Basic Information | |
---|---|
Family ID | F066117 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 50 residues |
Representative Sequence | DQTARYLDSALSERLAEAVSCSQEDRLKRRYSKLRSFGRWGTL |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.13 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.764 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (11.811 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.181 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.441 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF00436 | SSB | 50.39 |
PF00919 | UPF0004 | 7.87 |
PF04055 | Radical_SAM | 5.51 |
PF00675 | Peptidase_M16 | 3.94 |
PF05193 | Peptidase_M16_C | 2.36 |
PF05139 | Erythro_esteras | 2.36 |
PF08388 | GIIM | 1.57 |
PF01844 | HNH | 1.57 |
PF01938 | TRAM | 0.79 |
PF01656 | CbiA | 0.79 |
PF13655 | RVT_N | 0.79 |
PF00300 | His_Phos_1 | 0.79 |
PF02401 | LYTB | 0.79 |
PF13360 | PQQ_2 | 0.79 |
PF13278 | Obsolete Pfam Family | 0.79 |
PF01872 | RibD_C | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 50.39 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 50.39 |
COG0621 | tRNA A37 methylthiotransferase MiaB | Translation, ribosomal structure and biogenesis [J] | 7.87 |
COG2312 | Erythromycin esterase homolog | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.36 |
COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.57 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.79 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.76 % |
Unclassified | root | N/A | 10.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886012|MBSR1b_contig_3898130 | Not Available | 1457 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c1846601 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100353705 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300000789|JGI1027J11758_12077290 | Not Available | 929 | Open in IMG/M |
3300003267|soilL1_10054102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
3300003267|soilL1_10108166 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
3300004020|Ga0055440_10009114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1750 | Open in IMG/M |
3300004479|Ga0062595_100418362 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300005293|Ga0065715_10871548 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005328|Ga0070676_10585299 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300005328|Ga0070676_10740224 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005328|Ga0070676_11610614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Alcanivorax → Alcanivorax hongdengensis | 502 | Open in IMG/M |
3300005331|Ga0070670_100381563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1242 | Open in IMG/M |
3300005331|Ga0070670_100726871 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300005331|Ga0070670_100903502 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300005331|Ga0070670_102118259 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005344|Ga0070661_101328210 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005345|Ga0070692_11209395 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300005354|Ga0070675_100221964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1646 | Open in IMG/M |
3300005355|Ga0070671_101501337 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005364|Ga0070673_101018426 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300005364|Ga0070673_101693512 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300005438|Ga0070701_10346320 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300005441|Ga0070700_100221421 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
