Basic Information | |
---|---|
Family ID | F064758 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 49 residues |
Representative Sequence | VTALLAFLLLIVMLVIGARVRGVRDSFWKFLAFVVACVVVLALLLAILAQ |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 72.66 % |
% of genes near scaffold ends (potentially truncated) | 35.94 % |
% of genes from short scaffolds (< 2000 bps) | 82.81 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (59.375 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (28.125 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.344 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.156 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.97% β-sheet: 0.00% Coil/Unstructured: 41.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF00034 | Cytochrom_C | 3.91 |
PF04392 | ABC_sub_bind | 3.12 |
PF00571 | CBS | 3.12 |
PF01042 | Ribonuc_L-PSP | 2.34 |
PF00072 | Response_reg | 1.56 |
PF00582 | Usp | 1.56 |
PF01590 | GAF | 1.56 |
PF00239 | Resolvase | 1.56 |
PF03631 | Virul_fac_BrkB | 0.78 |
PF04314 | PCuAC | 0.78 |
PF03358 | FMN_red | 0.78 |
PF04909 | Amidohydro_2 | 0.78 |
PF04326 | AlbA_2 | 0.78 |
PF13374 | TPR_10 | 0.78 |
PF13240 | zinc_ribbon_2 | 0.78 |
PF01425 | Amidase | 0.78 |
PF00126 | HTH_1 | 0.78 |
PF13185 | GAF_2 | 0.78 |
PF12773 | DZR | 0.78 |
PF00589 | Phage_integrase | 0.78 |
PF13701 | DDE_Tnp_1_4 | 0.78 |
PF00118 | Cpn60_TCP1 | 0.78 |
PF01209 | Ubie_methyltran | 0.78 |
PF01569 | PAP2 | 0.78 |
PF06725 | 3D | 0.78 |
PF01145 | Band_7 | 0.78 |
PF00989 | PAS | 0.78 |
PF04172 | LrgB | 0.78 |
PF13191 | AAA_16 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.12 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.34 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.56 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.56 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.78 |
COG1346 | Putative effector of murein hydrolase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.78 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.78 |
COG2847 | Copper(I)-binding protein | Inorganic ion transport and metabolism [P] | 0.78 |
COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.38 % |
Unclassified | root | N/A | 40.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c1140472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1232 | Open in IMG/M |
3300004267|Ga0066396_10016933 | Not Available | 945 | Open in IMG/M |
3300004267|Ga0066396_10023742 | Not Available | 847 | Open in IMG/M |
3300004268|Ga0066398_10008199 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
3300004633|Ga0066395_10084313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1496 | Open in IMG/M |
3300004633|Ga0066395_10363450 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 807 | Open in IMG/M |
3300005174|Ga0066680_10008650 | All Organisms → cellular organisms → Bacteria | 5105 | Open in IMG/M |
3300005295|Ga0065707_10188925 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
3300005332|Ga0066388_100074520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3723 | Open in IMG/M |
3300005332|Ga0066388_100171007 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
3300005332|Ga0066388_101039840 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300005332|Ga0066388_102219037 | Not Available | 991 | Open in IMG/M |
3300005363|Ga0008090_11648839 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 724 | Open in IMG/M |
