Basic Information | |
---|---|
Family ID | F064760 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 40 residues |
Representative Sequence | AESVAGASRHLIDGAGHMPHMERPAEVQAAIEETIARAG |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.34 % |
% of genes near scaffold ends (potentially truncated) | 94.53 % |
% of genes from short scaffolds (< 2000 bps) | 92.19 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (80.469 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.312 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.125 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.969 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.39% β-sheet: 0.00% Coil/Unstructured: 77.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF01370 | Epimerase | 29.69 |
PF07993 | NAD_binding_4 | 14.06 |
PF00106 | adh_short | 4.69 |
PF03176 | MMPL | 2.34 |
PF12146 | Hydrolase_4 | 2.34 |
PF13463 | HTH_27 | 1.56 |
PF13784 | Fic_N | 0.78 |
PF13419 | HAD_2 | 0.78 |
PF00528 | BPD_transp_1 | 0.78 |
PF01590 | GAF | 0.78 |
PF02887 | PK_C | 0.78 |
PF03706 | LPG_synthase_TM | 0.78 |
PF09350 | DJC28_CD | 0.78 |
PF13738 | Pyr_redox_3 | 0.78 |
PF03704 | BTAD | 0.78 |
PF13649 | Methyltransf_25 | 0.78 |
PF08241 | Methyltransf_11 | 0.78 |
PF01266 | DAO | 0.78 |
PF07366 | SnoaL | 0.78 |
PF00211 | Guanylate_cyc | 0.78 |
PF09335 | SNARE_assoc | 0.78 |
PF13472 | Lipase_GDSL_2 | 0.78 |
PF05977 | MFS_3 | 0.78 |
PF00400 | WD40 | 0.78 |
PF02601 | Exonuc_VII_L | 0.78 |
PF12802 | MarR_2 | 0.78 |
PF14016 | DUF4232 | 0.78 |
PF00196 | GerE | 0.78 |
PF13561 | adh_short_C2 | 0.78 |
PF07729 | FCD | 0.78 |
PF00390 | malic | 0.78 |
PF00756 | Esterase | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 2.34 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 2.34 |
COG0281 | Malic enzyme | Energy production and conversion [C] | 0.78 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.78 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.78 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.78 |
COG1570 | Exonuclease VII, large subunit | Replication, recombination and repair [L] | 0.78 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.78 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.78 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.78 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.78 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.78 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.47 % |
Unclassified | root | N/A | 19.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003505|JGIcombinedJ51221_10056611 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
3300005435|Ga0070714_102065522 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005439|Ga0070711_101534393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
3300005467|Ga0070706_100155958 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
3300005563|Ga0068855_100855357 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300005591|Ga0070761_10037942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2699 | Open in IMG/M |
3300005602|Ga0070762_10216229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1178 | Open in IMG/M |
3300005713|Ga0066905_100804806 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300005718|Ga0068866_11298948 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005764|Ga0066903_104321047 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300005842|Ga0068858_100271644 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
3300005843|Ga0068860_101825555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
3300006028|Ga0070717_10076248 | All Organisms → cellular organisms → Bacteria | 2806 | Open in IMG/M |
3300006028|Ga0070717_12129791 | Not Available | 504 | Open in IMG/M |