3300005444|Ga0070694_100620157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
3300005467|Ga0070706_100868256 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300005518|Ga0070699_100907177 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300005518|Ga0070699_100944657 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300005530|Ga0070679_100479594 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300005544|Ga0070686_100733130 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300005545|Ga0070695_101332150 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300005546|Ga0070696_100294191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
3300005546|Ga0070696_100810126 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300005546|Ga0070696_101246270 | Not Available | 630 | Open in IMG/M |
3300005546|Ga0070696_101296053 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005547|Ga0070693_100816024 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300005563|Ga0068855_101163323 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300005615|Ga0070702_101216263 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300005617|Ga0068859_100550029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
3300005617|Ga0068859_100850088 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300005617|Ga0068859_101589037 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 722 | Open in IMG/M |
3300005617|Ga0068859_102326594 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005617|Ga0068859_102347283 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005618|Ga0068864_100742203 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300005618|Ga0068864_102381068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300005887|Ga0075292_1036798 | Not Available | 685 | Open in IMG/M |
3300005985|Ga0081539_10157237 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300006169|Ga0082029_1534001 | Not Available | 515 | Open in IMG/M |
3300006846|Ga0075430_101408986 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300006847|Ga0075431_100389831 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300006854|Ga0075425_101373491 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300006871|Ga0075434_100079994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3265 | Open in IMG/M |
3300006871|Ga0075434_100803335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300006880|Ga0075429_101590150 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300006881|Ga0068865_101670226 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300006894|Ga0079215_10477567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 768 | Open in IMG/M |
3300006894|Ga0079215_10629842 | Not Available | 707 | Open in IMG/M |
3300006904|Ga0075424_100052243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 4271 | Open in IMG/M |
3300006904|Ga0075424_100679274 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300006918|Ga0079216_11494792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
3300006969|Ga0075419_10088363 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
3300007004|Ga0079218_10547345 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300009088|Ga0099830_10418026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1086 | Open in IMG/M |
