 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F065556 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAKKSEKIVCHNCLEPMTFKTGVKVERNNFGIPHFVWICKKCKK |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 18.90 % |
| % of genes near scaffold ends (potentially truncated) | 34.65 % |
| % of genes from short scaffolds (< 2000 bps) | 88.98 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.228 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (29.921 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.118 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.866 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.56% β-sheet: 30.56% Coil/Unstructured: 63.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF00156 | Pribosyltran | 40.16 |
| PF13394 | Fer4_14 | 6.30 |
| PF13640 | 2OG-FeII_Oxy_3 | 6.30 |
| PF00085 | Thioredoxin | 6.30 |
| PF00037 | Fer4 | 5.51 |
| PF03567 | Sulfotransfer_2 | 5.51 |
| PF01227 | GTP_cyclohydroI | 3.94 |
| PF01242 | PTPS | 1.57 |
| PF00303 | Thymidylat_synt | 1.57 |
| PF00856 | SET | 1.57 |
| PF01041 | DegT_DnrJ_EryC1 | 1.57 |
| PF03104 | DNA_pol_B_exo1 | 0.79 |
| PF01503 | PRA-PH | 0.79 |
| PF06508 | QueC | 0.79 |
| PF02348 | CTP_transf_3 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.57 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.57 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.57 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 1.57 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.57 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.57 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.57 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 1.57 |
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.79 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.79 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.79 |
| COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.79 |
| COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.23 % |
| All Organisms | root | All Organisms | 26.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 29.92% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.66% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.30% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.72% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.15% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.57% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.79% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.79% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.79% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.79% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.79% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.79% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_10000389516 | 3300002835 | Freshwater | MVKKSEKIVCHECLSSITYKTGALIERNNWGIPHFIWVCKKCGKK* |
| Ga0007787_101829143 | 3300004240 | Freshwater Lake | MAKTSEKIVCHNCLDPMTYKTGVKVERNNFGIPHFVWICKKCKK* |
| Ga0007760_114093292 | 3300004793 | Freshwater Lake | VGKESENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWVCKKCKK* |
| Ga0079957_13109912 | 3300005805 | Lake | VGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK* |
| Ga0070749_103337551 | 3300006802 | Aqueous | MAKKSEKIVCHNCLEPMTFKTGVKIEKNNFGIPHFVWICKKCN |
| Ga0070749_103445623 | 3300006802 | Aqueous | MARVSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKKCKK* |