3300006358|Ga0068871_100512053 | Not Available | 1083 | Open in IMG/M |
3300006358|Ga0068871_100705525 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300006804|Ga0079221_10318956 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300006806|Ga0079220_11527851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 574 | Open in IMG/M |
3300006954|Ga0079219_10478058 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300006954|Ga0079219_11741921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300007076|Ga0075435_101786539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
3300009089|Ga0099828_10122750 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
3300009137|Ga0066709_101047181 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300009143|Ga0099792_10739736 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300009143|Ga0099792_11125144 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300009522|Ga0116218_1518799 | Not Available | 531 | Open in IMG/M |
3300009551|Ga0105238_10491411 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
3300009672|Ga0116215_1290386 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300009698|Ga0116216_10332609 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300010046|Ga0126384_10073484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2437 | Open in IMG/M |
3300010046|Ga0126384_11264990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 683 | Open in IMG/M |
3300010048|Ga0126373_10370620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella flava | 1449 | Open in IMG/M |
3300010048|Ga0126373_10385744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1422 | Open in IMG/M |
3300010048|Ga0126373_13215416 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300010341|Ga0074045_10598121 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300010360|Ga0126372_11559660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
3300010371|Ga0134125_12987928 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300010376|Ga0126381_101234705 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300010396|Ga0134126_12927921 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300010880|Ga0126350_11001248 | Not Available | 929 | Open in IMG/M |
3300012198|Ga0137364_10653736 | Not Available | 793 | Open in IMG/M |
3300012199|Ga0137383_10199157 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300012206|Ga0137380_10465815 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300012208|Ga0137376_10291946 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300012209|Ga0137379_11507243 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300012489|Ga0157349_1027316 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300012582|Ga0137358_10566260 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300012971|Ga0126369_11387171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 793 | Open in IMG/M |
3300012971|Ga0126369_11905761 | Not Available | 683 | Open in IMG/M |
3300012971|Ga0126369_12593002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
3300012971|Ga0126369_12601663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
3300013297|Ga0157378_10656533 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300014199|Ga0181535_10756684 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300016294|Ga0182041_10166513 | Not Available | 1720 | Open in IMG/M |
3300016319|Ga0182033_10250602 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
3300016319|Ga0182033_10953312 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300016341|Ga0182035_10642979 | Not Available | 920 | Open in IMG/M |
3300016357|Ga0182032_10242728 | Not Available | 1396 | Open in IMG/M |
3300016371|Ga0182034_11804383 | Not Available | 539 | Open in IMG/M |