3300009147|Ga0114129_13195791 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300009174|Ga0105241_10204754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1650 | Open in IMG/M |
3300009176|Ga0105242_10143717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2073 | Open in IMG/M |
3300009176|Ga0105242_11119485 | Not Available | 802 | Open in IMG/M |
3300009176|Ga0105242_12033514 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300009177|Ga0105248_10462371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1430 | Open in IMG/M |
3300009177|Ga0105248_11617859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
3300009177|Ga0105248_12135715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300009545|Ga0105237_10156884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2273 | Open in IMG/M |
3300009545|Ga0105237_10324026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1544 | Open in IMG/M |
3300009551|Ga0105238_11365511 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300010040|Ga0126308_10801655 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300010046|Ga0126384_12429978 | Not Available | 508 | Open in IMG/M |
3300010360|Ga0126372_10409533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1241 | Open in IMG/M |
3300010375|Ga0105239_13034329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300010397|Ga0134124_10102382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2494 | Open in IMG/M |
3300010397|Ga0134124_10899435 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300010399|Ga0134127_10715431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1043 | Open in IMG/M |
3300011333|Ga0127502_10308283 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300012045|Ga0136623_10477956 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300012199|Ga0137383_11064771 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300012211|Ga0137377_11359649 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300012353|Ga0137367_10566691 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300012469|Ga0150984_117785459 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012918|Ga0137396_10017599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4523 | Open in IMG/M |
3300012922|Ga0137394_10856984 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300012929|Ga0137404_12212330 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300012958|Ga0164299_11199059 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300012989|Ga0164305_12219544 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300013100|Ga0157373_11033867 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300013306|Ga0163162_12896784 | Not Available | 552 | Open in IMG/M |
3300013306|Ga0163162_13248169 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300013307|Ga0157372_11182692 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300014873|Ga0180066_1045594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 859 | Open in IMG/M |
3300014968|Ga0157379_11049886 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300015085|Ga0167632_1010945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1279 | Open in IMG/M |
3300015264|Ga0137403_11051132 | Not Available | 661 | Open in IMG/M |
3300015371|Ga0132258_10218772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 4633 | Open in IMG/M |
3300015371|Ga0132258_11244439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1881 | Open in IMG/M |
3300015371|Ga0132258_13523689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