3300005440|Ga0070705_100456859 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300005536|Ga0070697_100025151 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4747 | Open in IMG/M |
3300005552|Ga0066701_10378216 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 876 | Open in IMG/M |
3300005713|Ga0066905_100128996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1781 | Open in IMG/M |
3300005713|Ga0066905_101720874 | Not Available | 576 | Open in IMG/M |
3300005713|Ga0066905_102016884 | Not Available | 536 | Open in IMG/M |
3300005764|Ga0066903_100103624 | All Organisms → cellular organisms → Bacteria | 3859 | Open in IMG/M |
3300005764|Ga0066903_100405427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2246 | Open in IMG/M |
3300005764|Ga0066903_100556281 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
3300005764|Ga0066903_101133950 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1445 | Open in IMG/M |
3300005764|Ga0066903_101353203 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5 | 1334 | Open in IMG/M |
3300005764|Ga0066903_103520128 | Not Available | 844 | Open in IMG/M |
3300005764|Ga0066903_104364055 | Not Available | 756 | Open in IMG/M |
3300005764|Ga0066903_108073395 | Not Available | 539 | Open in IMG/M |
3300006049|Ga0075417_10300029 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 779 | Open in IMG/M |
3300006358|Ga0068871_100746870 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300006852|Ga0075433_10176301 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1902 | Open in IMG/M |
3300006854|Ga0075425_102044965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
3300006914|Ga0075436_101558584 | Not Available | 502 | Open in IMG/M |
3300009094|Ga0111539_10920039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
3300009100|Ga0075418_11161094 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 836 | Open in IMG/M |
3300009147|Ga0114129_10042526 | All Organisms → cellular organisms → Bacteria | 6398 | Open in IMG/M |
3300009156|Ga0111538_13384432 | Not Available | 554 | Open in IMG/M |
3300009162|Ga0075423_10270356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1781 | Open in IMG/M |
3300009792|Ga0126374_10025618 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
3300009792|Ga0126374_10273705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1116 | Open in IMG/M |
3300010046|Ga0126384_11396567 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300010046|Ga0126384_11861010 | Not Available | 573 | Open in IMG/M |
3300010047|Ga0126382_12376505 | Not Available | 514 | Open in IMG/M |
3300010048|Ga0126373_12110247 | Not Available | 625 | Open in IMG/M |
3300010358|Ga0126370_10550744 | Not Available | 985 | Open in IMG/M |
3300010358|Ga0126370_10595200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 954 | Open in IMG/M |
3300010358|Ga0126370_10744751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 867 | Open in IMG/M |
3300010359|Ga0126376_10024808 | Not Available | 3973 | Open in IMG/M |
3300010359|Ga0126376_10241736 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300010359|Ga0126376_10341366 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1323 | Open in IMG/M |
3300010359|Ga0126376_10365759 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1285 | Open in IMG/M |
3300010359|Ga0126376_11343114 | Not Available | 737 | Open in IMG/M |
3300010359|Ga0126376_12034725 | Not Available | 617 | Open in IMG/M |