3300016445|Ga0182038_10156399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1747 | Open in IMG/M |
3300016445|Ga0182038_10589951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 958 | Open in IMG/M |
3300017926|Ga0187807_1302253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
3300017932|Ga0187814_10069321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
3300017942|Ga0187808_10172002 | Not Available | 959 | Open in IMG/M |
3300017959|Ga0187779_11026131 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300017961|Ga0187778_11292036 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300018043|Ga0187887_10589800 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300020062|Ga0193724_1101770 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300021358|Ga0213873_10310471 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300021433|Ga0210391_10681516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
3300021439|Ga0213879_10177091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella flava | 628 | Open in IMG/M |
3300021444|Ga0213878_10156270 | Not Available | 948 | Open in IMG/M |
3300021559|Ga0210409_10269937 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300021560|Ga0126371_11620584 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300025898|Ga0207692_10225294 | Not Available | 1113 | Open in IMG/M |
3300025916|Ga0207663_10210586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1408 | Open in IMG/M |
3300025922|Ga0207646_10077253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2976 | Open in IMG/M |
3300025928|Ga0207700_11034412 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300025929|Ga0207664_10954071 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300025960|Ga0207651_10841545 | Not Available | 815 | Open in IMG/M |
3300025972|Ga0207668_10425457 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300026551|Ga0209648_10509871 | Not Available | 692 | Open in IMG/M |
3300027064|Ga0208724_1022678 | Not Available | 631 | Open in IMG/M |
3300027696|Ga0208696_1157391 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300027765|Ga0209073_10297768 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300028780|Ga0302225_10364795 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300030399|Ga0311353_10652490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 914 | Open in IMG/M |
3300030494|Ga0310037_10045743 | Not Available | 2088 | Open in IMG/M |
3300030494|Ga0310037_10113050 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300030707|Ga0310038_10372972 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300031616|Ga0307508_10693953 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300031716|Ga0310813_10665946 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300031724|Ga0318500_10062961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1610 | Open in IMG/M |
3300031724|Ga0318500_10069700 | Not Available | 1542 | Open in IMG/M |
3300031771|Ga0318546_10352623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1024 | Open in IMG/M |
3300031793|Ga0318548_10294213 | Not Available | 798 | Open in IMG/M |
3300031793|Ga0318548_10515374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella flava | 584 | Open in IMG/M |
3300031796|Ga0318576_10323631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 728 | Open in IMG/M |
3300031799|Ga0318565_10208199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 951 | Open in IMG/M |
3300031805|Ga0318497_10549443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 647 | Open in IMG/M |
3300031832|Ga0318499_10269864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 659 | Open in IMG/M |
3300031833|Ga0310917_10978448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella flava | 568 | Open in IMG/M |