3300015372|Ga0132256_101272450 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300015373|Ga0132257_103842530 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300017789|Ga0136617_10076934 | All Organisms → cellular organisms → Bacteria | 2912 | Open in IMG/M |
3300018422|Ga0190265_10260492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1786 | Open in IMG/M |
3300021344|Ga0193719_10120253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1141 | Open in IMG/M |
3300025313|Ga0209431_10279544 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300025907|Ga0207645_10404429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 918 | Open in IMG/M |
3300025917|Ga0207660_10505948 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300025921|Ga0207652_10352915 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300025922|Ga0207646_11938696 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300025934|Ga0207686_10086726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2057 | Open in IMG/M |
3300025934|Ga0207686_11770107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300025938|Ga0207704_11552439 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
3300025960|Ga0207651_10442998 | Not Available | 1113 | Open in IMG/M |
3300026095|Ga0207676_11278522 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300026116|Ga0207674_10997043 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300027907|Ga0207428_10887123 | Not Available | 630 | Open in IMG/M |
3300030511|Ga0268241_10134974 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300031548|Ga0307408_100735387 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300031716|Ga0310813_10356387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1248 | Open in IMG/M |
3300031903|Ga0307407_10070432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2079 | Open in IMG/M |
3300032002|Ga0307416_103327432 | Not Available | 538 | Open in IMG/M |
3300032180|Ga0307471_103105355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Herbidospora → Herbidospora mongoliensis | 589 | Open in IMG/M |
3300032211|Ga0310896_10204857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 973 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.66% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.30% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.15% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.36% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.36% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.36% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.57% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.57% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.79% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.79% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.79% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.79% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.79% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.79% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.79% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MBSR1b_0098.00007290 | 2162886012 | Miscanthus Rhizosphere | GAHNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYTKLRRFGRWGIDGKDSQ |
ICChiseqgaiiDRAFT_18466011 | 3300000033 | Soil | AHTDYDQAARFLXSALSERLAEAVSSSQEARLERRYAKLRQFGRWGTA* |
INPhiseqgaiiFebDRAFT_1003537053 | 3300000364 | Soil | HTDYDQAARFLDSALSERLAEAVSCSQEVRLAKRYAKLRQFGRWGTA* |
JGI1027J11758_120772901 | 3300000789 | Soil | HAAAARFLDAALTRQLAEAVSLSQDDRLNRRFVKLRKFGRWGTTPS* |