3300010360|Ga0126372_10951916 | Not Available | 866 | Open in IMG/M |
3300010360|Ga0126372_11156761 | Not Available | 796 | Open in IMG/M |
3300010361|Ga0126378_10700914 | Not Available | 1124 | Open in IMG/M |
3300010361|Ga0126378_10738190 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1095 | Open in IMG/M |
3300010361|Ga0126378_13146165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
3300010362|Ga0126377_10663241 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1093 | Open in IMG/M |
3300010362|Ga0126377_11905786 | Not Available | 670 | Open in IMG/M |
3300010366|Ga0126379_11930081 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
3300010366|Ga0126379_12643253 | Not Available | 599 | Open in IMG/M |
3300010366|Ga0126379_13058714 | Not Available | 560 | Open in IMG/M |
3300010366|Ga0126379_13358337 | Not Available | 536 | Open in IMG/M |
3300010376|Ga0126381_100973716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1223 | Open in IMG/M |
3300010398|Ga0126383_10099081 | All Organisms → cellular organisms → Bacteria | 2600 | Open in IMG/M |
3300010398|Ga0126383_11198906 | Not Available | 849 | Open in IMG/M |
3300010398|Ga0126383_11282753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 822 | Open in IMG/M |
3300010398|Ga0126383_11398410 | Not Available | 790 | Open in IMG/M |
3300010398|Ga0126383_11880176 | Not Available | 687 | Open in IMG/M |
3300010400|Ga0134122_12444121 | Not Available | 571 | Open in IMG/M |
3300012350|Ga0137372_11218242 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5 | 507 | Open in IMG/M |
3300012948|Ga0126375_10700309 | Not Available | 788 | Open in IMG/M |
3300012971|Ga0126369_10043910 | All Organisms → cellular organisms → Bacteria | 3773 | Open in IMG/M |
3300012971|Ga0126369_10812529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1018 | Open in IMG/M |
3300013297|Ga0157378_11148218 | Not Available | 815 | Open in IMG/M |
3300013306|Ga0163162_13391364 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 509 | Open in IMG/M |
3300015371|Ga0132258_10212882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4696 | Open in IMG/M |
3300015371|Ga0132258_10287377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4039 | Open in IMG/M |
3300015371|Ga0132258_10357970 | All Organisms → cellular organisms → Bacteria | 3611 | Open in IMG/M |
3300015371|Ga0132258_12455694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1305 | Open in IMG/M |
3300015372|Ga0132256_101183172 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300016270|Ga0182036_10196850 | Not Available | 1475 | Open in IMG/M |
3300016294|Ga0182041_10050716 | Not Available | 2806 | Open in IMG/M |
3300016319|Ga0182033_10709535 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 881 | Open in IMG/M |
3300016319|Ga0182033_10859155 | Not Available | 802 | Open in IMG/M |
3300016404|Ga0182037_11841221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
3300016445|Ga0182038_10513378 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300017939|Ga0187775_10021793 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1760 | Open in IMG/M |
3300017974|Ga0187777_10426485 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300018060|Ga0187765_11174665 | Not Available | 537 | Open in IMG/M |
3300018468|Ga0066662_10070899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 2333 | Open in IMG/M |
