772901 | 3300012096 | Vadose Zone Soil | MTKTPLMALSARSNSLDDIDGGPECGVYTQMRGIEQVRVR |
Ga0137388_107708531 | 3300012189 | Vadose Zone Soil | MTETRSAALPACSDGFDNVDGNPECGVYIQMRGIEQ |
Ga0137382_108571621 | 3300012200 | Vadose Zone Soil | MTKTPLTALSARSNSLDDIDGGPECGVYTQMRGIEQVRVRSGFKWGDA |
Ga0137376_104028642 | 3300012208 | Vadose Zone Soil | MTKTPLTALSARSNSLDDIDGGPECGVYTQMRGIEQVRVRSGFKWGDAAP* |
Ga0137379_106537633 | 3300012209 | Vadose Zone Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQMRGVEQVR |
Ga0137377_111115101 | 3300012211 | Vadose Zone Soil | MTKTPLTALSARSNSLDDIDGGPECGVYTQMRGIEQVRVRS |
Ga0134051_11325361 | 3300012398 | Grasslands Soil | LTETRSAAFPACSDGFDDVDGGPECGVYIQMRSIEQVRI |
Ga0137416_120126102 | 3300012927 | Vadose Zone Soil | MTGARSAARPACSDGFDNVDGSPECGVYIQMRGIEQVCIRRG |
Ga0181526_102320992 | 3300014200 | Bog | MTKALSTAPSARSNGLDDIDGGPERRVYTQMRGIEQVRVGRGL |
Ga0181537_109424112 | 3300014201 | Bog | MTKALLAALSACSNGLDDSDGGPERRVYTQMRGIEQV |
Ga0182018_102785412 | 3300014489 | Palsa | MTKALSTALSARSNGLDDIDGGPECGVYTQMRGVE |
Ga0182012_106043712 | 3300014499 | Bog | MTKARSIALSARSGSLDDINGGPERRVYTQMAGIEQVRVRRGLKRGHGSPGVP |
Ga0182024_109006302 | 3300014501 | Permafrost | MTKARSTALSARSDSFDDIDGSPECGVYTQMRGIEQVRV |
Ga0181536_100244471 | 3300014638 | Bog | MTKARSAAPSARSDGLDDCNGGPERRVYTQMRGIEQV |
Ga0181522_105927541 | 3300014657 | Bog | LLSTLSARSNGLDDVDGGPERRVYTQMRGIEQVGVGRLP |
Ga0132258_119026252 | 3300015371 | Arabidopsis Rhizosphere | MTKSRSAALSARSDGFDDVDGSPECRVYTQMRGIEQVRVGRGSQG |
Ga0132256_1022798181 | 3300015372 | Arabidopsis Rhizosphere | MTETRSTALPACSDGFDNVDGGPECGVYIQVRRVEQ |
Ga0182036_101550521 | 3300016270 | Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGIEQ |
Ga0182039_107908161 | 3300016422 | Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQVRGIEQVR |
Ga0182038_100236641 | 3300016445 | Soil | MTKTPLSAFSARSNSLDYLDGGPERGVYTQMRGIEQVRVRSRF |
Ga0187808_101876822 | 3300017942 | Freshwater Sediment | MTKAPSTALSARSNSLDNIDGSPERGVYTQMRGIEQV |
Ga0187879_104851951 | 3300017946 | Peatland | MTKALSTTLSARSNGLDDIDGGPERRVYTQMRGIEQV |
Ga0187779_106388351 | 3300017959 | Tropical Peatland | MTKARSAAPSARSDGLDDVNGGPECGVYTQMCGIEQVSVRSG |
Ga0187781_114366091 | 3300017972 | Tropical Peatland | MTKTRLTAFSARSNGLDDSDGGPERSVYTQMRSVEQ |
Ga0187782_104510521 | 3300017975 | Tropical Peatland | MTKARSAALSARSDGFDDVDGSPECGVYTQMRGIEQVRVG |
Ga0187804_101430552 | 3300018006 | Freshwater Sediment | MTKAPSTALSARSNSLDNIDGSPERGVYTQMRGIEQVR |
Ga0187866_12738301 | 3300018015 | Peatland | MTKAQSTAPSARSGGLDDLNSGPECGVYTQMGGIEQ |
Ga0187863_106346351 | 3300018034 | Peatland | MTKARSAALSARSDGFDDFDSGPECGVYIQMRGIEQVCIGSQF |
Ga0187766_111779592 | 3300018058 | Tropical Peatland | MTEALSAALPARSDCLDDVNGGPERGVYTQMRGVEQVRVGRR |
Ga0184639_103109781 | 3300018082 | Groundwater Sediment | MTGARSTALPACSDGFDDVDGGPECGVYIQMRGVEQVRI |
Ga0066667_108827312 | 3300018433 | Grasslands Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQMRGVEQVRVRR |
Ga0184603_1325471 | 3300019192 | Soil | MTKARSAALSARSDSFDDFDGSPECRVYTQMRGVEQVRIGR |
Ga0210404_102180462 | 3300021088 | Soil | MTKARSAALSARSDGLDDINGGPECGVYTQMCGIEQ |
Ga0210400_114660561 | 3300021170 | Soil | MTKTPLTALSARSNSLDDIDGGPECRVYTQMRGIEQVRVWSRFKRGDATP |
Ga0210405_113421551 | 3300021171 | Soil | MTKTPLTALSARSNSLDDIDGGPECRVYTQMRGIEQVR |
Ga0210390_105422801 | 3300021474 | Soil | MTKARSAALSARSDGFDDFDSGPECGVYIQMRGIEQVC |
Ga0210398_100440955 | 3300021477 | Soil | MTKALSTALSARSSGLDDGNGGPECGVYTQMSGVEQVRVRGGLQGG |
Ga0224564_10719402 | 3300024271 | Soil | MTKARSAALSARSDGFDDFDSGPECGVYIQMRGIEQ |
Ga0207692_108436132 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKTPLTAPSARSNSLDDIDGGPERGVYTQMRGVEQVRVRRRFQRSRG |
Ga0207699_109056461 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKSRSAALSARSDGFDDVDGSPECGVYTQMRGIEQVRVGRGLQGGGGTP |
Ga0207671_111172352 | 3300025914 | Corn Rhizosphere | MTKARSAALSARSDGLDDVNGGPECGVYTQMRGVEQ |
Ga0207700_101319171 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKARSAALSARSDSLDDVNGGPECGVYTQMRGVEQVSVG |
Ga0207703_107070851 | 3300026035 | Switchgrass Rhizosphere | MTKARSAALSARSDGLDDVNGGPECGVYTQMRGIEQVSVGSALERG |
Ga0207765_1185702 | 3300026819 | Tropical Forest Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGVEQVRVRRRFQRGG |
Ga0207758_10124872 | 3300026895 | Tropical Forest Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGVEQVRVRRR |
Ga0207946_1003052 | 3300027108 | Forest Soil | MTKARSAALSARSDGLDDINGGPECGVYTQMCGIEQVSVGSGLERRGA |
Ga0209215_10492681 | 3300027266 | Forest Soil | MTKTPLTAPSARSNSLDDIDGGPERGVYTQMRGVEQVRVWRGFQR |
Ga0208241_10121941 | 3300027297 | Forest Soil | MTKARSAALTARSDGFDDIDGSPECRVYTQMRGVEQVRIRRELERRGGAQAESG |
Ga0209115_10780742 | 3300027567 | Forest Soil | MTKALSTTLSARSNGLNDIDGGPERRVYTQMRGIEQVCVRGLH |
Ga0208827_10981471 | 3300027641 | Peatlands Soil | MTKALSTALSAHSDGFDDIDGGPERGVYTQMRGIEQVR |
Ga0209581_11530441 | 3300027706 | Surface Soil | MTKARSAAPSARSDSFDDLDGSPECGVYTQMRGVEQVRIGRRLER |
Ga0209038_102179131 | 3300027737 | Bog Forest Soil | MTKAPSTALSARSDGLDDCDGGPECGVYTQMRGIEQVRV |
Ga0209068_107427242 | 3300027894 | Watersheds | MTKALSAALSARSDGFDDIDGSPECRVYTQMRCIEQVRVRRGF |
Ga0302225_103763522 | 3300028780 | Palsa | MTKARSAALSARSDGFDDFDSGPECGVYIQMRGIEQVCIGSQFQGRG |
Ga0307503_102371972 | 3300028802 | Soil | MTDARSAAHPACSDGFDNVDGGPECGVYIQMRGVEQVCFRGRS |
Ga0302228_104872212 | 3300028808 | Palsa | MTKTLLTALSARSNCLDDIDGRPERRVYTQMRGIEQVRVGRGQQRGRGSP |
Ga0307296_108157152 | 3300028819 | Soil | MTGARSAAHPACSDGFDNVDGGPERRVYTQTRGIEQVGVG |
Ga0307300_103559752 | 3300028880 | Soil | MTGARSAAHPACSDGFDNVDGGPERRVYTQTRGIEQVGVGRGFQR |
Ga0308309_116126821 | 3300028906 | Soil | MTKTRSIALSARSGGLDDINGGPERRVYTQMGRVEQVRIGSGFEGGRGTPGVAF |
Ga0311355_105466782 | 3300030580 | Palsa | MTKARSAALSARSDGFDDFDSGPECGVYIQMRGIEQVRIGS |
Ga0170820_120293212 | 3300031446 | Forest Soil | MTKARSAALSARSDGLDDINGGPECGVYTQMRGIEQVS |
