Basic Information | |
---|---|
Family ID | F065714 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 45 residues |
Representative Sequence | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Number of Associated Samples | 81 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 50.39 % |
% of genes near scaffold ends (potentially truncated) | 46.46 % |
% of genes from short scaffolds (< 2000 bps) | 65.35 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (50.394 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (29.921 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.906 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (74.803 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 30.14% β-sheet: 0.00% Coil/Unstructured: 69.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF03807 | F420_oxidored | 23.62 |
PF12089 | DUF3566 | 15.75 |
PF00535 | Glycos_transf_2 | 8.66 |
PF02348 | CTP_transf_3 | 8.66 |
PF03989 | DNA_gyraseA_C | 4.72 |
PF00561 | Abhydrolase_1 | 4.72 |
PF13450 | NAD_binding_8 | 3.94 |
PF03435 | Sacchrp_dh_NADP | 3.94 |
PF05050 | Methyltransf_21 | 3.94 |
PF02826 | 2-Hacid_dh_C | 2.36 |
PF06210 | DUF1003 | 1.57 |
PF13692 | Glyco_trans_1_4 | 0.79 |
PF12697 | Abhydrolase_6 | 0.79 |
PF02096 | 60KD_IMP | 0.79 |
PF02698 | DUF218 | 0.79 |
PF03448 | MgtE_N | 0.79 |
PF01118 | Semialdhyde_dh | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 8.66 |
COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 8.66 |
COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 8.66 |
COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 4.72 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 1.57 |
COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.79 |
COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.39 % |
Unclassified | root | N/A | 49.61 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001843|RCM34_1020308 | Not Available | 582 | Open in IMG/M |
3300001844|RCM35_1109775 | Not Available | 750 | Open in IMG/M |
3300002145|S2t7BSb_11650956 | Not Available | 6546 | Open in IMG/M |
3300002733|codie8draft_1046829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 4062 | Open in IMG/M |
3300005739|Ga0076948_1000410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 109819 | Open in IMG/M |
3300005739|Ga0076948_1004183 | All Organisms → cellular organisms → Bacteria | 12779 | Open in IMG/M |
3300005739|Ga0076948_1007071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 8666 | Open in IMG/M |
3300005739|Ga0076948_1008351 | Not Available | 1631 | Open in IMG/M |
3300005739|Ga0076948_1018230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2200 | Open in IMG/M |
3300005739|Ga0076948_1034552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3317 | Open in IMG/M |
3300005739|Ga0076948_1036393 | Not Available | 1027 | Open in IMG/M |
3300005805|Ga0079957_1009219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7571 | Open in IMG/M |
3300006030|Ga0075470_10014586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2430 | Open in IMG/M |
3300006030|Ga0075470_10181504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
3300006641|Ga0075471_10005669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 7973 | Open in IMG/M |
3300006875|Ga0075473_10024479 | All Organisms → cellular organisms → Bacteria | 2321 | Open in IMG/M |
3300007094|Ga0102532_1014920 | Not Available | 1626 | Open in IMG/M |
3300007212|Ga0103958_1046239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2231 | Open in IMG/M |
3300007214|Ga0103959_1000264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3289 | Open in IMG/M |
3300007363|Ga0075458_10122688 | Not Available | 806 | Open in IMG/M |
3300008072|Ga0110929_1046006 | Not Available | 549 | Open in IMG/M |
3300010293|Ga0116204_1019926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium IMCC26103 | 2760 | Open in IMG/M |
3300010293|Ga0116204_1024347 | Not Available | 2434 | Open in IMG/M |
3300010293|Ga0116204_1160585 | Not Available | 744 | Open in IMG/M |
3300010293|Ga0116204_1224524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
3300010299|Ga0129342_1043500 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300010299|Ga0129342_1228981 | Not Available | 652 | Open in IMG/M |