3300021560|Ga0126371_11891582 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300025922|Ga0207646_10781091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 851 | Open in IMG/M |
3300027527|Ga0209684_1018374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
3300027654|Ga0209799_1041356 | Not Available | 1028 | Open in IMG/M |
3300027873|Ga0209814_10239120 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 787 | Open in IMG/M |
3300027874|Ga0209465_10088879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1509 | Open in IMG/M |
3300027907|Ga0207428_11138386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300031543|Ga0318516_10059081 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2105 | Open in IMG/M |
3300031561|Ga0318528_10800294 | Not Available | 504 | Open in IMG/M |
3300031564|Ga0318573_10150525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1220 | Open in IMG/M |
3300031564|Ga0318573_10607373 | Not Available | 589 | Open in IMG/M |
3300031573|Ga0310915_10886147 | Not Available | 626 | Open in IMG/M |
3300031640|Ga0318555_10089953 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
3300031640|Ga0318555_10648861 | Not Available | 571 | Open in IMG/M |
3300031679|Ga0318561_10437535 | Not Available | 719 | Open in IMG/M |
3300031720|Ga0307469_10119701 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
3300031720|Ga0307469_10637127 | Not Available | 958 | Open in IMG/M |
3300031723|Ga0318493_10538252 | Not Available | 648 | Open in IMG/M |
3300031740|Ga0307468_100002478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5687 | Open in IMG/M |
3300031740|Ga0307468_100009708 | Not Available | 3687 | Open in IMG/M |
3300031740|Ga0307468_102258490 | Not Available | 528 | Open in IMG/M |
3300031768|Ga0318509_10165455 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300031820|Ga0307473_10024239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2534 | Open in IMG/M |
3300031846|Ga0318512_10573173 | Not Available | 575 | Open in IMG/M |
3300031879|Ga0306919_10082367 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
3300031942|Ga0310916_10073354 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2685 | Open in IMG/M |
3300031947|Ga0310909_10992101 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 686 | Open in IMG/M |
3300031959|Ga0318530_10475135 | Not Available | 519 | Open in IMG/M |
3300032001|Ga0306922_10537678 | Not Available | 1243 | Open in IMG/M |
3300032055|Ga0318575_10488984 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
3300032063|Ga0318504_10311959 | Not Available | 745 | Open in IMG/M |
3300032091|Ga0318577_10379958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 675 | Open in IMG/M |
3300032180|Ga0307471_104156514 | Not Available | 511 | Open in IMG/M |
3300032261|Ga0306920_102247109 | Not Available | 757 | Open in IMG/M |
3300033289|Ga0310914_11397057 | Not Available | 603 | Open in IMG/M |
3300033289|Ga0310914_11742882 | Not Available | 527 | Open in IMG/M |
3300033290|Ga0318519_10448599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → Ramlibacter agri | 773 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 28.12% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 17.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.03% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.47% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.34% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.34% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_11404724 | 2228664022 | Soil | VTALIAFLLLVVMFVIGSLVHGARSSFWKLLAFVTGCVVVLALLYVILAK |