3300031846|Ga0318512_10296546 | Not Available | 803 | Open in IMG/M |
3300031846|Ga0318512_10561725 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300031896|Ga0318551_10165382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
3300031946|Ga0310910_11221233 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300031954|Ga0306926_11434191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 800 | Open in IMG/M |
3300031954|Ga0306926_12110193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
3300031959|Ga0318530_10508999 | Not Available | 501 | Open in IMG/M |
3300031962|Ga0307479_11775262 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300032009|Ga0318563_10385335 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300032041|Ga0318549_10052582 | Not Available | 1685 | Open in IMG/M |
3300032043|Ga0318556_10654058 | Not Available | 547 | Open in IMG/M |
3300032044|Ga0318558_10337754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella flava | 747 | Open in IMG/M |
3300032065|Ga0318513_10169230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1047 | Open in IMG/M |
3300032089|Ga0318525_10006588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5025 | Open in IMG/M |
3300032089|Ga0318525_10135873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis balhimycina | 1260 | Open in IMG/M |
3300032160|Ga0311301_10125356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4809 | Open in IMG/M |
3300032180|Ga0307471_101395882 | Not Available | 861 | Open in IMG/M |
3300032261|Ga0306920_102307001 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300032261|Ga0306920_103697085 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300032805|Ga0335078_12540583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300032828|Ga0335080_11885384 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300032896|Ga0335075_10060659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5198 | Open in IMG/M |
3300033158|Ga0335077_11537737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 635 | Open in IMG/M |
3300033289|Ga0310914_11222556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 653 | Open in IMG/M |
3300033290|Ga0318519_10738123 | Not Available | 603 | Open in IMG/M |
3300033475|Ga0310811_10707476 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.38% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.03% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.12% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.56% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.56% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.78% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.78% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.78% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ51221_100566112 | 3300003505 | Forest Soil | AESVAGAVRYLVDGAGHMPHMERPAQVQAAIEETIARAGGAEELP* |
Ga0070714_1020655221 | 3300005435 | Agricultural Soil | AQAEAVTGADRHLIDRAGHMPHMERPAEVQAAIEQTIARAT* |
Ga0070711_1015343932 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RGDRIIPAAQAEAVTGAVSHLIDDAGHMPQMERPAEVQAAIEETIARAG* |
Ga0070706_1001559583 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ILPAAQAGSVAGAVRYLLDGAGHMPHMERPAEVQAAIEETIARA* |
Ga0068855_1008553572 | 3300005563 | Corn Rhizosphere | QAESVTGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAS* |
Ga0070761_100379421 | 3300005591 | Soil | GAVRHVIDGAGHMPHMERPSEVQAAIEEAITGAADFA* |
Ga0070762_102162293 | 3300005602 | Soil | GAAVHLLDGAGHMAHLERPAEVQAAIEEAIATAPPG* |
Ga0066905_1008048062 | 3300005713 | Tropical Forest Soil | VIPAAQAESVAGAVRHLLEGAGHMPHMERPAEVQAAIEETIARTT* |
Ga0068866_112989482 | 3300005718 | Miscanthus Rhizosphere | SVTGAVRHLIDGAGHMPQMERPAEVQAAIEETIAGAG* |
Ga0066903_1043210472 | 3300005764 | Tropical Forest Soil | VAGADRHLLDDAGHMPHMERPAEVQAAIEEAIAKAG |