soilL1_100541021 | 3300003267 | Sugarcane Root And Bulk Soil | DGGAHNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYNKLRRFGRWGVDGKDS* |
soilL1_101081661 | 3300003267 | Sugarcane Root And Bulk Soil | HNDYDQTARYLDSALSERLAEAVSCSPEDRLSRRYSKLRGFGRWGTSDTATAES* |
Ga0055440_100091143 | 3300004020 | Natural And Restored Wetlands | LSERLAEAVSCTQEERLSRRYRKLRQFGRWGTADKEAGPTPA* |
Ga0062595_1004183623 | 3300004479 | Soil | LSEQLAEAVSCSQEERLSRRYSKLRHFGRWGTADKETGSQPSA* |
Ga0065715_108715481 | 3300005293 | Miscanthus Rhizosphere | HNDYDQTARFLDSALSERLAEAVSCSQEDRLSRRYSKLRRFGRWGTADQNGISSSPKSG* |
Ga0070676_105852993 | 3300005328 | Miscanthus Rhizosphere | DSALSERLAEAVSCSQEERLTRRYDKLRHFGRWGTADKETDPTANN* |
Ga0070676_107402241 | 3300005328 | Miscanthus Rhizosphere | TDYDRAARYLDSALSERLAEAVSCSQEERLAKRYAKLRLFGRWGGE* |
Ga0070676_116106141 | 3300005328 | Miscanthus Rhizosphere | NDYEKTARYLDSALSERLAEAVSCTQEERLSRRYAKLRQFGRWGTADPA* |
Ga0070670_1003815631 | 3300005331 | Switchgrass Rhizosphere | EGGAHNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYNKLRGFGRWGVDGK* |
Ga0070670_1007268711 | 3300005331 | Switchgrass Rhizosphere | RFLDSALTERLAEAASCSQEERLARRHSKLRQFGRWGSD* |
Ga0070670_1009035022 | 3300005331 | Switchgrass Rhizosphere | TARFLDSALSERLAEAVSCSQEDRLKRRYSKLRGFGRWGVDGKDS* |
Ga0070670_1021182592 | 3300005331 | Switchgrass Rhizosphere | AARYLDVALTERLAEAVSCSQDERLARRYNKLRDFGRWGTA* |
Ga0070661_1013282101 | 3300005344 | Corn Rhizosphere | RYLDSALSEQLAEAVSCSQEERLSRRYSKLRHFGRWGTADKETDPQPSA* |
Ga0070692_112093952 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LDSALSERLAEAVSCSPEERLSRRYSKLRHFGRWGTANEGAAPTPTS* |
Ga0070675_1002219643 | 3300005354 | Miscanthus Rhizosphere | ARYLDSALSERLAEAVSCSQEERLSRRYSKLRHFGRWGTAGKEARPTPAS* |
Ga0070671_1015013371 | 3300005355 | Switchgrass Rhizosphere | HNDYDQTARYLDSALSERLAEAVSCSTEDRLSRRYTKLRGFGRWGTSDAPVG* |
Ga0070673_1010184262 | 3300005364 | Switchgrass Rhizosphere | GAHNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYNKLRRFGRWGVEGKDS* |
Ga0070673_1016935121 | 3300005364 | Switchgrass Rhizosphere | DAALTERLAEAVSCSQQERLSRRYDKLRHFGRWGTAENVAPTPAP* |
Ga0070701_103463201 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | NDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYNKLRGFGRWGTDGKDAGPTKA* |
Ga0070700_1002214212 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | PEGGAHNDYDQTARFLDSALSERLAEAVSCSQEDRLKRRYNKLRNFGRWGTL* |
Ga0070694_1006201571 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | HNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYSKLRGFGRWGVDGKDS* |
Ga0070706_1008682561 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SALSERLAEAVSCTQDERLGRRYNKLRHFGRWGVLDNQGNPRPAT* |
Ga0070699_1009071771 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GAHNDYDQSARYLDSALSEQLAEAVSCSQEERLSRRYSKLRRFGRWGTADKEAGPQTST* |
Ga0070699_1009446572 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | QAARYLDAALAERLAEAVSCSQDERLSRRYAKLRQFGRWGTT* |
Ga0070679_1004795942 | 3300005530 | Corn Rhizosphere | HNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYDKLRAFGRWGTDGKDTGPTPPQG* |
Ga0070686_1007331302 | 3300005544 | Switchgrass Rhizosphere | YDQSARYLDSALSERLAEAVSCSQEERLSRRYSKLRHFGRWGTAGKEARPTPAS* |
Ga0070695_1013321501 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TERLAEAVSCSQQERLSRRYDKLRQFGRWGTAETAGPTPAS* |
Ga0070696_1002941913 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EQLAEAVSCSQEERLSRRYSKLRHFGRWGTADKETGPQPSA* |
Ga0070696_1008101262 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GAHTDYDQAARYLDAALTERLAEAVSCSQDERLTRRYQKLRAFGRWGTA* |