Ga0066396_100169332 | 3300004267 | Tropical Forest Soil | MTALIAFLLLIGMFVLGARVHGVRHSFWKFLAFVTACIVVLALALAFLAR* |
Ga0066396_100237421 | 3300004267 | Tropical Forest Soil | VTALLAFLLLIVMLVIGARVRGARHSFWKFLVFVLACIVVLALLLAILAK* |
Ga0066398_100081993 | 3300004268 | Tropical Forest Soil | MNMRALLAFLFLIVMLVIGARVRGVRDSLWRFLAFIAACVVVLALLLAILAK* |
Ga0066395_100843133 | 3300004633 | Tropical Forest Soil | MTALIAFLLLIGMFVLGARVHGVRHSFWKFLAFVTACIVVL |
Ga0066395_103634502 | 3300004633 | Tropical Forest Soil | VTALLAFLLLIVMLVIGARVRGVRDSLWKFLAFIAACVVVLALLLAILAK* |
Ga0066680_100086504 | 3300005174 | Soil | VTALIAFLLLLVMLAIGARVRGVRFSFWKLLAFFTACVVVLALLLAILAK* |
Ga0065707_101889252 | 3300005295 | Switchgrass Rhizosphere | VTALLAFLLLIVVLVFGSRVHGTRHSFWKVLAFVVACVVILALL |
Ga0066388_1000745206 | 3300005332 | Tropical Forest Soil | VTALIAFLLLIVMLVIGARVHGVRHSFWKFLVFVTACVVVLGLLLAFLAK* |
Ga0066388_1001710072 | 3300005332 | Tropical Forest Soil | MTALIALLLLIGMFVLGARVHGVRHSFWKFLAFVTACIVVLALVLAFLAG* |
Ga0066388_1010398402 | 3300005332 | Tropical Forest Soil | MEEGHEEDVTAVVALLLLIVMFVIGSRVHGVRSSPWKLLAFVVACLVVLALLFLILAK* |
Ga0066388_1022190371 | 3300005332 | Tropical Forest Soil | VMLVIGARVRGVRQSFWKFLVFVLACVVVLVLLLTILAK* |
Ga0008090_116488391 | 3300005363 | Tropical Rainforest Soil | RPAGYATRWGISVTALIAFLLLIVMLVLGSRIHGVRESRWKFLAFVTACIFVLVLLLVILSR* |
Ga0070705_1004568592 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VTALIAFVLLIAMMVLGARVRGVRQSLWKFLAFVAACIVVLALLLAILAR* |
Ga0070697_1000251515 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VTALIAFLLLLVMLAIGARVRGVRFSLWKILAFATACVVVLALLLAILAK* |
Ga0066701_103782163 | 3300005552 | Soil | VTALIAFLLLLVMLAIGARVRGVRFSFWKLLAFFTACVVVLALLLAIL |
Ga0066905_1001289964 | 3300005713 | Tropical Forest Soil | VRALFAFLLLIVMLVIGARVRGVRQSFWKFLVFVLACVVVLVLLLTILAK* |
Ga0066905_1017208742 | 3300005713 | Tropical Forest Soil | MTALIAFLLLIGMFVLGSRVHGVRHSFWKFLAFVTACIVVL |
Ga0066905_1020168841 | 3300005713 | Tropical Forest Soil | MTALIAFLLLIGMFVLGARVHGVRHSFWKFLAFVTACIVVLALVLAFLAR* |
Ga0066903_1001036248 | 3300005764 | Tropical Forest Soil | MTALIAILLLIGMFVLGARVHGVRHSFWKFLAFVTACVVVLALVLAFLAG* |
Ga0066903_1004054274 | 3300005764 | Tropical Forest Soil | LIAFLLLIVMLVIGARVRGVRDSFWKFQPITACAVVLALLLAILGT* |
Ga0066903_1005562816 | 3300005764 | Tropical Forest Soil | VIGARVPGVRDSLWKFLAFIAACVVVLALLLAILAK* |
Ga0066903_1011339503 | 3300005764 | Tropical Forest Soil | VKALLAFLLLIVMLVIGARVRGVRDSFWKFLAFVVACVVVLALLLAILAK* |
Ga0066903_1013532033 | 3300005764 | Tropical Forest Soil | VTALLAFLLLIVLLVIGARVRGVRDSLWKFLAFVAACVVVLALLLAILAK* |
Ga0066903_1035201281 | 3300005764 | Tropical Forest Soil | VRALLAFVLLIVMLVIGDRVRGVRHSFWKFLVFVAACVVVLALLLAILAK* |
Ga0066903_1043640551 | 3300005764 | Tropical Forest Soil | VIGARVRGVRDSLWKFLAFIAACVVVLALLLAILAK* |
Ga0066903_1080733951 | 3300005764 | Tropical Forest Soil | VTALLACLLLIVMLVVGARVRGVRDSFWKFLAFVVACAVVLALLLAILAK* |
Ga0075417_103000292 | 3300006049 | Populus Rhizosphere | VTAAIAFLLLLIMFVIGSRVHGVRDSWWKLLAFVTACVVVLALILAILAK* |
Ga0068871_1007468702 | 3300006358 | Miscanthus Rhizosphere | RPPGADGESKNVTALIAFVLLIAMMVLGARVRGVRQSLWKFLAFVAACIVVLALLLAILAR* |
Ga0075433_101763012 | 3300006852 | Populus Rhizosphere | VTALIAFVLLIVMLVLGSRVHGVRQSLWKFLAFVAACIVVLALLLAILAR* |
Ga0075425_1020449651 | 3300006854 | Populus Rhizosphere | VTAAIAFLLLLIMFVIGSRVHGVRDSWWKLLAFVTACVVVLAL |