Ga0170820_138305802 | 3300031446 | Forest Soil | MTKALSLALSARSDGFDDVDGSPECGVYTQMRGIEQVRV |
Ga0302326_125828071 | 3300031525 | Palsa | MTKALSTSLSARSNGLDDIDGCPEFGVYTQMRGIEQVCVGRGHQRGGG |
Ga0318534_105023142 | 3300031544 | Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQVRGIEQVRIVRAPKRRD |
Ga0318541_102164892 | 3300031545 | Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGVE |
Ga0318541_104904431 | 3300031545 | Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGIEQVHI |
Ga0318528_101686651 | 3300031561 | Soil | MTETRSAAFPACSDGFDDVDGGPERGVYIQMRGVEQVRI |
Ga0318542_100989641 | 3300031668 | Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQVRGIEQ |
Ga0318561_102034532 | 3300031679 | Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGIEQVRIRRRFQ |
Ga0307474_101014001 | 3300031718 | Hardwood Forest Soil | MTKALSLALSARSDGFDDVDGSPECGVYTQMRGIEQV |
Ga0318493_108030211 | 3300031723 | Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQVRGIEQV |
Ga0318492_107110421 | 3300031748 | Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGVEQVRVRRRFQRG |
Ga0318537_100405512 | 3300031763 | Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGIEQVRV |
Ga0318543_101405102 | 3300031777 | Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGIEQVRI |
Ga0318548_100815511 | 3300031793 | Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQVRGIEQVRIVRAP |
Ga0307478_105156002 | 3300031823 | Hardwood Forest Soil | MTKTRSIALSARSGSLDDINGGPERRVYTQMGGVEQVRIGSGFEGGRGTP |
Ga0306925_116897092 | 3300031890 | Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGIEQVR |
Ga0310912_103440502 | 3300031941 | Soil | MTKTRSAAFPACSDGFDDVDGGPERGVYIQMRGVEQVRI |
Ga0310910_100355234 | 3300031946 | Soil | MTKTPLTAPSARSNSLDNIDGGPERGVYTQMRGVEQVRVRRRFQRGRG |
Ga0306926_104656111 | 3300031954 | Soil | LSSKTKARSAVLSACSDGFDNVEGGPECGVYIQMRGVEQVRVG |
Ga0306926_118666262 | 3300031954 | Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQVRGIEQVRI |
Ga0318507_104712352 | 3300032025 | Soil | MTKSRSAALSARSDGFDDVDGSPERGVYTQMRGIEQVRVGRGLQGSGGA |
Ga0318558_102325081 | 3300032044 | Soil | MTKTPLTAPSARSNSLDNIDGGPERRVYTQMRGIEQVRVRRRFQWGRTAP |
Ga0318513_102868202 | 3300032065 | Soil | MTEARSAALPACSDGFDDVDGGPECGVYIQVRGIEQVRIVRAPERRGGT |
Ga0318514_101674272 | 3300032066 | Soil | MTETRSAAFPACSDGFDDVDGGPERGVYIQMRGVEQVRIR |
Ga0318514_107237851 | 3300032066 | Soil | VRSAALSACSDGFDNVEGGPECGVYIQMRCVEQVRVGRR |
Ga0348332_101139851 | 3300032515 | Plant Litter | MTKARSAALSARSDGFDDVDGSPECGVYTQMRGIEQVRVGR |
Ga0335080_114012212 | 3300032828 | Soil | MTEARLAALPARSDGLDDVNGGPERGVYTQMRGIEQVRVGRRFERRY |
Ga0335075_113387541 | 3300032896 | Soil | MTKARLAALSARSDGLDDFDSGPECGVYIQMRSVEQVC |
Ga0370483_0277208_470_574 | 3300034124 | Untreated Peat Soil | MTKALLTALSARSDGLDDIDSGPECGVYTQMRGIE |
Ga0370515_0043541_16_147 | 3300034163 | Untreated Peat Soil | MTKARSAALSARSDGLDDFDSGPECGVYIQMRGIEQVCIGSQF |
Ga0370515_0389256_446_586 | 3300034163 | Untreated Peat Soil | MTKARSTTPSARSGSLDDINGGPERRVYTQMGGVEQVRIGSGFEGGR |
⦗Top⦘ |