| Ga0070749_106286782 | 3300006802 | Aqueous | MAVKAEKVVCHDCLGPMTYKTGVKIERNNFGIPHFVWVCKKCFNEAINRK* |
| Ga0099851_10432713 | 3300007538 | Aqueous | MAKKSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKTCKKNYD* |
| Ga0099851_13516462 | 3300007538 | Aqueous | MAKKSEKIVCHNCLEPMTFKAGVKVERNNFGIPHFVWICKKCSKK* |
| Ga0099848_10158036 | 3300007541 | Aqueous | MTKKSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKTCKKNYD* |
| Ga0099846_10952661 | 3300007542 | Aqueous | KSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKTCKKNYD* |
| Ga0102828_11879502 | 3300007559 | Estuarine | MNLDKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKKCKK* |
| Ga0105745_12763011 | 3300007972 | Estuary Water | MGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK* |
| Ga0114340_10251814 | 3300008107 | Freshwater, Plankton | MAKSSEKIVCHNCLDPMTYKTGVKVERNNFGIPHFVWICKKCKK* |
| Ga0114340_11177324 | 3300008107 | Freshwater, Plankton | MAKTSEKIVCHNCLGPMTFKTGVKVERNNFGIPHFVWICKKCKK* |
| Ga0114340_12067742 | 3300008107 | Freshwater, Plankton | MAKKSEKIVCHDCLEPMTFKTGVKIERNNFGIPHFVWICKKCKK* |
| Ga0114350_10232291 | 3300008116 | Freshwater, Plankton | MAKKSEKIVCHNCLEPMTFKTGVKIERNNFGIPHFIWICKKCNKK* |
| Ga0114350_11052733 | 3300008116 | Freshwater, Plankton | MAKKSEKIVCHNCLSPMTFKTGVKVERNNFGIPHFVWICKKCKK* |
| Ga0114350_11071793 | 3300008116 | Freshwater, Plankton | MAKKEELIVCHNCLTNVTFKKAQKLERNNFGIPHIVLVCKKCYDAASSRK* |
| Ga0114355_10946623 | 3300008120 | Freshwater, Plankton | MAKKSEKIVCHNCLEPMTFKTGVKVERNNFGIPHFVWICKKCNKK* |
| Ga0114355_11358372 | 3300008120 | Freshwater, Plankton | MAKKSEKIVCHNCLEPMTFKTGVKVERNNFGIPHFVWICKKCKK* |
| Ga0114841_11603412 | 3300008259 | Freshwater, Plankton | MAKKSEKIVCHDCLGPMTFKTGVKVERNNFGIPHFVWICKKCDKK* |
| Ga0114363_10407314 | 3300008266 | Freshwater, Plankton | MGKETEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK* |
| Ga0114364_10472582 | 3300008267 | Freshwater, Plankton | MAKKSEKIVCHSCLEPMTFKTGVKVERNNFGIPHFVWICKKCNKK* |
| Ga0114364_10517092 | 3300008267 | Freshwater, Plankton | MGKETEKIVCHNCLDTVAFKTAFKVERNNFGIPHFVWICKKCKK* |
| Ga0114364_10728373 | 3300008267 | Freshwater, Plankton | VGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWIC |
| Ga0114364_10815073 | 3300008267 | Freshwater, Plankton | MAKTSEKVVCHDCLGPMTYKTGVKVERNNFGIPHFVWVCKTCKKNYD* |
| Ga0114364_11163983 | 3300008267 | Freshwater, Plankton | VGKESENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWVCKKCNNETSNRK* |
| Ga0114876_12210703 | 3300008448 | Freshwater Lake | MAKKSEKIVCHNCLESITYKTGVLVERNNWGIPHSVWICKKCNKK* |
| Ga0114865_11232573 | 3300008459 | Freshwater Lake | VCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK* |
| Ga0105099_102130783 | 3300009082 | Freshwater Sediment | LDLKKFLNLDMSKKSEKIVCHECLSPITHKTGALMERNNWGIPHFIWVCKKCKK* |
| Ga0114918_104033411 | 3300009149 | Deep Subsurface | MAKTSEKVVCHDCLGPMTYKTGVKVKRNNFGIPHFV |
| Ga0129333_104871853 | 3300010354 | Freshwater To Marine Saline Gradient | MAKKSEKIVCHNCLEPMTFKTGVKIEKNNFGIPHFVWICKKCNKNATN* |
| Ga0139557_10418192 | 3300011010 | Freshwater | VGKESDKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK* |
| Ga0153799_10054742 | 3300012012 | Freshwater | MAKESENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK* |
| Ga0164292_105287611 | 3300013005 | Freshwater | MVKKSEKIVCHECLSSITYKTGALIERNNWGIPHFIW |