Ga0075436_1015585841 | 3300006914 | Populus Rhizosphere | VTAVIAFLLLIVMLAIGARVHGVRQSRWKFLAFVTACVVVLALLLAILAP* |
Ga0111539_109200392 | 3300009094 | Populus Rhizosphere | VTAVVALLLLVVMFVTGSRVHGVRSSPWKLLAFVVACLVVLALLFLILAK* |
Ga0075418_111610942 | 3300009100 | Populus Rhizosphere | MTALITFLLLIGMFVLGARVHGVRHSFWKFVAFVTACIVVLALLLVLLAK* |
Ga0114129_100425265 | 3300009147 | Populus Rhizosphere | VTAVVALLLLVVMFVTGSRVHGVRSSPWKLLAFVVACLVVLALLVLILAK* |
Ga0111538_133844323 | 3300009156 | Populus Rhizosphere | VTAVVALLLLVVMFVIGSRVHGVRSSPWKLLAFVVACLVVLALLFLILAK* |
Ga0075423_102703563 | 3300009162 | Populus Rhizosphere | VTAAIALLLLLIMFVIGSRVHGVRDSWWKLLAFVTACVVVLALILAILAK* |
Ga0126374_100256182 | 3300009792 | Tropical Forest Soil | MTALIAFILLIGMFVLGARVHGVRHSFWKFLAFVTACLVVLALVLAFLAG* |
Ga0126374_102737053 | 3300009792 | Tropical Forest Soil | VRALFAFLLLIVMLVIGARVRGVRQSFWKFLVFVLACVVVLALLLAILAK* |
Ga0126384_113965672 | 3300010046 | Tropical Forest Soil | VKALFAFLLLIVMLVLGARVHGVRHSFWKFLAFVTACLIVLGLLLAFLAK* |
Ga0126384_118610101 | 3300010046 | Tropical Forest Soil | VTALIAFLLLIVILVIGARVHGVRHSFWKFLAFVTACVVVLGLLLAFLAK* |
Ga0126382_123765051 | 3300010047 | Tropical Forest Soil | MTALIAFLLLIGMFVLGSRVHGVRHSFWKFLAFVAACIVVLVLVLAVLAR* |
Ga0126373_121102471 | 3300010048 | Tropical Forest Soil | VTALLAFLLPIVMLVNRARVRGVRDSFWKFLAFVVACVVVLALLA |
Ga0126370_105507443 | 3300010358 | Tropical Forest Soil | MTALIAFILLVGMFILGARVHGVRHSFWKFLAFVTACLVVLALVLAFLSR* |
Ga0126370_105952003 | 3300010358 | Tropical Forest Soil | MTALIAFILLIGMFVLGARVHGVRHSFWKFLAFVTACVVVLALVLAFLAG* |
Ga0126370_107447514 | 3300010358 | Tropical Forest Soil | VTALLAFLLLIVMLVIGARVRGVRDSLWKFLAFIAACV |
Ga0126376_100248086 | 3300010359 | Tropical Forest Soil | MTALIAFLLLIGMFVLGARIHGVRHSFWKFLAVVTACIVVLALALAFLAR* |
Ga0126376_102417363 | 3300010359 | Tropical Forest Soil | HGGRRTVTAVIAFLLLIVMLAIGARVHDVRQSRWKFLAFVTACVVVLALVLAILAQ* |
Ga0126376_103413661 | 3300010359 | Tropical Forest Soil | MTALIAFILLIGMFILGARVHGARHSFWKFLAFVTACLV |
Ga0126376_103657594 | 3300010359 | Tropical Forest Soil | VTALLAFLLLIVMLVIGARVHGVRHSFWKFLAFVTACLIVLGLLLAFLAK* |
Ga0126376_113431142 | 3300010359 | Tropical Forest Soil | VTALLAFLLLIVMLVIGARVRGVRDSFWKFVAFVVACVVVLALLLAILAQ* |
Ga0126376_120347251 | 3300010359 | Tropical Forest Soil | VGGQEDVTALLAFLLLIVMLVIGARVHGVRHSFWKFLAFVTACVVVLALLLAILAK* |
Ga0126372_109519161 | 3300010360 | Tropical Forest Soil | MTALIAFILLIGMFILGARVHGVRHSFWKFLAFVTACLVVLALVLAFLAK* |
Ga0126372_111567613 | 3300010360 | Tropical Forest Soil | VTALLAFLLLIVMLLIGARVHGVRDSFWKFLAFITACVVVLALLLAILAK* |
Ga0126378_107009143 | 3300010361 | Tropical Forest Soil | VTALLAFLFLIVMLVIGARVRGVRDSLWRFLAFIAACVVVLALLLAILAK* |
Ga0126378_107381901 | 3300010361 | Tropical Forest Soil | GMSALIAFLLLIGMFVLGARVHGVRHSFWKFLAFVTACIVVLALALAFLAR* |
Ga0126378_131461652 | 3300010361 | Tropical Forest Soil | VTALLAFLLLIVMLLIGARVHGVRDSLWKFLAFITACVVVLALLLAILAK* |
Ga0126377_106632411 | 3300010362 | Tropical Forest Soil | MTAVIAFLLLIGMFVLGARVHGVRQSFWKFLAFVTACIVVLALVLAFLAG* |
Ga0126377_119057862 | 3300010362 | Tropical Forest Soil | MTALIAFLLLIGMFVLGSRVHGVRHSFWKFLAFVTACIVVLVLVLAVLAR* |
Ga0126379_119300811 | 3300010366 | Tropical Forest Soil | VTALIAFLLLIVMLVIGARVHGVRHSFWKFLAFVTA |
Ga0126379_126432531 | 3300010366 | Tropical Forest Soil | VTALLAFLLLIVMLVIGARVRGVRDSLWKFLAFVAACVVVLAL |
Ga0126379_130587142 | 3300010366 | Tropical Forest Soil | MTALIAFLLLIGMFVLGARVHGVRHSFWKFLAFVTACIVVLALALAFLAG* |