Ga0068858_1002716443 | 3300005842 | Switchgrass Rhizosphere | SVTGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG* |
Ga0068860_1018255551 | 3300005843 | Switchgrass Rhizosphere | PAAQAEAVTGAVSHLIDDAGHMPQMERPAEVQAAIEETIARAG* |
Ga0070717_100762484 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RSVAGAARHLIDGAGHMPHLERPAEVRAAIEETIARAP* |
Ga0070717_121297912 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IPPAQAESVAGAARHLIDGAGHMPHMERPAEVQAAVEESIARAG* |
Ga0068871_1005120531 | 3300006358 | Miscanthus Rhizosphere | AGAARHLIDGAGHMPHMERPAEVQAAVEESIARAG* |
Ga0068871_1007055251 | 3300006358 | Miscanthus Rhizosphere | SVTGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAS* |
Ga0079221_103189561 | 3300006804 | Agricultural Soil | VTGADRHLIDRAGHMPHMERPAEVQAAIEQTIARAT* |
Ga0079220_115278511 | 3300006806 | Agricultural Soil | GADRHLIDRAGHMPHMERPAEVQAAIEQTIARAT* |
Ga0079219_104780582 | 3300006954 | Agricultural Soil | VMGADRHLIEGAGHMPHMERPAEVQAAIEQTIARAT* |
Ga0079219_117419212 | 3300006954 | Agricultural Soil | AVTGADRHLIDRAGHMPHMERPAEVQAAIEQTIARAT* |
Ga0075435_1017865391 | 3300007076 | Populus Rhizosphere | AQAEAVTGAVSHLIDDAGHMPQMERPAEVQAAIEETIARAG* |
Ga0099828_101227503 | 3300009089 | Vadose Zone Soil | VPGAVSHLLDGAGHMPHMERPAEVQAAIEETIARAG* |
Ga0066709_1010471811 | 3300009137 | Grasslands Soil | DRIIPAAQAEAVTGAVSHLIDNAGHMPQMERPAEVQAAIEETIARAP* |
Ga0099792_107397361 | 3300009143 | Vadose Zone Soil | TGAVSRLIDDAGHMPQMERPAEVQAAIAETIARAG* |
Ga0099792_111251442 | 3300009143 | Vadose Zone Soil | PPAQAESVAGAVCYLLDGAGHMPHMERPAEVQAAIEEAMARAG* |
Ga0116218_15187991 | 3300009522 | Peatlands Soil | LHIEDAEVVTGAVRHLVDGAGHMPHTERPADVRAAIEETIASAG* |
Ga0105238_104914112 | 3300009551 | Corn Rhizosphere | GAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG* |
Ga0116215_12903862 | 3300009672 | Peatlands Soil | VQAESAAGAVRHLIDGTGQMPHMERPAEVQAAIEETIARST* |
Ga0116216_103326092 | 3300009698 | Peatlands Soil | AAQAESVTGAVRHLIDGAGHMPHMERPAEVQAAIEETIARST* |
Ga0126384_100734845 | 3300010046 | Tropical Forest Soil | EEAIFPAAQAEAVPGTVRVLVDGAGHMPHMERPAAVQAAIEAAVARAS* |
Ga0126384_112649901 | 3300010046 | Tropical Forest Soil | IIPPAQAESVAGAVRHLVDGAGHMPHMERPAEVQAAIEETIARSG* |
Ga0126373_103706201 | 3300010048 | Tropical Forest Soil | IIPAGQAAAVTAADPSAVVRVIDGAGHMPHLERPAESLTAIADTIARAG* |
Ga0126373_103857443 | 3300010048 | Tropical Forest Soil | VCGCWPDGVIPAAQAESVAGAVRHLLEGAGHMPHMERPAEVQAAIEETIARTT* |
Ga0126373_132154162 | 3300010048 | Tropical Forest Soil | PAAQAESVSGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG* |
Ga0074045_105981212 | 3300010341 | Bog Forest Soil | AESVAGAARHLIDGAGHMPHMERPAEVQAAIEETIARST* |
Ga0126372_115596601 | 3300010360 | Tropical Forest Soil | VAGADRHLLDDAGHMPHMERPAEVQAAIEEAIAKAG* |
Ga0134125_129879281 | 3300010371 | Terrestrial Soil | AQAESVTGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG* |
Ga0126381_1012347052 | 3300010376 | Tropical Forest Soil | ESVAGAVRHVIDGAGHMPQMERPAEVQAAIEESIARAS* |
Ga0134126_129279212 | 3300010396 | Terrestrial Soil | PAAQAESVTGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG* |
Ga0126350_110012482 | 3300010880 | Boreal Forest Soil | VDGAVSRLIEGAGHMAHMERPAEGQAAIEETIARAS* |
Ga0137364_106537362 | 3300012198 | Vadose Zone Soil | AGAARHLLDGAGHMPHMERPAEVQAAIEETIARAG* |
Ga0137383_101991571 | 3300012199 | Vadose Zone Soil | RIIPAAQAGSVTGAVSHLIDGAGHMPQMERPTEVQAAIEETIARAG* |
Ga0137380_104658152 | 3300012206 | Vadose Zone Soil | IPAAQAESVAGAVRHLIDGAGHMPHMERPAEVQAAIEETIARTG* |
Ga0137376_102919463 | 3300012208 | Vadose Zone Soil | RIIPAAQAESVAGAVRRLIDGAGHMPQMERPDELQAAIEETIARAG* |
Ga0137379_115072431 | 3300012209 | Vadose Zone Soil | DAVTGAVRHLIDGAGHMPQMERPAEVQAAIEETLARAG* |
Ga0157349_10273161 | 3300012489 | Unplanted Soil | VSGVVRHVIDGAGHMPQMERPADVQAAIEETIARTG* |