| (restricted) Ga0172368_101301833 | 3300013123 | Freshwater | MAKASEKVVCHDCLGPMTLKTGVKVERNNFGIPHFIWVCKTCKKNYD* |
| (restricted) Ga0172367_101283884 | 3300013126 | Freshwater | MAKTSEKVVCHDCLGPMTLKTGVKVKRNNFGIPHFVWICKKCKK* |
| (restricted) Ga0172367_107340122 | 3300013126 | Freshwater | MAKTSEKVVCHDCLGPMTLKTGVKVERNNFGIPHFVWVCKTCKKNYD* |
| (restricted) Ga0172365_100910251 | 3300013127 | Sediment | MAKTSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWV |
| (restricted) Ga0172366_101664391 | 3300013128 | Sediment | MGKGTEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKKCSKEKV* |
| (restricted) Ga0172364_104259072 | 3300013129 | Sediment | MAKTSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKTCKKNYD* |
| (restricted) Ga0172364_105375572 | 3300013129 | Sediment | MAKKSEKVVCHDCLGPMTLKTGVKVERNNFGIPHFIWVCKICKKNYD* |
| (restricted) Ga0172363_102275811 | 3300013130 | Sediment | MAKTSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKTCKKN |
| (restricted) Ga0172363_103619281 | 3300013130 | Sediment | MGKGTEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKTCKKN |
| (restricted) Ga0172373_103991181 | 3300013131 | Freshwater | MAKTSEKVVCHDCLGPMTLKTGVKVKRNNFGIPHF |
| (restricted) Ga0172373_105371221 | 3300013131 | Freshwater | DCLGPMTLKTGVKVERNNFGIPHFIWVCKTCKKNYD* |
| Ga0177922_101635123 | 3300013372 | Freshwater | MAKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK* |
| Ga0177922_103772983 | 3300013372 | Freshwater | VGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKND* |
| Ga0181363_10040085 | 3300017707 | Freshwater Lake | MAVKAEKVVCHDCLGPMTYKTGVKIERNNFGIPHFVWVCKKCFNEAINRK |
| Ga0181347_12031361 | 3300017722 | Freshwater Lake | NLNKIVCHNCLNTVAFKTAFRVERNNFGIPHFVWICKKCKKND |
| Ga0181365_11632882 | 3300017736 | Freshwater Lake | VCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0181344_11115053 | 3300017754 | Freshwater Lake | VGKESDKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0181356_11484752 | 3300017761 | Freshwater Lake | CHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0181356_12021291 | 3300017761 | Freshwater Lake | VGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWI |
| Ga0181356_12221333 | 3300017761 | Freshwater Lake | MNLDKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWIC |
| Ga0181356_12424041 | 3300017761 | Freshwater Lake | KIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKKI |
| Ga0181343_10647323 | 3300017766 | Freshwater Lake | MAKKSEKIVCHNCLESITHKTGVMIERNNWGIPHFIWVCKKCSKDATN |
| Ga0181343_11974151 | 3300017766 | Freshwater Lake | RATEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0181343_12243111 | 3300017766 | Freshwater Lake | MAKTSEKIVCHNCLDPMTYKTGVKVERNNFGIPHFVWICKKCKK |
| Ga0181358_10435365 | 3300017774 | Freshwater Lake | VGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICK |
| Ga0181357_11660593 | 3300017777 | Freshwater Lake | MGKETEKIVCHNCLDTVAFKTAFRVERNNFGITHFVWICKKCKKND |
| Ga0181346_10453003 | 3300017780 | Freshwater Lake | MVKSSENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWVCKK |
| Ga0181346_11950042 | 3300017780 | Freshwater Lake | MNLNKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWVCKKCKK |
| Ga0181348_11255671 | 3300017784 | Freshwater Lake | PNKMVKSSENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWVCKKCIKPLKNK |
| Ga0181355_10476515 | 3300017785 | Freshwater Lake | MAKESEKIVCHNCLDTVAFKTAFRVERNNFGIPYFVWICKKCKK |
| Ga0169931_101762736 | 3300017788 | Freshwater | MGKGTEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKTCKKNYD |
| Ga0169931_104805453 | 3300017788 | Freshwater | MAKTSEKVVCHDCLGPMTLKTGVKVERNNFGIPHFVW |
| Ga0181359_10407985 | 3300019784 | Freshwater Lake | MAKESENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0181359_10959061 | 3300019784 | Freshwater Lake | MNLDKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0181359_10959672 | 3300019784 | Freshwater Lake | MNLDKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKKI |
| Ga0211732_10749433 | 3300020141 | Freshwater | VGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0211736_108009372 | 3300020151 | Freshwater | LNFVMGKETEKIVCHNCLDTVAFKTAFKVERNNFGIPHFVWICKKCKK |
| Ga0211734_106101604 | 3300020159 | Freshwater | MAKESESIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0211734_110632463 | 3300020159 | Freshwater | VGKESEKIVCHNCLDTVAFKTAFKVERNNFGIPHFVWICKKCKK |
| Ga0211733_109022084 | 3300020160 | Freshwater | MGKETEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0211733_111236991 | 3300020160 | Freshwater | MGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWIC |
| Ga0211726_106394712 | 3300020161 | Freshwater | MGKETEKIVCHNCLDTVAFKTAFKVERNNFGIPHFVWICKKCKK |
| Ga0211735_111327182 | 3300020162 | Freshwater | MAKESEKIVCHNCLDTVVFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0194134_101065152 | 3300020179 | Freshwater Lake | MGKGTKKVVCHDCLGPMTFKTGVKVERNNFGIPHFIWVCKTCKKNYD |
| Ga0194115_100754904 | 3300020183 | Freshwater Lake | MAKSSKKIVCHNCLGPITFKTGVKVERNNFGIPHFIWVCKTCKKNYD |
| Ga0194118_102395294 | 3300020190 | Freshwater Lake | MAKTSEKVVCHDCLGPMTLKTGVKVERNNFGIPHFVWVCKTCKKNYD |
| Ga0208091_10008049 | 3300020506 | Freshwater | ENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0208091_10109564 | 3300020506 | Freshwater | MKNLNFFMAKESENIVCHNCLDTVAFKTAFRVERNNFGIPHFVW |
| Ga0208235_10168322 | 3300020530 | Freshwater | MVKKSEKIVCHECLSSITYKTGALIERNNWGIPHFIWVCKKCGKK |
| Ga0194133_105206894 | 3300021091 | Freshwater Lake | MGKGTKKVVCHDCLGPMTFKTGVKVERNNFGIPHFIWVCKTCKK |
| Ga0222714_100182539 | 3300021961 | Estuarine Water | MAKKSEKIVCHNCLEPMTFKKGIKVERNNFGIPHFVWICKKCNKK |
| Ga0222714_101755392 | 3300021961 | Estuarine Water | MAKKSEKIVCHNCLEPMTFKTGVKVERNNFGIPHFVWICKKCKK |
| Ga0222714_102743481 | 3300021961 | Estuarine Water | SEKIVCHNCLEPMTFKTGVKVERNNFGIPHFVWICKKCSKK |
| Ga0222713_101265762 | 3300021962 | Estuarine Water | MAKKSEKIVCHNCLESITHKTGVMIERNNWGIPHFIWVCKKCSKK |
| Ga0222713_102581642 | 3300021962 | Estuarine Water | MAKKSEKIVCHNCLEPMTFKTGVKVERNNFGIPHFVWICKKCSKK |
| Ga0222712_101271723 | 3300021963 | Estuarine Water | MAHASEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWICKKCNKK |
| Ga0222712_103405994 | 3300021963 | Estuarine Water | MAKKSEKIVCHNCLESITYKTGVLVPRNNWGIPHSVWICKK |
| Ga0181353_10142635 | 3300022179 | Freshwater Lake | MAKSSEKIVCHNCLDPMTYKTGVKVERNNFGIPHFVWICKKCKK |
| Ga0181353_10623974 | 3300022179 | Freshwater Lake | MAKKSEKIVCHNCLESITHKTGVMIERNNWGIPHFIWVCKKCSKQ |
| Ga0181353_10988393 | 3300022179 | Freshwater Lake | MAVKAEKVVCHDCLGPMTYKTGVKIERNNFGIPHFVWVCKKCFNEAINRKR |