3300010318|Ga0136656_1291493 | Not Available | 531 | Open in IMG/M |
3300010354|Ga0129333_10122773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 2391 | Open in IMG/M |
3300010354|Ga0129333_10129335 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
3300010354|Ga0129333_10180092 | Not Available | 1929 | Open in IMG/M |
3300010354|Ga0129333_10509684 | Not Available | 1054 | Open in IMG/M |
3300010354|Ga0129333_11217449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
3300010370|Ga0129336_10080430 | Not Available | 1923 | Open in IMG/M |
3300010370|Ga0129336_10248895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 999 | Open in IMG/M |
3300012006|Ga0119955_1157089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300013087|Ga0163212_1212325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
3300013087|Ga0163212_1265700 | Not Available | 532 | Open in IMG/M |
3300013091|Ga0163210_1241910 | Not Available | 635 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1020726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 3038 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1264599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10236280 | Not Available | 1216 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10475558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 765 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10051939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3945 | Open in IMG/M |
3300017788|Ga0169931_10187298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium IMCC26103 | 1788 | Open in IMG/M |
3300017788|Ga0169931_10403830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1009 | Open in IMG/M |
3300017788|Ga0169931_10597093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
3300017788|Ga0169931_10689929 | Not Available | 674 | Open in IMG/M |
3300017788|Ga0169931_10791707 | Not Available | 610 | Open in IMG/M |
3300020074|Ga0194113_10013965 | All Organisms → cellular organisms → Bacteria | 9284 | Open in IMG/M |
3300020074|Ga0194113_10122783 | Not Available | 2216 | Open in IMG/M |
3300020074|Ga0194113_10293614 | Not Available | 1237 | Open in IMG/M |
3300020083|Ga0194111_10698853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
3300020084|Ga0194110_10097528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2442 | Open in IMG/M |
3300020084|Ga0194110_10318478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium IMCC26103 | 1089 | Open in IMG/M |
3300020179|Ga0194134_10014735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5619 | Open in IMG/M |
3300020179|Ga0194134_10046549 | Not Available | 2436 | Open in IMG/M |
3300020179|Ga0194134_10110195 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300020179|Ga0194134_10293975 | Not Available | 644 | Open in IMG/M |
3300020183|Ga0194115_10145126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium IMCC26103 | 1244 | Open in IMG/M |
3300020190|Ga0194118_10095521 | Not Available | 1834 | Open in IMG/M |
3300020193|Ga0194131_10337742 | Not Available | 679 | Open in IMG/M |
3300020197|Ga0194128_10297425 | Not Available | 807 | Open in IMG/M |
3300020200|Ga0194121_10082635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium IMCC26103 | 2180 | Open in IMG/M |
3300020200|Ga0194121_10506780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
3300020204|Ga0194116_10298069 | Not Available | 849 | Open in IMG/M |
3300020204|Ga0194116_10569272 | Not Available | 516 | Open in IMG/M |
3300020214|Ga0194132_10132038 | Not Available | 1521 | Open in IMG/M |
3300020214|Ga0194132_10411427 | Not Available | 687 | Open in IMG/M |
3300020220|Ga0194119_10077199 | Not Available | 2772 | Open in IMG/M |
3300020220|Ga0194119_10536004 | Not Available | 731 | Open in IMG/M |
3300020222|Ga0194125_10027780 | Not Available | 6305 | Open in IMG/M |
3300020222|Ga0194125_10564430 | Not Available | 685 | Open in IMG/M |
3300020499|Ga0208084_1000306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12069 | Open in IMG/M |
3300020557|Ga0208231_1000697 | All Organisms → cellular organisms → Bacteria | 9052 | Open in IMG/M |