Ga0070696_1012462702 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | YDQAAHYLDVALTERLAEAVSCSQDERLARRYNKLRDFGRWGTA* |
Ga0070696_1012960532 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAHNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYNKLRGFGRWGTDAKDTGPA* |
Ga0070693_1008160241 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RYLDSALSERLAEAVSCSQEERLSRRYSKLRRFGRWGTADKKAGPQPST* |
Ga0068855_1011633231 | 3300005563 | Corn Rhizosphere | DYDQTARYLDSALSERLAEAVSQSQEDRLKRRYTKLRGFGRWGTDGKDASST* |
Ga0070702_1012162632 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEAVSCSQEDRLTRRYSKLRHFGRWGTADEATGATPTS* |
Ga0068859_1005500293 | 3300005617 | Switchgrass Rhizosphere | TARYLDSALSERLAEAVSCSQEDRLSRRYSKLRHFGRWGTAENTNP* |
Ga0068859_1008500881 | 3300005617 | Switchgrass Rhizosphere | DYDQTARYLDSALSERLAEAVSCSQEDRLKRRYNKLRGFGRWGVDGK* |
Ga0068859_1015890371 | 3300005617 | Switchgrass Rhizosphere | HNDYDQTARYLDSALSERLAEAVSCSPEDRLSRRYSKLRGFGRWGTTEGAAPAG* |
Ga0068859_1023265941 | 3300005617 | Switchgrass Rhizosphere | YDQTARYLDSALSERLAEAVSCSQEDRLKRRYTKLRGFGRWGTV* |
Ga0068859_1023472832 | 3300005617 | Switchgrass Rhizosphere | HNDYDQSARYLDSALTEQLAEAVSCSQEERLSRRYSKLRHFGRWGTADEDAAPRPTS* |
Ga0068864_1007422032 | 3300005618 | Switchgrass Rhizosphere | GAHNDYDQTARFLDSALSERLAEAVSCSQEDRLKRRYSKLRGFGRWGTA* |
Ga0068864_1023810681 | 3300005618 | Switchgrass Rhizosphere | DQTARYLDSALSERLAEAVSCSQEDRLKRRYGKLRGYGRWGTDGKD* |
Ga0075292_10367981 | 3300005887 | Rice Paddy Soil | TARFLDSALSERLAEAVSCSQEDRLKRRYNKLRCFGRWGVAGKDT* |
Ga0081539_101572371 | 3300005985 | Tabebuia Heterophylla Rhizosphere | QTARYLDSALSERLAEAVSCSQEDRLTRRYSKLRRFGRWGTDGKNGE* |
Ga0082029_15340012 | 3300006169 | Termite Nest | EGGAHNDYDQTARYLDSALSERLAEAVSCSAEDRLSRRYSKLRSFGRWGTNDATAPDR* |
Ga0075430_1014089862 | 3300006846 | Populus Rhizosphere | DSALSERLAEAVSCSQEDRLTRRYSKLRHFGRWGTDGKDTNPTPPIS* |
Ga0075431_1003898313 | 3300006847 | Populus Rhizosphere | GAHNDYDQTARLLDSALSERLAEAVSCSQEDRLSRRYSKLRHFGRWGTDGHDTAHKAQDD |
Ga0075425_1013734912 | 3300006854 | Populus Rhizosphere | AHNDYDQTARYLDSALSERLAEAVSCSQEDRLSRRYSKLRRFGRWGTDGKDAGPTPSGS* |
Ga0075434_1000799941 | 3300006871 | Populus Rhizosphere | SARYLDSALSEQLAEAVSCSQEERLSRRYSKLRHFGRWGTADKETGSQPSA* |
Ga0075434_1008033353 | 3300006871 | Populus Rhizosphere | LSERLAEAVSCSQEERLSRRYSKLRRFGRWGTENSGPTPSK* |
Ga0075429_1015901501 | 3300006880 | Populus Rhizosphere | ALSERLAEAVSCSQEERLTRRYSKLRHFGRWGTADKETDPTPSS* |
Ga0068865_1016702261 | 3300006881 | Miscanthus Rhizosphere | AALTERLAEAVSCSQQERLSRRYDKLRHFGRWGTAENVAPTPAP* |
Ga0079215_104775672 | 3300006894 | Agricultural Soil | RFLDAALTERLAEAVSCSPEERLTRRYKKLREFGRWGTADATT* |
Ga0079215_106298421 | 3300006894 | Agricultural Soil | DYDQTARYLDSALTERLAEAVSCSTDDRLSRRYQKLRGFGRWGTSDSSTPDN* |
Ga0075424_1000522436 | 3300006904 | Populus Rhizosphere | LDSALSEQLAEAVSCSQEERLSRRYSKLRHFGRWGTADKETGPQPSA* |
Ga0075424_1006792741 | 3300006904 | Populus Rhizosphere | AHNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYDKLRAFGRWGTDGEDTGPTAPAG* |
Ga0079216_114947921 | 3300006918 | Agricultural Soil | RFLDSALSERLAEAVSCSQEDRLKRRYSKLRGFGRWGTDESQRAKEV* |
Ga0075419_100883631 | 3300006969 | Populus Rhizosphere | HNDYDQTARYLDSALSERLAEAVSCSQEDRLSRRYSKLRGFGRWGTDGHDTSQNP* |
Ga0079218_105473453 | 3300007004 | Agricultural Soil | DYDQTARFLDSALSERLAEAVSCSQEDRLSRRYSKLRHFGRWGTDGKDTRPTPA* |
Ga0099830_104180263 | 3300009088 | Vadose Zone Soil | TARYLDSALSERLAEAVSCTQDERLVRRYNKLRHFGRWGTAGNEVQPTPTA* |