Ga0137358_105662601 | 3300012582 | Vadose Zone Soil | IPAAQAEAVTGAVSRLIDDAGHMPQMERPAEVQAAIEETIARAG* |
Ga0126369_113871711 | 3300012971 | Tropical Forest Soil | QIIPATQAGSVAGAVRQVLDGAGHMPHMERPAEVQAAIEETIARTP* |
Ga0126369_119057611 | 3300012971 | Tropical Forest Soil | GAVRQMLDGAGHMPHMERPAEVKAAIEETIARTP* |
Ga0126369_125930022 | 3300012971 | Tropical Forest Soil | GQAESVEGASRHLVDGAGHMPHMERPAEVQAAIEEAITRAG* |
Ga0126369_126016632 | 3300012971 | Tropical Forest Soil | VEGASRHLVDGAGHMPHMERPAEVQAAIEETITRAG* |
Ga0157378_106565332 | 3300013297 | Miscanthus Rhizosphere | IPAAQAESVTGAVRHVIDGAGHMPQMERPAEVQAAIEETIAGAG* |
Ga0181535_107566841 | 3300014199 | Bog | AESVTGAVRHLIDDAGHMPHMERPAEVQAAIEATIARST* |
Ga0182041_101665131 | 3300016294 | Soil | QAEGMTGAVRYLVDGAGHMPHMEKPAEVQAAIEETIARVR |
Ga0182033_102506023 | 3300016319 | Soil | PATQAGSVAGAVRQLLDGAGHLPHMERPAEVQAAIEETIARTP |
Ga0182033_109533122 | 3300016319 | Soil | VPGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG |
Ga0182035_106429792 | 3300016341 | Soil | AEQARSVAGASSRLIDGAGHMAHMERPAEVQAAIEETIAGR |
Ga0182032_102427281 | 3300016357 | Soil | VAGAVRQLLDGAGHLPHMERPAEVQAAIEETIARTP |
Ga0182034_118043831 | 3300016371 | Soil | QAESVAGASHHLIDGAGHMPHMERPAEVQAAIEETIARAG |
Ga0182038_101563991 | 3300016445 | Soil | PAAQAESVTGAVRYLVDGAGHMPHMERPAQVQAAIEETIARAG |
Ga0182038_105899512 | 3300016445 | Soil | QSATGAARYLVDGAGHMPHMERPGEVQAAIEETIARAGA |
Ga0187807_13022531 | 3300017926 | Freshwater Sediment | ESVTGAVRYLIDGAGHMPHMERPGEVQAAIEEAIARAG |
Ga0187814_100693211 | 3300017932 | Freshwater Sediment | ESITGAVRYLVDGAGHMPHMEKPAEVQAAIEETIARAR |
Ga0187808_101720021 | 3300017942 | Freshwater Sediment | ESVTGAVRYLVDGAGHMPHMERPGEVQAAIEETIARAG |
Ga0187779_110261312 | 3300017959 | Tropical Peatland | AGAVRHLIGRAGHMPHMERPAEVQAAIEETIARAT |
Ga0187778_112920362 | 3300017961 | Tropical Peatland | AQADSVAGAERRTIDDAGHMPHMERPAEVQAAIEETIARAG |
Ga0187887_105898002 | 3300018043 | Peatland | QADAVTGADHRLIDGAGHMPHMERPAEVQAAIEQTIARAT |
Ga0193724_11017702 | 3300020062 | Soil | IIPAAQAESVTGAVRHLIDGAGHMPQMERPAEVQAAIEETIARAG |
Ga0213873_103104711 | 3300021358 | Rhizosphere | AESVAGAERRLIDGAGHMPHMERPAEVQAAIEETIARST |
Ga0210391_106815161 | 3300021433 | Soil | GAAVHLLDGAGHMAHLERPAEVQAAIEEAIAAAPPG |
Ga0213879_101770911 | 3300021439 | Bulk Soil | AAPGADIRVIDGAGHMPHMERPAEAQAAVEGAIARAG |
Ga0213878_101562703 | 3300021444 | Bulk Soil | VPAAQAQSVPGAVRVLVDGAGHMPHMERPAAVQAAIEQAIAAAARS |
Ga0210409_102699373 | 3300021559 | Soil | AVTGAVSHLIDDAGHMPQMERPAEVQAAIEETIARAG |
Ga0126371_116205841 | 3300021560 | Tropical Forest Soil | VPGAVRHVIDGAGHMPHMERPADVQAAIEETIARAG |
Ga0207692_102252942 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AQAESVADAARHLIDGAGHMPHMERPAEVQAAVEESIARAG |
Ga0207663_102105861 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ESVAGAARHLIDGAGHMPHMERPAEVQAAVEESIARAG |
Ga0207646_100772531 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VADAIRVLVAGAGHMPHMERPAAVQAAIEAAIARAC |
Ga0207700_110344121 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGADRHLIDRAGHMPHMERPAEVQAAIEQTIARAT |
Ga0207664_109540712 | 3300025929 | Agricultural Soil | EAVTGADRHLIDRAGHMPHMERPAEVQAAIEQTIARAT |
Ga0207651_108415452 | 3300025960 | Switchgrass Rhizosphere | AESVAGAARHLIDGAGHMPHMERPAEVQAAVEESIARAG |
Ga0207668_104254572 | 3300025972 | Switchgrass Rhizosphere | SVTGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG |
Ga0209648_105098712 | 3300026551 | Grasslands Soil | VAGAVCYLLDGAGHMPHMERPAEVQAAIEEAIARAG |
Ga0208724_10226781 | 3300027064 | Forest Soil | IIPAAQAESVAGAVRYLIDGAGHMPQMERPAEVQAAIEETIARST |
Ga0208696_11573912 | 3300027696 | Peatlands Soil | PAAQAESVAGAVRHLIDGAGHLPHMERPAEVQAAIEETIARST |
Ga0209073_102977682 | 3300027765 | Agricultural Soil | QAESVTGAVRHLVDGAGHMPQMERPAEVQAAIEETIARAG |