3300020578|Ga0194129_10128714 | Not Available | 1666 | Open in IMG/M |
3300020578|Ga0194129_10249100 | Not Available | 1036 | Open in IMG/M |
3300020603|Ga0194126_10083512 | Not Available | 2690 | Open in IMG/M |
3300020603|Ga0194126_10702848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300021092|Ga0194122_10561733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
3300021093|Ga0194123_10050555 | All Organisms → cellular organisms → Bacteria | 2727 | Open in IMG/M |
3300021093|Ga0194123_10199333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium IMCC26103 | 1025 | Open in IMG/M |
3300021093|Ga0194123_10439108 | Not Available | 590 | Open in IMG/M |
3300021376|Ga0194130_10070030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium IMCC26103 | 2394 | Open in IMG/M |
3300021376|Ga0194130_10144752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 1473 | Open in IMG/M |
3300021424|Ga0194117_10184440 | Not Available | 1041 | Open in IMG/M |
3300021961|Ga0222714_10020276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5217 | Open in IMG/M |
3300021961|Ga0222714_10181237 | Not Available | 1232 | Open in IMG/M |
3300022752|Ga0214917_10055023 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
(restricted) 3300023208|Ga0233424_10000414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 55456 | Open in IMG/M |
(restricted) 3300023208|Ga0233424_10016790 | All Organisms → cellular organisms → Bacteria | 3769 | Open in IMG/M |
(restricted) 3300023208|Ga0233424_10025150 | Not Available | 2949 | Open in IMG/M |
(restricted) 3300023208|Ga0233424_10043369 | Not Available | 2116 | Open in IMG/M |
3300024277|Ga0255207_1020468 | Not Available | 1071 | Open in IMG/M |
3300024350|Ga0255167_1035446 | Not Available | 908 | Open in IMG/M |
3300024356|Ga0255169_1009897 | Not Available | 1944 | Open in IMG/M |
3300024356|Ga0255169_1058427 | Not Available | 652 | Open in IMG/M |
3300024491|Ga0255203_1010283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1439 | Open in IMG/M |
3300024498|Ga0255199_1051969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
3300024502|Ga0255181_1086380 | Not Available | 501 | Open in IMG/M |
3300024507|Ga0255176_1013597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 1671 | Open in IMG/M |
3300024512|Ga0255186_1021707 | Not Available | 869 | Open in IMG/M |
3300024572|Ga0255268_1174634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300025145|Ga0209609_10180500 | Not Available | 696 | Open in IMG/M |
3300025279|Ga0208047_1019537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1971 | Open in IMG/M |
3300025283|Ga0208048_1019031 | Not Available | 2111 | Open in IMG/M |
3300025283|Ga0208048_1126108 | Not Available | 519 | Open in IMG/M |
3300025585|Ga0208546_1112606 | Not Available | 602 | Open in IMG/M |
3300025635|Ga0208147_1004000 | All Organisms → cellular organisms → Bacteria | 4343 | Open in IMG/M |
3300025818|Ga0208542_1142665 | Not Available | 657 | Open in IMG/M |
3300027306|Ga0255220_1083427 | Not Available | 595 | Open in IMG/M |
3300027503|Ga0255182_1011096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 2982 | Open in IMG/M |
3300027627|Ga0208942_1091895 | Not Available | 872 | Open in IMG/M |
3300027656|Ga0209357_1001425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9685 | Open in IMG/M |
3300028086|Ga0255201_1059004 | Not Available | 585 | Open in IMG/M |
3300028089|Ga0255299_1100773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300028258|Ga0255214_1038255 | Not Available | 740 | Open in IMG/M |
3300028267|Ga0256358_1053314 | Not Available | 797 | Open in IMG/M |
3300028269|Ga0255193_1034630 | Not Available | 707 | Open in IMG/M |
3300029930|Ga0119944_1019617 | Not Available | 928 | Open in IMG/M |
3300029930|Ga0119944_1026628 | Not Available | 762 | Open in IMG/M |
3300033981|Ga0334982_0046020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 2429 | Open in IMG/M |
3300034018|Ga0334985_0282297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
3300034073|Ga0310130_0194268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
3300034120|Ga0335056_0079427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 2060 | Open in IMG/M |