Ga0114129_131957911 | 3300009147 | Populus Rhizosphere | LSERLAEACSISQEDRLKRRYDKLRSFGRWGTDGKDTGPTPPAG* |
Ga0105241_102047541 | 3300009174 | Corn Rhizosphere | EGGAHNDYDQTARYLDSALSERLAEAVSQSQEDRLKRRYSKLRGFGRWGTEGKDASPT* |
Ga0105242_101437171 | 3300009176 | Miscanthus Rhizosphere | DYDQSARYLDSALSERLAEAVSCSQEERLSRRYSKLRHFGRWGTAGKEARPTPAS* |
Ga0105242_111194852 | 3300009176 | Miscanthus Rhizosphere | GGAHTDYDQAARLLDAALTERLAEAVSCSQDQRLARRYNKLREFGRWGNSDSSSK* |
Ga0105242_120335141 | 3300009176 | Miscanthus Rhizosphere | EQTARYLDSALSERLAAAVSCSQEDRLKRRYDKLRAFGRWGTAGKDTSPTPPAG* |
Ga0105248_104623711 | 3300009177 | Switchgrass Rhizosphere | DYDQTARYLDSALSERLAEAVSCSQEDRLKRRYDKLRAFGRWGTDGKDTGPTPPVG* |
Ga0105248_116178591 | 3300009177 | Switchgrass Rhizosphere | NDYDQTARYLDSALTERLAEAVSCSQDDRLSRRYSKLRHFGRWGSAHSETSS* |
Ga0105248_121357152 | 3300009177 | Switchgrass Rhizosphere | YDQTARYLDAALSERLAEAVSVSLEDRLKRRYNKLRSFGRWGTDVKDAGST* |
Ga0105237_101568841 | 3300009545 | Corn Rhizosphere | NDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYSKLRSFGRWGTL* |
Ga0105237_103240261 | 3300009545 | Corn Rhizosphere | RYLDSALSERLAETVSCSQEDRLKRRYSKLRGFGRWGTDGKDEPQRSTDV* |
Ga0105238_113655111 | 3300009551 | Corn Rhizosphere | GGAHNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYSKLRHFGRWGVDGQDSK* |
Ga0126308_108016552 | 3300010040 | Serpentine Soil | YDQTAGFLDSALSERLAEAVSCSQEDRLARRYSKLRHFGRWGTADQVDEAAGN* |
Ga0126384_124299781 | 3300010046 | Tropical Forest Soil | DSALSERLAEAVSCSLEDRLKRRYTKLRSFGRWGTDGKGTSPT* |
Ga0126372_104095333 | 3300010360 | Tropical Forest Soil | ERLAEAVSCSDEERLERRYRKLRDFGRWGTADKGAAPTP* |
Ga0105239_130343292 | 3300010375 | Corn Rhizosphere | YDQTARYLDSALSERLAEAVSCSQEDRLKRRYGKLRGYGRWGTDGKD* |
Ga0134124_101023823 | 3300010397 | Terrestrial Soil | ARYLDSALSERLAEAVSCSQEDRLKRRYSKLRGFGRWGTS* |
Ga0134124_108994351 | 3300010397 | Terrestrial Soil | NDYDRTARYLDAALSERLAEAVSCSQQERLSRRYDKLRQFGRWGTAETAGPTPAS* |
Ga0134127_107154311 | 3300010399 | Terrestrial Soil | ERLAEAVSCSQQERLSRRYDKLRHFGRWGTAENVAPTPAP* |
Ga0127502_103082832 | 3300011333 | Soil | RLAEAVSCSQEDRLSRRYAKLRRFGRWGSSDKSEAAPDG* |
Ga0136623_104779562 | 3300012045 | Polar Desert Sand | DYDRAARFLDSALSERLAEAVSSSQEVRLAKRYAKLRQFGRWGTA* |
Ga0137383_110647712 | 3300012199 | Vadose Zone Soil | RYLDSALSERLAEAVSCTQDERLVRRYNKLRHFGRWGTAENEVQPTPTA* |
Ga0137377_113596492 | 3300012211 | Vadose Zone Soil | NDYDQTARYLDSALSERLAEAVSCTQDERLGRRYNKLRHFGRWGVMDNPGNPRSAT* |
Ga0137367_105666911 | 3300012353 | Vadose Zone Soil | AARYLDAALAERLAEAVSCSQDERLARRYMKLRQFGRWGTA* |
Ga0150984_1177854591 | 3300012469 | Avena Fatua Rhizosphere | LDYDQAGRYLDSALSERLAEAVSCSQEERLSRRYSKLRQFGRWGTDDKETGPTPTA* |
Ga0137396_100175997 | 3300012918 | Vadose Zone Soil | QTARYLDSALSERLAEAVSCTQDERLGRRYNKLRHFGRWGVMDNQGNPTPAT* |
Ga0137394_108569841 | 3300012922 | Vadose Zone Soil | DYDQTARYLDSALSERLAEAVSCTQDERLGRRYNKLRHFGRWGVMDSQGNPTPAT* |
Ga0137404_122123301 | 3300012929 | Vadose Zone Soil | DQAARLLDAALTERLAEAVSCSQDERLARRYNKLRGFGRWGTA* |
Ga0164299_111990591 | 3300012958 | Soil | YLDSALSERLAEAVSCSQDERLSRRYSKLRHFGRWGTAGKEAGPTPAS* |
Ga0164305_122195442 | 3300012989 | Soil | DRTARYLDAALSERLAEAVSCSQQERLSRRYDKLRQFGRWGTAETAGPTPAS* |
Ga0157373_110338671 | 3300013100 | Corn Rhizosphere | TARYLDSALSERLAEAVSCSQEDRLKRRYNKLRRFGRWGVEGKVTG* |
Ga0163162_128967841 | 3300013306 | Switchgrass Rhizosphere | QTARYLDSALSERLAEAVSCSQEDRLKRRYSKLRSFGRWGTL* |
Ga0163162_132481691 | 3300013306 | Switchgrass Rhizosphere | YLDSALSERLAEAVSCSQEDRLKRRYAKLRAFGRWGTDGKDTGPTPPAD* |