| Ga0181353_11089112 | 3300022179 | Freshwater Lake | KIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0181354_10599614 | 3300022190 | Freshwater Lake | MNLDKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWVCKKCKK |
| Ga0181354_11120191 | 3300022190 | Freshwater Lake | MNLDKIVCHNCLDTVAFKTAFRVERNNFDIPHFVWICKKCKKI |
| Ga0181354_11404224 | 3300022190 | Freshwater Lake | MGKETEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKKND |
| Ga0181351_10509923 | 3300022407 | Freshwater Lake | MVKSSENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWVCKKCIKPLKNK |
| Ga0181351_10893905 | 3300022407 | Freshwater Lake | MGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0181351_10958005 | 3300022407 | Freshwater Lake | MAKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0181351_12025372 | 3300022407 | Freshwater Lake | DNKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKKI |
| Ga0181351_12276622 | 3300022407 | Freshwater Lake | MGKESEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKKND |
| Ga0181351_12426412 | 3300022407 | Freshwater Lake | KHLNFVMGKETEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKKND |
| Ga0208161_10195475 | 3300025646 | Aqueous | MTKKSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKTCKKNYD |
| Ga0208644_13046122 | 3300025889 | Aqueous | MAKKSEKIVCHNCLEPMTFKTGVKIEKNNFGIPHFVWICKKCNKNATN |
| Ga0209768_103967704 | 3300027772 | Freshwater Lake | MKNLNFFMAKESENIVCHNCLDTVAFKTAFRVERNNFGI |
| Ga0209768_104163731 | 3300027772 | Freshwater Lake | MNLDKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWVCK |
| Ga0209990_101266693 | 3300027816 | Freshwater Lake | NFVMGKETEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0209820_10091434 | 3300027956 | Freshwater Sediment | MARVSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKTCKKKYD |
| Ga0247723_10307754 | 3300028025 | Deep Subsurface Sediment | MAKKSEKIVCHNCLESITHKTGVMIERNNWGIPHFIWVCKKCGKK |
| Ga0307376_102283571 | 3300031578 | Soil | MAREVEKIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| Ga0307375_101213564 | 3300031669 | Soil | MAKTSEKVVCHDCLGPMTYKTGVKVKRNNFGIPHFVWVCKTCKKNYD |
| Ga0315907_102962662 | 3300031758 | Freshwater | MAKTSEKVVCHDCLGPMTYKTGVKVERNNFGIPHFVWVCKTCKKNYD |
| Ga0315900_105014163 | 3300031787 | Freshwater | MAHASEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWICKKCKK |
| Ga0315900_109159502 | 3300031787 | Freshwater | MARVSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKKCKK |
| Ga0315909_100657582 | 3300031857 | Freshwater | MAKKSEKIVCHDCLGPMTFKTGVKVERNNFGIPHFVWICKKCDKK |
| Ga0315909_108192683 | 3300031857 | Freshwater | MAKTSEKIVCHNCLDSITFKKGVKVERNNFGIPHFVWICKKCYDAAPTRK |
| Ga0315901_101595104 | 3300031963 | Freshwater | SEKIVCHNCLEPMTFKTGVKVERNNFGIPHFVWICKKCKK |
| Ga0315902_110930242 | 3300032093 | Freshwater | SLNFVMARVSEKVVCHDCLGPMTFKTGVKVERNNFGIPHFVWVCKKCKK |
| Ga0315903_111552042 | 3300032116 | Freshwater | MAKKSEKIVCHNCLESITYKTGVLVERNNWGIPHSVWICKKCNKK |
| Ga0334998_0299489_828_956 | 3300034019 | Freshwater | MAKESENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCK |
| Ga0310127_179589_2_109 | 3300034072 | Fracking Water | MAKKSEKIVCHSCLEPMTFKTGVKVERNNFGIPHFV |
| Ga0335036_0054074_866_1003 | 3300034106 | Freshwater | MVKKSEKIVCHECLSSITHKTGVLIERNNWGIPHFIWVCKKCGKK |
| Ga0335050_0447054_17_172 | 3300034108 | Freshwater | MKNLNFFMAKESENIVCHNCLDTVAFKTAFRVERNNFGIPHFVWICKKCKK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |