NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064902

Metagenome / Metatranscriptome Family F064902

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064902
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 47 residues
Representative Sequence MNGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQK
Number of Associated Samples 109
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.53 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(50.781 % of family members)
Environment Ontology (ENVO) Unclassified
(41.406 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.531 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.67%    β-sheet: 0.00%    Coil/Unstructured: 53.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00005ABC_tran 43.75
PF08241Methyltransf_11 3.12
PF13304AAA_21 3.12
PF00282Pyridoxal_deC 2.34
PF13424TPR_12 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 2.34


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.50 %
UnclassifiedrootN/A12.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005331|Ga0070670_100885282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia809Open in IMG/M
3300005435|Ga0070714_100614595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1044Open in IMG/M
3300005436|Ga0070713_102284780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300005455|Ga0070663_100133231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1889Open in IMG/M
3300005615|Ga0070702_100080760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1947Open in IMG/M
3300005719|Ga0068861_100025350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4299Open in IMG/M
3300005995|Ga0066790_10000945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia11851Open in IMG/M
3300006176|Ga0070765_101554053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300006572|Ga0074051_11641232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1163Open in IMG/M
3300006574|Ga0074056_11746662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1234Open in IMG/M
3300006893|Ga0073928_10976688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300009523|Ga0116221_1308948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae684Open in IMG/M
3300009623|Ga0116133_1026945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1419Open in IMG/M
3300009683|Ga0116224_10488592All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009839|Ga0116223_10759861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae555Open in IMG/M
3300010366|Ga0126379_12960610Not Available568Open in IMG/M
3300010376|Ga0126381_102089096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis816Open in IMG/M
3300010396|Ga0134126_11143081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis867Open in IMG/M
3300011106|Ga0151489_1177365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis695Open in IMG/M
3300012189|Ga0137388_10505801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1122Open in IMG/M
3300012984|Ga0164309_10037988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2703Open in IMG/M
3300016294|Ga0182041_11496451Not Available621Open in IMG/M
3300016341|Ga0182035_12103219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300016422|Ga0182039_11749556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300017928|Ga0187806_1118828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis855Open in IMG/M
3300017933|Ga0187801_10485721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300017939|Ga0187775_10541184Not Available500Open in IMG/M
3300017942|Ga0187808_10412094All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300017946|Ga0187879_10632192All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300017970|Ga0187783_10542879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis842Open in IMG/M
3300017973|Ga0187780_11102604All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300017973|Ga0187780_11366570Not Available522Open in IMG/M
3300017973|Ga0187780_11486106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300018058|Ga0187766_10077539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1987Open in IMG/M