Ga0302225_103647951 | 3300028780 | Palsa | AQAVAGAVRYVIEGAGHMPHMERPVEVQTAIEDTIARAG |
Ga0311353_106524901 | 3300030399 | Palsa | QAQAVAGAVRYVIEGAGHMPHMERPVEVQTAIEDTIARAG |
Ga0310037_100457432 | 3300030494 | Peatlands Soil | LHIEDAEVVTGAVRHLVDGAGHMPHTERPADVRAAIEETIASAG |
Ga0310037_101130501 | 3300030494 | Peatlands Soil | SVTGAVSHLVDGAGHMPHMERPAEVQAAIEETIARST |
Ga0310038_103729722 | 3300030707 | Peatlands Soil | QAESVSGAVRHLVDGAGHMPHMERPAEVQAAIEETIARST |
Ga0307508_106939531 | 3300031616 | Ectomycorrhiza | QAEAVTGADRRLIDGAGHMPHMERPAEVQAAIEETIARVP |
Ga0310813_106659461 | 3300031716 | Soil | SVTGAVRHLIDGAGHMPQMERPAGVQAAIEETIARAG |
Ga0318500_100629612 | 3300031724 | Soil | IPPAQAESVAGAVRHLVDDAGHMPHMERPAEVQAAIEEAITRAG |
Ga0318500_100697003 | 3300031724 | Soil | SVAGAVRQLLDGAGHLPHMERPAEVQAAIEETIARTP |
Ga0318546_103526231 | 3300031771 | Soil | AGAVRHLLDDAGHMPHMERPAEVQAAIEEAITRAG |
Ga0318548_102942131 | 3300031793 | Soil | AESVAGAVHRLLDDTGHMPHMERPAEVQAAIEETIARAR |
Ga0318548_105153741 | 3300031793 | Soil | VAPGAAVRVIDGAGHMPHMERPAEAQAAVEETIARAG |
Ga0318576_103236312 | 3300031796 | Soil | AESVTGAVRYLVDGAGHMPHMERPAQVQAAIEETIARAG |
Ga0318565_102081992 | 3300031799 | Soil | AEAVAGAGRHLIDGAGHMPHMERPAEVQAAIEETIAGSG |
Ga0318497_105494431 | 3300031805 | Soil | VSGAVRYLVDGAGHMPHMERPAQVQAAVEETIARAG |
Ga0318499_102698642 | 3300031832 | Soil | SGAVRYLVDGAGHMPHMERPAQVQAAVEETIARAG |
Ga0310917_109784482 | 3300031833 | Soil | VAAVAPGAAVRVIDGAGHMPHMERPAEAQAAVEETIARAG |
Ga0318512_102965461 | 3300031846 | Soil | AVSGAASHLIDGAGHMAHMERPAEVQAAIEQTIAGR |
Ga0318512_105617252 | 3300031846 | Soil | LHLRHVPGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG |
Ga0318551_101653822 | 3300031896 | Soil | AVAGAVSYLLDGAGHMPHMERPAEVQTAIEETIARARLLPPKQVP |
Ga0310910_112212331 | 3300031946 | Soil | PAAQAESVPGAVRHVNDGAGHMPQMERPAEVQAAIEETIARAG |
Ga0306926_114341911 | 3300031954 | Soil | AGAVRHLIDGAGHMPHMERPAEVQAAIEETIARSS |
Ga0306926_121101931 | 3300031954 | Soil | IPATQAGSLAGAVRHMLDGAGHMPHMERPAEVQAAIEETIARTP |
Ga0318530_105089991 | 3300031959 | Soil | AAQAESVTGAVRYLVDGAGHMPHMERPGEVQAAIEETIARAE |
Ga0307479_117752621 | 3300031962 | Hardwood Forest Soil | ADRIIPAAQAESVTGAVRHLIDGAGHLPHMERPAEVQAAIEETIARST |
Ga0318563_103853352 | 3300032009 | Soil | RHVPGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG |
Ga0318549_100525821 | 3300032041 | Soil | PAGQAGSVAVAASYVIDGAGHMAHMERPAEVQAAIEETIAGR |
Ga0318556_106540583 | 3300032043 | Soil | IPAAQAGSVAGAVSYLLDGAGHMPHMERPAEVQAAIEETIARAS |
Ga0318558_103377542 | 3300032044 | Soil | HVPRAVAPGAAVRVIDGAGHMPHMERPAEAQAAVEETIARAG |
Ga0318513_101692302 | 3300032065 | Soil | ESVAGAVRHLLDDAGHMPHMERPAEVQAAIEEAITRAG |
Ga0318525_100065881 | 3300032089 | Soil | AAVAPGAAVRVIDGAGHMPHMERPAEAQAAVEETIARAG |
Ga0318525_101358731 | 3300032089 | Soil | AQAGSVAGAVRYLVEGAGHMPHMERPGEVQAAIEETIARAG |
Ga0311301_101253563 | 3300032160 | Peatlands Soil | VQAESAAGAVRHLIDGTGQMPHMERPAEVQAAIEETIARST |
Ga0307471_1013958822 | 3300032180 | Hardwood Forest Soil | AESVAGASRHLIDGAGHMPHMERPAEVQAAIEETIARAG |
Ga0306920_1023070011 | 3300032261 | Soil | SAPGAVRHMIDGAGHMPQMERPAEVQAAIEETIARAG |
Ga0306920_1036970852 | 3300032261 | Soil | AQAESVAGAVRHVIDGAGHMPQMERPAEVQAAIEETIARAG |
Ga0335078_125405831 | 3300032805 | Soil | AQAQSVAGAARHLVDGAGHMPHMERPGEVQAAIEETIVRAG |
Ga0335080_118853841 | 3300032828 | Soil | SGAVRHVIDGAGHMPQMERPADVQAAIEETIARAG |
Ga0335075_100606597 | 3300032896 | Soil | SVPGAVRHLVDGAGHMPHMERPGEVQAAIEQAIARAS |
Ga0335077_115377371 | 3300033158 | Soil | VAGASRHLLDGAGHMPHMERPAEVQAAIEETIARAG |
Ga0310914_112225561 | 3300033289 | Soil | ESVSGAVRYLVDGAGHMPHMERPAQVQAAVEETIARAG |
Ga0318519_107381232 | 3300033290 | Soil | VAGAVRYLVDGAGHMPHMEKPAEVQAAIEETIARVR |
Ga0310811_107074761 | 3300033475 | Soil | SVTGAARHLIDGAGHMPQMERPAEVQAAIEETIARAG |
⦗Top⦘ |