Ga0126379_133583371 | 3300010366 | Tropical Forest Soil | ATRWGGQEDVTALLAFLLLIVMLVIGARVRGVRDSLWKFLAFIAACVVVLALLLAILAK* |
Ga0126381_1009737162 | 3300010376 | Tropical Forest Soil | VKALLAFLLLIVMLVIGARVRGVRDSLWRFLAFIAACVVVLALLLAILAK* |
Ga0126383_100990814 | 3300010398 | Tropical Forest Soil | WGSEDVRALFAFLLLIVMLVIGARVRGVRQSFWKFLVFVLACVVVLVLLLTILAK* |
Ga0126383_111989062 | 3300010398 | Tropical Forest Soil | VTALLAFLLLIVMLVIGARVRGVRDSFWKFLAFVVACVVVLALLLAILAQ* |
Ga0126383_112827531 | 3300010398 | Tropical Forest Soil | VGVRDVTALLAFLLLIVMLVIGARVHGVQNSLWKFLAFITACVVVLALLLAILAK* |
Ga0126383_113984102 | 3300010398 | Tropical Forest Soil | VRALLAFVLLIVMLVIGARVRGVRHSFWKFLVFVAACVVVLALLLAILAK* |
Ga0126383_118801761 | 3300010398 | Tropical Forest Soil | MTALIAFILLIGMFMLGARVHGVRHSFWKFLAFVTACLVVLALVLAFLAG* |
Ga0134122_124441212 | 3300010400 | Terrestrial Soil | VTALSAFVLLIAMMVLGARVRGVRQSLWKFLAFVAACIVVLALLLAILAR* |
Ga0137372_112182421 | 3300012350 | Vadose Zone Soil | MTALIAFLLLVVMLALGARVHGVRHSFWKFLAFVTACIVVLGLVLAFLAK* |
Ga0126375_107003092 | 3300012948 | Tropical Forest Soil | MTALIAFILLSGMFILGARVHGARHSFWKFLAFVTACLVVLA |
Ga0126369_100439101 | 3300012971 | Tropical Forest Soil | LIVMLVIGARVRGVRDSLWKFLAFIAACVVVLALLLAILAK* |
Ga0126369_108125291 | 3300012971 | Tropical Forest Soil | VTALLAFLLLIVMLVIGARVRGVRDSLWKFLAFVAACVVVLALLLAIL |
Ga0157378_111482181 | 3300013297 | Miscanthus Rhizosphere | VKALIAFLLLIAMLVLGARVRGVRDSFWKLLAFIAACIIVLALLLTILSK* |
Ga0163162_133913641 | 3300013306 | Switchgrass Rhizosphere | FLLLIAMLVLGARVRGVRDSFWKLLAFIAACIIVLALLLTILSK* |
Ga0132258_102128824 | 3300015371 | Arabidopsis Rhizosphere | VEEGREEDVTSVVELLLLVVMFVIGSRVHGVRSSPWKLLAFVVACLVVLALLFLILAK* |
Ga0132258_102873777 | 3300015371 | Arabidopsis Rhizosphere | VKALIAFLLLIAMLMLGARVRGVRDSFWKLLAFISACIVVLALLLTILSK* |
Ga0132258_103579703 | 3300015371 | Arabidopsis Rhizosphere | LIACLLLIVMLALGSRVHGVRESLWKFLAFVAACIVVLALLLAILAR* |
Ga0132258_124556942 | 3300015371 | Arabidopsis Rhizosphere | MGARNTVTALIAFLLLIVMLLLGSRVHGVRESLWKFLAFVAACIVVLALLLAILAR* |
Ga0132256_1011831722 | 3300015372 | Arabidopsis Rhizosphere | VEEGREEDVTSVVALLLLVVMFVIGSRVHGVRSSPWKLLAFVVACLVVLALLFLILAT |
Ga0182036_101968502 | 3300016270 | Soil | VGSEDVTALLAFLLLIVMLVIGARVHGVRHAFWKFLAFVTACIVVLALLRAFLAK |
Ga0182041_100507167 | 3300016294 | Soil | MTALIAFILLIGMFVLGARVHGVRHSFWKFLAFVTACLVVLALVLAFLAE |
Ga0182033_107095351 | 3300016319 | Soil | MTALIALLLLIGMFVLGARVHGVRHSFWKFLAFVTACI |
Ga0182033_108591552 | 3300016319 | Soil | LLAFLLLIVMLVIGARIRGVRHSFWKFLLFVVACIVVPALLLAILAK |
Ga0182037_118412211 | 3300016404 | Soil | LIAFLLLIVMLVLGSRIHGVRESLWKSLAFVTACIFVLVLLLVILSR |
Ga0182038_105133781 | 3300016445 | Soil | IGARVRGVRHSLWKFLVFVVACVVVLALLLAILAK |
Ga0187775_100217933 | 3300017939 | Tropical Peatland | VRALLAFLLLIVMLVIGARVRGVRQSFWKFLAFVVACVVVLALLLAILAK |
Ga0187777_104264852 | 3300017974 | Tropical Peatland | VAALIAFVLLIVMLTLGSRVHGVRESLWKFLAFAAACIVVLGLLLVILAR |
Ga0187765_111746651 | 3300018060 | Tropical Peatland | LIAFVLLIVMLTLGSRVHGVRESLWKFLAFAAACIVVLGLLLVILAR |
Ga0066662_100708994 | 3300018468 | Grasslands Soil | VTALIAFLLLLVMLAIGARVRGVRFSFWKLLAFFTACVVVLALLLAILAK |
Ga0126371_118915821 | 3300021560 | Tropical Forest Soil | VVGSKRRDGVLAFLLLIVMLVIGARVRGVRDSFWKFLAFVVACAVVLALLLAILAK |
Ga0207646_107810911 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EHVTALIAFLLLLVMLAIGARVRGVRFSFWKLLAFFTACVVVLALLLAILAK |
Ga0209684_10183742 | 3300027527 | Tropical Forest Soil | VTALLAFLLLIVMLVIGARVRGARHSFWKFLVFVLACIVVLALLLAILAK |
Ga0209799_10413564 | 3300027654 | Tropical Forest Soil | LFLIVMLVIGARVRGVRDSLWRFLAFIAACVVVLALLLAILAK |
Ga0209814_102391202 | 3300027873 | Populus Rhizosphere | VTAAIAFLLLLIMFVIGSRVHGVRDSWWKLLAFVTACVVVLALILAILAK |
Ga0209465_100888793 | 3300027874 | Tropical Forest Soil | MTALIAFLLLIGMFVLGARVHGVRHSFWKFLAFVTACIVVLALAL |
Ga0207428_111383862 | 3300027907 | Populus Rhizosphere | VTAVVALLLLVVMFVTGSRVHGVRSSPWKLLAFVVACLVVLALLFLILAK |
Ga0318516_100590812 | 3300031543 | Soil | VVGSEDVTALLAFLLLIVMLVIGARVHGVRHAFWKFLAFVTACIVVLALLLAFLAK |
Ga0318528_108002942 | 3300031561 | Soil | LRPLLAFLVLIVMLVIGARVRGVRDSFWKLLAFVVACIVVLALLLAILAK |
Ga0318573_101505251 | 3300031564 | Soil | VTALLAFLLLIVMLVIGARVHGVRHAFWKFLAFVTACIVVLALLLAFLAK |
Ga0318573_106073733 | 3300031564 | Soil | VTALIAFLLLIVMLVLGSRIHGVRESLWKFLAFVAA |
Ga0310915_108861471 | 3300031573 | Soil | VRALLAFLLLIVMLVIGARIRGVRHSFWKFLLFVVACVVALALLLAILAK |
Ga0318555_100899532 | 3300031640 | Soil | VGSEDVTALLAFLLLIVMLVIGARVHGVRHAFWKFLAFVTACIVVLALLLAFLAK |
Ga0318555_106488612 | 3300031640 | Soil | VTAVIAFLLLIVMMVLGSRIHGVRESLWKFLAFVTACIFVLVLLLVILSR |
Ga0318561_104375352 | 3300031679 | Soil | LLLIVMLVIGARVHGVRHAFWKFLAFVTACIVVLALLLAFLAK |
Ga0307469_101197012 | 3300031720 | Hardwood Forest Soil | VKAVIAFLLLIVMLAIGARVHGVRQSRWKFLAFVTACVVVLALVLAILAQ |
Ga0307469_106371272 | 3300031720 | Hardwood Forest Soil | VTALIAFLLLLAMFVIGARVRGVRDSWWKLLAFVTACVVVLALLLAILSK |
Ga0318493_105382522 | 3300031723 | Soil | VRALLAFLLLIVMLVIGARIRGVRHSFWKFLLFVVACVVALA |
Ga0307468_1000024781 | 3300031740 | Hardwood Forest Soil | IGARVHGVRQSRWKFLAFATACVVVLALLLAILAP |
Ga0307468_1000097082 | 3300031740 | Hardwood Forest Soil | VEEGQEEDVTAVVALLLLVVMFVIGSRVHGVRSSPWKLLAFVVACLVVLALLFLILAK |
Ga0307468_1022584901 | 3300031740 | Hardwood Forest Soil | VTALIAFLLLLVMFVIGARVRGVRDSWWKLLAFVTACVVVLALLLAILSK |
Ga0318509_101654551 | 3300031768 | Soil | SGVVGSEDVTALLAFLLLIVMLVIGARVHGVRHAFWKFLAFVTACIVVLALLLAFLAK |
Ga0307473_100242394 | 3300031820 | Hardwood Forest Soil | AVIALLLLIVMLAIGARVHGVRQSRWKFLAFATACVVVLALLLAILAP |
Ga0318512_105731732 | 3300031846 | Soil | VTALIAFLLLIVMLVLGSRIHGVRESLWKFLAFVAACIVVLVLLLAI |
Ga0306919_100823672 | 3300031879 | Soil | MTALIALLLLIGMFVLGARVHGVRHSFWKFLAFVTACIVVLALVLAFLAR |
Ga0310916_100733541 | 3300031942 | Soil | MTALIALLLLIGMFVLGARVHGVRHSFWKFLAFVTACIVVL |
Ga0310909_109921011 | 3300031947 | Soil | MVLGSRIHGVRESLWKFLAFVTACIFVLVLLLVILSR |
Ga0318530_104751351 | 3300031959 | Soil | VTALLAFLLLIVMLVIGARVHGVRHAFWKFLAFVTACIVVLALL |
Ga0306922_105376781 | 3300032001 | Soil | RHVRALLAFLLLIVMLVIGARIRGVRHSFWKFLLFVVACVVALALLLAILAK |
Ga0318575_104889842 | 3300032055 | Soil | ISVTALIAFLLLIVMLVLGSRIHGVRESLWKFLAFVAACIVVLVLLLAILAR |
Ga0318504_103119592 | 3300032063 | Soil | MTALIALLLLIGMFVLGARVHGVRHSFWKFLAFVTAC |
Ga0318577_103799582 | 3300032091 | Soil | RWGTRVTAVIAFLLLIVMMVLGSRIHGVRESLWKSLAFVTACIFVLVLLLVILSR |
Ga0307471_1041565141 | 3300032180 | Hardwood Forest Soil | AIGARVRGVRDSWWKLLAFVTACVVVLALLLAILSK |
Ga0306920_1022471092 | 3300032261 | Soil | VRALLAFLLLIVMLVIGARVRGVRHSFWKFLAFVAACVIVLALLLAILAK |
Ga0310914_113970572 | 3300033289 | Soil | LIVMLVIGARVHGVRHAFWKFLAFVTACIVVLALLLAFLAK |
Ga0310914_117428821 | 3300033289 | Soil | LIGMFVLGARVHGVRHSFWKFLAFVTACIVVLALVLAFLAR |
Ga0318519_104485991 | 3300033290 | Soil | VTALIAFLLLIVMLVLGSRIHGVRESLWKSLAFVTACIFVLVLLLVILSR |
⦗Top⦘ |