3300018085|Ga0187772_10175160All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300018086|Ga0187769_11176275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura kijaniata580Open in IMG/M
3300020002|Ga0193730_1046589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1254Open in IMG/M
3300020081|Ga0206354_10219095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1281Open in IMG/M
3300020580|Ga0210403_11384175All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300020580|Ga0210403_11525717Not Available502Open in IMG/M
3300021088|Ga0210404_10896871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura kijaniata507Open in IMG/M
3300021171|Ga0210405_11074935All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300021180|Ga0210396_10197748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1796Open in IMG/M
3300021377|Ga0213874_10103101All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300021401|Ga0210393_10247573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1445Open in IMG/M
3300021402|Ga0210385_10296746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1197Open in IMG/M
3300021402|Ga0210385_11334647All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300021405|Ga0210387_11176300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300021420|Ga0210394_11327888Not Available614Open in IMG/M
3300021432|Ga0210384_11225878Not Available655Open in IMG/M
3300021474|Ga0210390_10531163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis989Open in IMG/M
3300021478|Ga0210402_10365837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1338Open in IMG/M
3300021478|Ga0210402_10569020All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300021478|Ga0210402_11533997Not Available593Open in IMG/M
3300021479|Ga0210410_10258963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1560Open in IMG/M
3300021559|Ga0210409_11057174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300021860|Ga0213851_1300745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales792Open in IMG/M
3300021860|Ga0213851_1608500All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300024181|Ga0247693_1048778Not Available610Open in IMG/M
3300025929|Ga0207664_10389613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1238Open in IMG/M
3300025939|Ga0207665_11508399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300026489|Ga0257160_1011262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1291Open in IMG/M
3300027063|Ga0207762_1044929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Spongiactinospora → Spongiactinospora gelatinilytica653Open in IMG/M
3300027090|Ga0208604_1008841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis957Open in IMG/M
3300027703|Ga0207862_1061934All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300027765|Ga0209073_10322597Not Available617Open in IMG/M
3300027884|Ga0209275_10544094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis664Open in IMG/M
3300027889|Ga0209380_10068828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2019Open in IMG/M
3300028879|Ga0302229_10117638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1247Open in IMG/M
3300030007|Ga0311338_11978280Not Available518Open in IMG/M
3300030056|Ga0302181_10280419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis745Open in IMG/M
3300030580|Ga0311355_10289036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1654Open in IMG/M
3300031525|Ga0302326_13555696Not Available516Open in IMG/M
3300031543|Ga0318516_10470552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis722Open in IMG/M
3300031573|Ga0310915_10437173Not Available930Open in IMG/M
3300031640|Ga0318555_10152566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1237Open in IMG/M
3300031640|Ga0318555_10242158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis974Open in IMG/M
3300031640|Ga0318555_10768076Not Available520Open in IMG/M
3300031668|Ga0318542_10553610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia599Open in IMG/M