3300034166|Ga0335016_0515839 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300034682|Ga0310128_030374 | Not Available | 1300 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 29.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.68% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 13.39% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.87% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.30% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 5.51% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 3.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.57% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.57% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.57% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.57% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.57% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.79% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.79% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.79% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.79% |
Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.79% |
Coal-Bed Methane Well | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Coal-Bed Methane Well | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
3300002145 | S2t7BSb (114f) | Environmental | Open in IMG/M |
3300002733 | Coal-bed methane well microbial communities from Surat Basin, Queensland, Australia, Sample - Codie-8 produced water | Environmental | Open in IMG/M |
3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013091 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300020499 | Freshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
3300024277 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d | Environmental | Open in IMG/M |
3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
3300024491 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h | Environmental | Open in IMG/M |
3300024498 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
3300024512 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h | Environmental | Open in IMG/M |
3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025145 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 325m metaG (SPAdes) | Environmental | Open in IMG/M |
3300025279 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m (SPAdes) | Environmental | Open in IMG/M |
3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027306 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8d | Environmental | Open in IMG/M |
3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300028086 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300028089 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028258 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8d | Environmental | Open in IMG/M |
3300028267 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028269 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034682 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-4-A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM34_10203082 | 3300001843 | Marine Plankton | MKLFRRLLLVLSVATAVVGILRVGGGGKSRVTTKQGGWRSY |
RCM35_11097751 | 3300001844 | Marine Plankton | LLVLSVATSVVGILRVGGGGKSRVTTKQGGWRSYSPPK* |
S2t7BSb_116509562 | 3300002145 | Marine | MKLFRRLLLVLSVASAVVGILRFGGGSSKSRVTTKQGGWRTYTPPK* |
codie8draft_10468292 | 3300002733 | Coal-Bed Methane Well | MKLFRRLLLVLSVATAVVGILRFGGSEKSRVTTKQGGWRNYSSPE* |
Ga0076948_1000410101 | 3300005739 | Lake Water | MKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPTK* |
Ga0076948_100418311 | 3300005739 | Lake Water | MKLFRRLLLVLSVATAVVGVLRFGGGGKSRVTTKQGGWRSYTPPK* |
Ga0076948_10070718 | 3300005739 | Lake Water | MKLFRRLLLVLSVATAVLGIIRFGGSGKARVTTKQGGWRNYSPPS* |
Ga0076948_10083513 | 3300005739 | Lake Water | MKLFSRLLLVLSVATAVVGVLRFGGNGKSRVTTKQGGWRSYSPPK* |
Ga0076948_10182302 | 3300005739 | Lake Water | MKLFRRLLLVLSVATAVVGILRVGGGGKQRVTTKQGGWRAYTPPK* |
Ga0076948_10345523 | 3300005739 | Lake Water | MKLFRRLLLVLSVATAVVGILRVGGGGKSRVTTKQGGWRSYSPPK* |
Ga0076948_10363933 | 3300005739 | Lake Water | MKLFRRLLLVLSVATAVVGILRVGGGGKQRVTTKQGGWRAYTPPKSGVS* |