Ga0157372_111826923 | 3300013307 | Corn Rhizosphere | HNDYDQTARFLDSALSERLAEAVSCSQEERLTRRYDKLRHFGRWGTADKKTDPTANN* |
Ga0180066_10455943 | 3300014873 | Soil | ARFLDAALTERLAEAASSTQEERLARRHSKLRQFGRWGSD* |
Ga0157379_110498861 | 3300014968 | Switchgrass Rhizosphere | NDYEQTARYLDSALSERLAEAVSCSQEDRLKRRYAKLRAFGRWGTDGKDTGPTPPAG* |
Ga0167632_10109451 | 3300015085 | Glacier Forefield Soil | AHTDYDQTAHYLDSALSERLAEAVSCGQQERLAKRYSKLRQFGRWGVA* |
Ga0137403_110511321 | 3300015264 | Vadose Zone Soil | YAQAARFLDAALAERLAEAVSCSQDERLTRRYKKLREFGRWGTA* |
Ga0132258_102187727 | 3300015371 | Arabidopsis Rhizosphere | GAHNDYDQSARYLDSALSEQLAEAVSCSQEERLSRRYSKLRHFGRWGTADKETGSQPSA* |
Ga0132258_112444391 | 3300015371 | Arabidopsis Rhizosphere | SALSERLAEAVSCSQEDRLSRRYSKLRGFGRWGTDGKDAGPTPSGS* |
Ga0132258_135236892 | 3300015371 | Arabidopsis Rhizosphere | HNDYDQTARYLDSALSERLAEAVSQSQEDRLKRRYTKLRGFGRWGTDGKDASST* |
Ga0132256_1012724501 | 3300015372 | Arabidopsis Rhizosphere | NDYDQSARYLDSALTEQLAEAVSCSQEERLSRRYSKLRHFGRWGTADKETGPPPSA* |
Ga0132257_1038425301 | 3300015373 | Arabidopsis Rhizosphere | YDRTARYLDAALSERLAEAVSCSQQERLSRRYDKLRQFGRWGTAETTGPTPAS* |
Ga0136617_100769341 | 3300017789 | Polar Desert Sand | TDYDQAARLLDSALSERLAEAVSCTQEVRLAKRYAKLRQFGRWGTA |
Ga0190265_102604923 | 3300018422 | Soil | GGAHNDYDQTARYLDSALSERLAEAVSCSQEDRLSRRYSKLRGFGRWGTDGHADAHEQQTIS |
Ga0193719_101202533 | 3300021344 | Soil | YLDSALSERLAEAVSCTQDERLGRRYNKLRHFGRWGVMDSQGNPRPAT |
Ga0209431_102795443 | 3300025313 | Soil | AHTNYDQTARYLDSALSKKLAEAVSCSQDERLARRYAKLRQFGRWELEDSFAGPASGE |
Ga0207645_104044291 | 3300025907 | Miscanthus Rhizosphere | RFLDSALSERLAEAVSCSQEERLTRRYDKLRHFGRWGTADKETDPTANN |
Ga0207660_105059481 | 3300025917 | Corn Rhizosphere | DGGAHNDYDQTARYLDAALTERLAEAVSCSQQERLSRRYDKHRQFGRWGTAETAGPTPAS |
Ga0207652_103529151 | 3300025921 | Corn Rhizosphere | GAHNDYDQTARYLDSALSERLAEAVSCSQEDRLKRRYDKLRAFGRWGTDGKDTGPTPPQG |
Ga0207646_119386961 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | NDYDRTARYLDAALSERLAEAVSCSQQERLSRRYDKLRQFGRWGTAETAGPTPAS |
Ga0207686_100867261 | 3300025934 | Miscanthus Rhizosphere | DYDQSARYLDSALSERLAEAVSCSQEERLSRRYSKLRHFGRWGTAGKEARPTPAS |
Ga0207686_117701071 | 3300025934 | Miscanthus Rhizosphere | DQTARYLDSALSERLAEAVSCSQEDRLKRRYSKLRSFGRWGTL |
Ga0207704_115524392 | 3300025938 | Miscanthus Rhizosphere | AARLLDAALTERLAEAVSCSQDERLARRYNKLRDFGRWGTS |
Ga0207651_104429981 | 3300025960 | Switchgrass Rhizosphere | TDYDQAARLLDAALTERLAEAVSCSQDERLARRYNKLRDFGRWGTS |
Ga0207676_112785221 | 3300026095 | Switchgrass Rhizosphere | QTARYLDSALSERLAEAVSCSQDDRLTRRYSKLRQFGRWGTADKESGPTPTA |
Ga0207674_109970432 | 3300026116 | Corn Rhizosphere | RFLDSALSERLAEAVSCSQEDRLKRRYSKLRGFGRWGVDGKDS |
Ga0207428_108871231 | 3300027907 | Populus Rhizosphere | LDSALSERLAEAVSCSQEDRLTRRYSKLRRFGRWGTDVKDGNPTPSA |
Ga0268241_101349741 | 3300030511 | Soil | GAHNDYDQTARLLDSALSERLAEAVSCSQEDRLSRRYSKLRRFGRWGSTDQNGISSSDKS |
Ga0307408_1007353872 | 3300031548 | Rhizosphere | DQAARYLDSALSERLAEAVSCSQEDRLRRRYSKLRGFGRWGIDGHESPSNTQKD |
Ga0310813_103563871 | 3300031716 | Soil | HNDYDRTARYLDAALSERLAEAVSCSQQERLSRRYDKLRQFGRWGTAETAGPTPAS |
Ga0307407_100704322 | 3300031903 | Rhizosphere | HNDYDQTARFLDSALSERLAEAVSCSQEDRLKRRYSKLRGFGRWGTEPQKST |
Ga0307416_1033274321 | 3300032002 | Rhizosphere | RYLDSALSERLAEAVSCSQEDRLTRRYSKLRRFGRWGTDGKDGNPTPSA |
Ga0307471_1031053551 | 3300032180 | Hardwood Forest Soil | QTDHDAAARFLDAAMTRQLAEAVRLSQEERLARRYAKLRKFGRWGAE |
Ga0310896_102048573 | 3300032211 | Soil | YLDAALTERLAEAVSCSQQERLSRRYDKLRHFGRWGTAENAAPTPAP |
⦗Top⦘ |