3300031668|Ga0318542_10599377All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300031668|Ga0318542_10764463All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031724|Ga0318500_10062403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1616Open in IMG/M
3300031724|Ga0318500_10658559All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300031747|Ga0318502_10911662All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031748|Ga0318492_10024098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2680Open in IMG/M
3300031748|Ga0318492_10226600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis962Open in IMG/M
3300031765|Ga0318554_10171364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1234Open in IMG/M
3300031768|Ga0318509_10272835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis946Open in IMG/M
3300031769|Ga0318526_10380702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300031771|Ga0318546_11329410Not Available505Open in IMG/M
3300031781|Ga0318547_10352303All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300031782|Ga0318552_10030147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2482Open in IMG/M
3300031793|Ga0318548_10460626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300031795|Ga0318557_10054016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1697Open in IMG/M
3300031796|Ga0318576_10421213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300031797|Ga0318550_10292095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Spongiactinospora → Spongiactinospora gelatinilytica791Open in IMG/M
3300031805|Ga0318497_10835906All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031819|Ga0318568_10789073All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031832|Ga0318499_10392666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300031846|Ga0318512_10226172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis920Open in IMG/M
3300031846|Ga0318512_10378161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis710Open in IMG/M
3300031860|Ga0318495_10452019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300031880|Ga0318544_10131285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis955Open in IMG/M
3300031894|Ga0318522_10390491All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300031954|Ga0306926_12393997All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300031954|Ga0306926_12878036All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031959|Ga0318530_10016666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2464Open in IMG/M
3300031981|Ga0318531_10489568All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300032041|Ga0318549_10063487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1553Open in IMG/M
3300032043|Ga0318556_10603807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300032044|Ga0318558_10143837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1144Open in IMG/M
3300032044|Ga0318558_10610315Not Available545Open in IMG/M
3300032055|Ga0318575_10177174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1066Open in IMG/M
3300032063|Ga0318504_10096846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1316Open in IMG/M
3300032065|Ga0318513_10159104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis1080Open in IMG/M
3300032068|Ga0318553_10571148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300032076|Ga0306924_12263033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300032089|Ga0318525_10054458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1991Open in IMG/M
3300032089|Ga0318525_10671524All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300032090|Ga0318518_10058650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1849Open in IMG/M
3300032091|Ga0318577_10252943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis843Open in IMG/M
3300032160|Ga0311301_10640578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1516Open in IMG/M
3300032160|Ga0311301_11463334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis845Open in IMG/M