Ga0079957_10092194 | 3300005805 | Lake | MKLFRRLLLVLSVATAVVGILRVGGGGKSRVTTKQGGWRNFSPPQ* |
Ga0075470_100145861 | 3300006030 | Aqueous | MKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPTKG* |
Ga0075470_101815042 | 3300006030 | Aqueous | MKLFRRLLLVLSVASTVVGILRFGGSSKAKVTTKQGGWRSYSPPK* |
Ga0075471_100056692 | 3300006641 | Aqueous | MKLFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWRSVRVDTDFK* |
Ga0075473_100244791 | 3300006875 | Aqueous | MKLFRRLLLVLSVASAVVGILRFGGSSKSKVTTKQGGWRTTRLDNEPQ* |
Ga0102532_10149204 | 3300007094 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRVGGGGKQRVTTKQGGWRPYTPPK* |
Ga0103958_10462391 | 3300007212 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRVGGGGKSRVTTKQGGW |
Ga0103959_10002642 | 3300007214 | Freshwater Lake | VKLFRRLLLVLSVATAVVGIIRFGGSEKSRVTTKQGGWRGFTPPE* |
Ga0075458_101226881 | 3300007363 | Aqueous | RLLLVLSVASTVVGILRFGGSSKAKVTTKQGGWRSYSPPK* |
Ga0110929_10460062 | 3300008072 | Water Bodies | MKLFRRLLLVLSVATAVVGILRVGGGGKQRVTTKQGGWRAYTPPKSEVS* |
Ga0116204_10199265 | 3300010293 | Anoxic Lake Water | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTR* |
Ga0116204_10243472 | 3300010293 | Anoxic Lake Water | VKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK* |
Ga0116204_11605851 | 3300010293 | Anoxic Lake Water | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPGEGQRL* |
Ga0116204_12245241 | 3300010293 | Anoxic Lake Water | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK* |
Ga0129342_10435001 | 3300010299 | Freshwater To Marine Saline Gradient | TMKLFRRLLLVLSVASTVVGILRFGGSSKAKVTTKQGGWRSTRFESHQL* |
Ga0129342_12289811 | 3300010299 | Freshwater To Marine Saline Gradient | TMKLFRRLLLVLSVASTVVGILRFGGSSKAKVTTKQGGWRSYSPPK* |
Ga0136656_12914932 | 3300010318 | Freshwater To Marine Saline Gradient | KLFRRLLLVLSVASTVVGILRFGGSSKAKVTTKQGGWRSTRFESHQL* |
Ga0129333_101227733 | 3300010354 | Freshwater To Marine Saline Gradient | MKLFSRLLLVLSVATAVVGVLKFGGNGKSRVTTKQGGWRSYSPPK* |
Ga0129333_101293354 | 3300010354 | Freshwater To Marine Saline Gradient | MKLFRRLLLVLSVATAVVGILRVGGGGKSRVTTKQGGWRNFSPQQ* |
Ga0129333_101800921 | 3300010354 | Freshwater To Marine Saline Gradient | DEHEMKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPTKG* |
Ga0129333_105096842 | 3300010354 | Freshwater To Marine Saline Gradient | MKLFRRLLLVLSVATAVVGILRVGGGGKSRVTTKQGGWRNYSPPQ* |
Ga0129333_112174491 | 3300010354 | Freshwater To Marine Saline Gradient | LVLSVATAVVGILRVGGGGKSRVTTKQGGWRNFSPPQ* |
Ga0129336_100804304 | 3300010370 | Freshwater To Marine Saline Gradient | MKLFRRLLLVLSVASAVLGILRFGGSSKAKVTTKQGGWRSVRVDTDFK* |
Ga0129336_102488952 | 3300010370 | Freshwater To Marine Saline Gradient | MKLFRRLMLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPPKG* |
Ga0119955_11570892 | 3300012006 | Freshwater | MKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRSYTPTK* |
Ga0163212_12123251 | 3300013087 | Freshwater | HDKARTEMKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK* |
Ga0163212_12657002 | 3300013087 | Freshwater | VKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPGEGQRL* |
Ga0163210_12419102 | 3300013091 | Freshwater | LKLFRRLLLVLSVATAVVGILRFGGSGKQRATTKQGGWRSYEPTK* |
(restricted) Ga0172374_10207262 | 3300013122 | Freshwater | MKLFRRLILVLSVATAVVGILRFGGGGKQRVTTKQGGWRAYTPPK* |
(restricted) Ga0172374_12645992 | 3300013122 | Freshwater | MLEASRYMKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK* |
(restricted) Ga0172373_102362802 | 3300013131 | Freshwater | VQTYLYINVKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK* |
(restricted) Ga0172373_104755581 | 3300013131 | Freshwater | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSY |
(restricted) Ga0172372_100519395 | 3300013132 | Freshwater | MKLFSRLLLVLSVATAVVGVLRFGGNGKSRVTTKQGGWRSYEPTK* |
Ga0169931_101872984 | 3300017788 | Freshwater | MLTSVKLVRLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0169931_104038302 | 3300017788 | Freshwater | LDSNLPHDKARTELKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0169931_105970931 | 3300017788 | Freshwater | VKLFRRLLLVLSVASAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0169931_106899292 | 3300017788 | Freshwater | VKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTQ |
Ga0169931_107917072 | 3300017788 | Freshwater | LLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0194113_100139659 | 3300020074 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRGYEPTK |
Ga0194113_101227835 | 3300020074 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0194113_102936143 | 3300020074 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPGEGQRL |
Ga0194111_106988532 | 3300020083 | Freshwater Lake | MKLFRRLLLVMSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTR |
Ga0194110_100975283 | 3300020084 | Freshwater Lake | MKHFSRLLLVLSVATAVVGVVRFGGNGKSRVTTKQGGWRSYAPPK |
Ga0194110_103184782 | 3300020084 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTR |
Ga0194134_100147358 | 3300020179 | Freshwater Lake | MKLFRRLLLVLSVASAVVGILRFGGSSKQRVTTKQGGWRTFNPPK |
Ga0194134_100465491 | 3300020179 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPT |
Ga0194134_101101952 | 3300020179 | Freshwater Lake | VRLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0194134_102939751 | 3300020179 | Freshwater Lake | EMKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRGYEPTK |
Ga0194115_101451263 | 3300020183 | Freshwater Lake | MLTSVKLVRLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSY |
Ga0194118_100955214 | 3300020190 | Freshwater Lake | MKLFRRLLLVLSVASAVVGILRFGGSGKQRVTTKQGGWRSY |
Ga0194131_103377423 | 3300020193 | Freshwater Lake | MKLLRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGW |
Ga0194128_102974251 | 3300020197 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRGYE |
Ga0194121_100826351 | 3300020200 | Freshwater Lake | RPRTEMKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRGYEPTK |
Ga0194121_105067801 | 3300020200 | Freshwater Lake | MKVFSRLLLVLSVATAVVGVLRFGGNGKSRVTTKQGGWRSYSP |
Ga0194116_102980691 | 3300020204 | Freshwater Lake | KARTEMKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0194116_105692722 | 3300020204 | Freshwater Lake | VKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0194132_101320383 | 3300020214 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRS |
Ga0194132_104114272 | 3300020214 | Freshwater Lake | HFSRLLLVLSVATAVVGVVRFGGNGKSRVTTKQGGWRSYAPPK |
Ga0194119_100771991 | 3300020220 | Freshwater Lake | MKFLRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRGYEPT |
Ga0194119_105360041 | 3300020220 | Freshwater Lake | FRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0194125_100277801 | 3300020222 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEP |
Ga0194125_105644301 | 3300020222 | Freshwater Lake | VLDALNHSRMLTSVKLVRLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPT |
Ga0208084_10003066 | 3300020499 | Freshwater | MKLFRRLLLVLSVATAVVGILRVGGGGKSRVTTKQGGWRGYSPLE |
Ga0208231_100069713 | 3300020557 | Freshwater | MKLFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWRSVRVDTDFK |
Ga0194129_101287141 | 3300020578 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYE |
Ga0194129_102491001 | 3300020578 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQCVTTKQGGWRSYEPGEGQRL |
Ga0194126_100835121 | 3300020603 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQG |
Ga0194126_107028481 | 3300020603 | Freshwater Lake | VLSVATAVVGVLRFGGNGKSRVTTKQGGWRSYEPT |
Ga0194122_105617331 | 3300021092 | Freshwater Lake | KVFSRLLLVLSVATAVVGVLRFGGNGKSRVTTKQGGWRSYSPPK |
Ga0194123_100505551 | 3300021093 | Freshwater Lake | MKLFRRLLLVLSVASAVVGILRFGGSGKQRVTTKQGGWRSYEPTR |
Ga0194123_101993331 | 3300021093 | Freshwater Lake | MLTSVKLVRLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWR |
Ga0194123_104391082 | 3300021093 | Freshwater Lake | MKFFSRLLLVLSVATAVVGVLRFGGNGKSRVTTKQGG |
Ga0194130_100700301 | 3300021376 | Freshwater Lake | MLTSVKLVRLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYE |
Ga0194130_101447521 | 3300021376 | Freshwater Lake | HDKARTEMKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0194117_101844402 | 3300021424 | Freshwater Lake | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWCSYEPTK |
Ga0222714_100202761 | 3300021961 | Estuarine Water | MKLFRRLLLVLSVASAVVGILRFGGGSSKSRVTTKQGGWRTFDLKSDKK |
Ga0222714_101812372 | 3300021961 | Estuarine Water | MKLFRRLLLVLSVASTVVGILRFGGSSKAKVTTKQGGWRSYSPPK |
Ga0214917_100550233 | 3300022752 | Freshwater | MKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRSYSKRS |
(restricted) Ga0233424_1000041433 | 3300023208 | Freshwater | MKLFRRLLLVLSVATAVVGILRVGGGGKQRVTTKQGGWRAYTPSK |
(restricted) Ga0233424_100167902 | 3300023208 | Freshwater | MKLFRRLLLVLSVAAAVVGILRVGGGKQRVTTKQGGWRTYTPPKSGI |
(restricted) Ga0233424_100251502 | 3300023208 | Freshwater | MKLFRRLLLVLSVAAAVVGILRVGGGKQRVTTRQGGWRTYTPPK |
(restricted) Ga0233424_100433694 | 3300023208 | Freshwater | MKLFRRLLLVLSVAAAVVGILRVGGGKQRVTTKQGGWRTYTPPK |
Ga0255207_10204682 | 3300024277 | Freshwater | EHEMKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPTK |
Ga0255167_10354462 | 3300024350 | Freshwater | LVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPTK |
Ga0255169_10098971 | 3300024356 | Freshwater | RLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTQPKG |
Ga0255169_10584271 | 3300024356 | Freshwater | MKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYT |
Ga0255203_10102835 | 3300024491 | Freshwater | MKLFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWRSTRLDGEQ |
Ga0255199_10519691 | 3300024498 | Freshwater | RLLLVLSVAYAVVGILRFGGSSKAKVTTKQGGWRSYTPPK |
Ga0255181_10863802 | 3300024502 | Freshwater | VLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTQPKG |
Ga0255176_10135973 | 3300024507 | Freshwater | RRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPTK |
Ga0255186_10217072 | 3300024512 | Freshwater | MKLFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWRSTRLDGEQL |
Ga0255268_11746342 | 3300024572 | Freshwater | EMKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPTK |
Ga0209609_101805002 | 3300025145 | Anoxic Lake Water | PHDKARTEMKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPTK |
Ga0208047_10195375 | 3300025279 | Freshwater | MKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEPGEGQ |
Ga0208048_10190312 | 3300025283 | Freshwater | MKPFSRLLLVLSVATAVVGVLRFGGNGKSRVTTKQGGWRSYSPPK |
Ga0208048_11261082 | 3300025283 | Freshwater | VKLFRRLLLVLSVATAVVGILRFGGSGKQRVTTKQGGWRSYEP |
Ga0208546_11126061 | 3300025585 | Aqueous | MKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPTKG |
Ga0208147_10040004 | 3300025635 | Aqueous | MKLFRRLLLVLSVASAVVGILRFGGSSKSKVTTKQGGWRTTRLDNEPQ |
Ga0208542_11426651 | 3300025818 | Aqueous | MKLFRRLLLVLSVASTVVGILRFGGSSKAKVTTKQGGWRSTRFEGH |
Ga0255220_10834272 | 3300027306 | Freshwater | LVLSVASAVVGILRFGGSSKAKVTTKQGGWRSTRLDGEQL |
Ga0255182_10110961 | 3300027503 | Freshwater | RLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYTPTK |
Ga0208942_10918952 | 3300027627 | Freshwater Lentic | KLFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWRTYSPPK |
Ga0209357_10014255 | 3300027656 | Freshwater Lake | MKLFRRLLLVLSVALAVVGILRFGGSSKSRVTTKQGGWRTYTPPK |
Ga0255201_10590042 | 3300028086 | Freshwater | FRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWRSTRLDGEQL |
Ga0255299_11007732 | 3300028089 | Freshwater | KLFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWRSYTPPK |
Ga0255214_10382551 | 3300028258 | Freshwater | LFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWRSTRLDGEQL |
Ga0256358_10533142 | 3300028267 | Freshwater | FRRLLLVLSVAYAVVGILRFGGSSKAKVTTKQGGWRSYTPPK |
Ga0255193_10346303 | 3300028269 | Freshwater | MKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQ |
Ga0119944_10196174 | 3300029930 | Aquatic | MKLFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGG |
Ga0119944_10266282 | 3300029930 | Aquatic | MKLFRRLLLVLSVATAVVGILRVGGGGKQRVTTKQGGWRAYTPPK |
Ga0334982_0046020_3_119 | 3300033981 | Freshwater | MKLFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWR |
Ga0334985_0282297_2_109 | 3300034018 | Freshwater | MKLFRRLLLVLSVASAVVGILRFGGSSKSRVTTKQG |
Ga0310130_0194268_48_185 | 3300034073 | Fracking Water | MKLFRRLLLVLSVASAIVGILRFGGSSKTKVTTKQGAWRPYNPTK |
Ga0335056_0079427_2_136 | 3300034120 | Freshwater | MKLFRRLLLVLSVASAVVGILRFGGSSKAKVTTKQGGWRSVRVDT |
Ga0335016_0515839_110_247 | 3300034166 | Freshwater | VKLFRRLLLVLSVATAVVGIIRFGGSEKSRVTTKQGGWRGFTPPE |
Ga0310128_030374_316_453 | 3300034682 | Fracking Water | MTLFRRLLLVLSVATAVVGILRFGGSEKSRVTTKQGGWRNYSPTK |
⦗Top⦘ |