3300032160|Ga0311301_12952431All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300032261|Ga0306920_103045560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300032896|Ga0335075_11400651All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300033158|Ga0335077_11285936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces longwoodensis711Open in IMG/M
3300033290|Ga0318519_10764385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil50.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.47%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.69%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.34%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.78%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300027063Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes)EnvironmentalOpen in IMG/M
3300027090Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070670_10088528213300005331Switchgrass RhizosphereMNGFSRLAFVETKLFLRETGAAIGVFGLPVALVIGFCLIPGFSDPQKSLSGQI
Ga0070714_10061459513300005435Agricultural SoilMNGFGRLTLTETRLFLREQAAAIGVFGLPVALVIGFGLIP
Ga0070713_10228478013300005436Corn, Switchgrass And Miscanthus RhizosphereMNGFSRLAYVETKLFLRETGAAIGVFGLPVALVIGFGLIPGF
Ga0070663_10013323133300005455Corn RhizosphereMNGFSRLAFVETKLFLREKAAAISVFGLPVALVIGFGLIP
Ga0070702_10008076033300005615Corn, Switchgrass And Miscanthus RhizosphereMNGFSRLAFVETKLFLRETGAAIGVFGLPVALVIGFGLIPGFSDPQKSL
Ga0068861_10002535053300005719Switchgrass RhizosphereMNGFSRLAFVETKLFLRETGAAIGVFGLPVALVIGFGLIPGFSDPQK
Ga0066790_10000945143300005995SoilMNGFGRLAYVETKLFLREKTATLAVFGLPLALVIGFGLIPGFGQPQKGLSG
Ga0070765_10155405313300006176SoilMNGFSRLALVEGKLFLREKAALIGVFGLPVALVIG
Ga0074051_1164123213300006572SoilMNGFSRLAFVETKLFLRETGAAIGVFGLPVALVIGFGLIP
Ga0074056_1174666223300006574SoilMNGFSRLAFVETKLFLRETGAAIGVFGLPVALVIGFGLIPGFG
Ga0073928_1097668823300006893Iron-Sulfur Acid SpringMTGYSRLAAVEARLFLRERAGLIGVFGLPVGLVVGFGLIPGFSDPQKSLSG
Ga0116221_130894823300009523Peatlands SoilMNGFSRLAVVEARLFLREKAALIGVFGLPVALVLGFGLIPGFSDPQKGLSDQLGTEY
Ga0116133_102694533300009623PeatlandMNGFSRLTFTETKLFLRETGAAIGVFGLPVALVIGFGLIPGFGD
Ga0116224_1048859213300009683Peatlands SoilMNGFSRLAFVETKLFLREKAATVAVFGLPVALVIGFGLIPGFGQPQKGLSDQI
Ga0116223_1075986113300009839Peatlands SoilMNGFSRLAVVEARLFLREKAALIGVFGLPVALVLGFGLIPGFSDPQKGLSDQLGTEYIAAVGVA
Ga0126379_1296061013300010366Tropical Forest SoilMNGFSRLAYVEAKLFLRETGAAIGVFGLPVALVIGFGLI
Ga0126381_10208909613300010376Tropical Forest SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIG
Ga0134126_1114308123300010396Terrestrial SoilMNGFSRLTAVEARLFLRERASLIAVFGLPVALVIGFGLIPGFS
Ga0151489_117736513300011106SoilMNGFSRLAYVETKLFLRETGAAIAVFGLPVALVIGFGLIP
Ga0137388_1050580123300012189Vadose Zone SoilMNGFSRLAFVETKLFLRERAAAVAVFGLPVALVIGFGLIP
Ga0164309_1003798843300012984SoilMNGFSRLAFVETKLFLRETGAAIGVFGLPVALVIGFGLIPGFSDPQKSLS
Ga0182041_1149645113300016294SoilMNGFSRLAYVETKLFLREKAAAISVFGLPVALVIGFGLIP
Ga0182035_1210321913300016341SoilMNGFSKLAFVETKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQV
Ga0182039_1174955613300016422SoilMTGFSRLALVEGKLFLREKAALIGVFGLPVGLIIGFGLIPGFSDPQKGLSDQIGTEYI
Ga0187806_111882823300017928Freshwater SedimentMNGFSRLAVVETRLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSD
Ga0187801_1048572113300017933Freshwater SedimentMSGFSRLALVEGRLFLREKAALIGVFGLPVALVIGFGLIPGFGDPQKGLSDQIGTEYIA
Ga0187775_1054118413300017939Tropical PeatlandMNGFSRLAYVETKLFLRETAAAIAVFGLPVALVIGFGL
Ga0187808_1041209423300017942Freshwater SedimentMNGFSRLAFVETKLFLREKAATLAVFGLPVALVIGFALIPGFGQPQKGLSD
Ga0187879_1063219223300017946PeatlandMNGFSRLAFVETKLFLREKAATLAVFGLPVALVIGFGLI
Ga0187783_1054287913300017970Tropical PeatlandMNGFSGLATTEAKLFLREKAAALAVFGLPVALVIGFGLIPGFSDPQKSLS
Ga0187780_1110260413300017973Tropical PeatlandMSGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGL
Ga0187780_1136657013300017973Tropical PeatlandMNGFSRLALVDGKLFLRERAALLGVFGLPVGLVVGFGLIPGFGDPQKGLSDQIGTEYIAA
Ga0187780_1148610613300017973Tropical PeatlandMSGFSRLALVEGKLFLREKAALIGVFGLPVALVIG
Ga0187766_1007753913300018058Tropical PeatlandMNGFSRLAFVETKLFLREHAALAGVFGLPVALVIGFGLIPGF
Ga0187772_1017516013300018085Tropical PeatlandMNGFSRLAFVETKLFLREHAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQ
Ga0187769_1117627523300018086Tropical PeatlandMTGFGRLAFVESKLFLREKAALLGVFGLPLALVVGFGLIPGFGDPQKGLSNQIGTEYIASVGVAIV
Ga0193730_104658923300020002SoilMNGFSRLAFVETKLFLREKAAAISVFGLPVALVIGFGLIPGFGDP
Ga0206354_1021909523300020081Corn, Switchgrass And Miscanthus RhizosphereMNGFSRLAFVETKLFLRETGAAIGVFGLPVALVIGFG
Ga0210403_1138417513300020580SoilMNGFSRLAAVEARLFLRERAGLLAVFGLPVALVIGFGLIPGF
Ga0210403_1152571713300020580SoilMNGFSRLAYVETKLFLRETGAAIAVFGLPVALVIGF
Ga0210404_1089687113300021088SoilMNGFGRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQIGTEYIAA
Ga0210405_1107493523300021171SoilMNGFSRLAFVETKLFLREKAATLAVFGLPVALVIGFGLIPGFGQPQK
Ga0210396_1019774833300021180SoilLNGFSRLALVEGKLFLREKAALTGVFGLPVALVIGFGLIPGFSDP
Ga0213874_1010310113300021377Plant RootsMHGFSKLAFVETKLFLREKAALIGVFGLPVALVIGFGLIPGFS
Ga0210393_1024757333300021401SoilMNGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGF
Ga0210385_1029674623300021402SoilVNGFSRLTIVETRLFLRERVAALALFGLPVSLVIGFGLIPGFGKPQKGLSDQIGTEFI
Ga0210385_1133464713300021402SoilMNGFSKLAMVEGRLFLREKFAIIGVFAFPVGLVIAFGLIPGFSKPQKSLADQIGTEYIAGLG
Ga0210387_1117630013300021405SoilMNGFSRLAYVETKLFLRETGAAIGVFGLPVALVIGFG
Ga0210394_1132788813300021420SoilMNGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQK
Ga0210384_1122587813300021432SoilMNGFSRLAFVETKLFLREKAATLAVFGLPVALVIGFGLIP
Ga0210390_1053116323300021474SoilLNGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQ
Ga0210402_1036583723300021478SoilMNGFSRLAYVETKLFLRETGAAIGVFGLPVALVIGFGLIPG
Ga0210402_1056902023300021478SoilMNGFGRLAFVETKLFLREKAATLAVFGLPVALVIGFGLIPGFGQPQKSL
Ga0210402_1153399723300021478SoilMNGFSRLAYVETKLFLRETGAAIGVFGLPVALVIGFGLIPGFGDPQK
Ga0210410_1025896313300021479SoilLNGFSRLALVEGKLFLREKAALTGVFGLPVALVIGFGLIPGF
Ga0210409_1105717413300021559SoilMDGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQIG
Ga0213851_130074513300021860WatershedsMNGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQIGTEYIAALGV
Ga0213851_160850013300021860WatershedsMNGFSRLAFVETKLFLREKAATLAVFGLPVALVIGFGLIPGFGQPQ
Ga0247693_104877823300024181SoilMNGFSRLAFVETKLFLRETGAAIGVFGLPVALVIGFGLI
Ga0207664_1038961323300025929Agricultural SoilMNGFGRLALTETRLFLREQAAAIGVFGLPVALVIGFGLIPG
Ga0207665_1150839923300025939Corn, Switchgrass And Miscanthus RhizosphereMDGFSRLAYVETKLFLRETGAAIGVFGLPVALIIGFGLIPGFGDPQK
Ga0257160_101126223300026489SoilMNGFSRLTLVEGKLFLREKAALIGVFGLPVALVIGFGLIP
Ga0207762_104492913300027063Tropical Forest SoilMNGFSKLAFVETKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSEQIGTEYIAAVGV
Ga0208604_100884123300027090Forest SoilMDGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQI
Ga0207862_106193423300027703Tropical Forest SoilMTGFSRLAFVEAKLFLREKAALIGVFGLPVALVIGFG
Ga0209073_1032259723300027765Agricultural SoilMDGFSRLAYVETKLFLRETGAAIGVFGLPVALVIGFGL
Ga0209275_1054409413300027884SoilMNGFARLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGF
Ga0209380_1006882833300027889SoilMDGFSRLALVETKLFLRERAAAVAVFGLPVALVIGFGLI
Ga0302229_1011763833300028879PalsaMTGFNKLAFVETKLFLREKAATLAVFALPLALVLGFGLIPGFDKPQKGLSDQ
Ga0311338_1197828013300030007PalsaMTGFNKLAFVETKLFLREKAATLAVFALPLALVLGFGL
Ga0302181_1028041923300030056PalsaMTGFNKLAFVETKLFLREKAATLAVFALPLALVLGFGLIPGFDKPQKGLSDQIGTE
Ga0311355_1028903633300030580PalsaMTGFNKLAFVETKLFLREKAATLAVFALPLALVLGFGLIPGFDKPQKGLSDQI
Ga0302326_1355569623300031525PalsaMTGFNKLAFVETKLFLREKAATLAVFALPLALVLGFGLIPGFDKPQKGLSDQIGTEYIASIGVAIVLV
Ga0318516_1047055213300031543SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQ
Ga0310915_1043717313300031573SoilMNGFGKLTLVEGRLFLREKAALIGVFGLPVGLVLGFGLIPGFSDPQKGLSDQIGTEYIAA
Ga0318555_1015256613300031640SoilMTGFSRLAVVETRLFLREKAALLGVFGLPVALGIGFGLIPG
Ga0318555_1024215823300031640SoilMNGFSKLAFVETKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQVGTEYIAAVG
Ga0318555_1076807623300031640SoilMNGFSRLAVVETRLFLREKAALIGVFGLPVALVIGFGLI
Ga0318542_1055361013300031668SoilMNGFSKLAFVETKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQVGTEYIA
Ga0318542_1059937713300031668SoilMSGFSRLTFVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFGDAQKGLSDQIGTEYI
Ga0318542_1076446313300031668SoilMNGFSRLAYVETKLFLREKAAAIGVFGLPVALVIGFGLIPGF
Ga0318500_1006240313300031724SoilMSGFSRLTVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQIGTEY
Ga0318500_1065855923300031724SoilMTGFSRLTLVEGKLFLREKSALLGVFGLPVALVIGFGLIPGFSSPQKGLSDQIGTPV
Ga0318502_1091166213300031747SoilMNGFSKLAFVETKLFLREKAALIGVFGLPVALVIGFGLIPGFSDP
Ga0318492_1002409813300031748SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSD
Ga0318492_1022660023300031748SoilMTGFSRLTLVEGKLFLREKSALLGVFGLPVALVIGFGLIPGFSSPQ
Ga0318554_1017136423300031765SoilMTGFSRLAVVETRLFLREKAALLGVFGLPVALVIGFGLIPGFSDPQKSLSG
Ga0318509_1027283513300031768SoilMNGFSRLAYVETKLFLREKAAAIAVFGLPVALVIGFGLIPGFGDPQKN
Ga0318526_1038070223300031769SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQIGTE
Ga0318546_1132941023300031771SoilMNGFSRLAVVETRLFLREKAALIGVFGLPVALVIGFGLIPG
Ga0318547_1035230313300031781SoilMTGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFG
Ga0318552_1003014713300031782SoilMSGFSRLTVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSD
Ga0318548_1046062623300031793SoilMSGFSRLTFVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFGDPQKGLSDQIG
Ga0318557_1005401633300031795SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKG
Ga0318576_1042121323300031796SoilMTGFSRLTLVEGKLFLREKSALLGVFGLPVALVIGFGLIPGFSSPQKGLSDQIGTEFIAGLGVAV
Ga0318550_1029209513300031797SoilMTGFSRLAVVETRLFLREKAALLGVFGLPVALVIGFGLIPGF
Ga0318497_1083590623300031805SoilMNGFSRLAYVETKLFLREKAAAISVFGLPVALVIGFGLIPGFGD
Ga0318568_1078907313300031819SoilMTGFSRLTLVEGKLFLREKSALLGVFGLPVALVIGFGLIPG
Ga0318499_1039266623300031832SoilMTGFSRLALVEGKLFLREKAALIGVFGLPVGLIIGFGLIPGFS
Ga0318512_1022617213300031846SoilMNGFSRLAYVETKLFLREKAAAIAVFGLPVALVIGFGLIPGFGDPQKNL
Ga0318512_1037816113300031846SoilMTGFSRLTLVEGKLFLREKSALLGVFGLPVALVIGFGLIPGFSSPQKGLSD
Ga0318495_1045201923300031860SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIGFGLIP
Ga0318544_1013128523300031880SoilMSGFSRLTVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLS
Ga0318522_1039049113300031894SoilMNGFSKLAFVETKLFLREKAALIGVFGLPVALVIGFGLI
Ga0306926_1239399713300031954SoilMNGFSRLAYVETKLFLRETAAAIAVFGLPVALVIGFGLIPGF
Ga0306926_1287803613300031954SoilVTGFSRLALVEGKLFLREKAALLGVFGLPVALVIGFGLIPGFSDPQKG
Ga0318530_1001666643300031959SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQIG
Ga0318531_1048956823300031981SoilMNGFSRLAYVETKLFLREKAAAISVFGLPVALVIGFGL
Ga0318549_1006348733300032041SoilMTGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGF
Ga0318556_1060380713300032043SoilMSGFSRLTVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQ
Ga0318558_1014383723300032044SoilMTGFSRLALVEGKLFLREKAALIGVFGLPVGLIIGFGLIPGFSDPQKGLSDQIGTEFIAALG
Ga0318558_1061031513300032044SoilMTGFSRLAVVETRLFLREKAALLGVFGLPVALVIGFGLIPGFSDP
Ga0318575_1017717423300032055SoilMNGFSKLAFVETKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKG
Ga0318504_1009684633300032063SoilMSGFSRLTVVEGKLFLREKAALIGVFGLPVALVIG
Ga0318513_1015910413300032065SoilMTGFSRLAVVETRLFLREKAALLGVFGLPVALVIGFGLIPG
Ga0318553_1057114823300032068SoilMTGFSRLALVEGKLFLREKAALIGVFGLPVALVIG
Ga0306924_1226303313300032076SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGL
Ga0318525_1005445813300032089SoilMSGFSRLTFVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFGDPQKGLSDQI
Ga0318525_1067152413300032089SoilMTGFSRLTLVEGKLFLREKSALLGVFGLPVALVIGFGLIPGFSSPQKGLSDQIGT
Ga0318518_1005865013300032090SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQK
Ga0318577_1025294323300032091SoilMNGFSRLAYVETKLFLREKAAAIAVFGLPVALVIGFGLIPGFGDPC
Ga0311301_1064057833300032160Peatlands SoilMNGFSRLALVEGKLFLREKAALIGVFGLPVALVLGFGLI
Ga0311301_1146333413300032160Peatlands SoilMNGFSRLAFVETKLFLREKAATLAVFGLPVALVIGFGLIPGFGRPQKGLSDQ
Ga0311301_1295243113300032160Peatlands SoilMNGFGKLALVEGRLFLREKAALIGVFGLPVALVLGFGLIP
Ga0306920_10304556023300032261SoilMTGFSRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQIG
Ga0335075_1140065113300032896SoilMSGFGRLALVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSD
Ga0335077_1128593623300033158SoilMNGFSRLAVVETRLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLS
Ga0318519_1076438523300033290SoilMSGFSRLAVVEGKLFLREKAALIGVFGLPVALVIGFGLIPGFSDPQKGLSDQIGTEY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.