NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064610

Metagenome / Metatranscriptome Family F064610

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064610
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 41 residues
Representative Sequence GVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH
Number of Associated Samples 110
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.60 %
% of genes near scaffold ends (potentially truncated) 96.09 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.656 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(28.125 % of family members)
Environment Ontology (ENVO) Unclassified
(47.656 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.125 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.97%    β-sheet: 0.00%    Coil/Unstructured: 53.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00127Copper-bind 39.84
PF13478XdhC_C 7.03
PF13490zf-HC2 7.03
PF02625XdhC_CoxI 4.69
PF13473Cupredoxin_1 4.69
PF08281Sigma70_r4_2 2.34
PF07883Cupin_2 0.78
PF02627CMD 0.78
PF13561adh_short_C2 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG1975Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF familyPosttranslational modification, protein turnover, chaperones [O] 4.69
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.78
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.66 %
UnclassifiedrootN/A2.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002558|JGI25385J37094_10118442All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes759Open in IMG/M
3300002916|JGI25389J43894_1036896All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes843Open in IMG/M
3300005166|Ga0066674_10168536All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1038Open in IMG/M
3300005175|Ga0066673_10646358All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium612Open in IMG/M
3300005179|Ga0066684_10836927All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300005180|Ga0066685_10154100All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1564Open in IMG/M
3300005181|Ga0066678_10298685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1053Open in IMG/M
3300005406|Ga0070703_10014900All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2219Open in IMG/M
3300005458|Ga0070681_10820887All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300005518|Ga0070699_101954918All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes536Open in IMG/M
3300005536|Ga0070697_100096833All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2448Open in IMG/M
3300005536|Ga0070697_100387369All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300005540|Ga0066697_10617523All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium600Open in IMG/M
3300005546|Ga0070696_100685678All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium834Open in IMG/M
3300005552|Ga0066701_10046759All Organisms → cellular organisms → Bacteria2355Open in IMG/M
3300005554|Ga0066661_10874398All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium526Open in IMG/M
3300005555|Ga0066692_10163153All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1375Open in IMG/M
3300005555|Ga0066692_10485718All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300005555|Ga0066692_10835103All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium566Open in IMG/M
3300005557|Ga0066704_10201640All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1345Open in IMG/M
3300005559|Ga0066700_10106190All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1848Open in IMG/M
3300005569|Ga0066705_10446208All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium811Open in IMG/M
3300005574|Ga0066694_10017895All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3097Open in IMG/M
3300005574|Ga0066694_10054639All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300005586|Ga0066691_10057832All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2095Open in IMG/M
3300005587|Ga0066654_10433401All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium718Open in IMG/M
3300006031|Ga0066651_10224955All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes995Open in IMG/M
3300006032|Ga0066696_10427415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes866Open in IMG/M
3300006034|Ga0066656_11135764All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium503Open in IMG/M
3300006046|Ga0066652_100211622All Organisms → cellular organisms → Bacteria1674Open in IMG/M
3300006755|Ga0079222_11085663All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium701Open in IMG/M
3300006796|Ga0066665_10676335All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium819Open in IMG/M
3300006797|Ga0066659_10320480All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1191Open in IMG/M
3300006797|Ga0066659_10360652All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300006852|Ga0075433_10920377All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300006871|Ga0075434_100242175All Organisms → cellular organisms → Bacteria1824Open in IMG/M
3300006880|Ga0075429_100365151All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300007255|Ga0099791_10379002All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23680Open in IMG/M
3300007255|Ga0099791_10647638All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes518Open in IMG/M
3300007258|Ga0099793_10418831All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300009012|Ga0066710_101820971All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium918Open in IMG/M
3300009012|Ga0066710_104194327All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium539Open in IMG/M
3300009090|Ga0099827_10495838All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1049Open in IMG/M
3300009137|Ga0066709_100443013All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1814Open in IMG/M
3300010126|Ga0127482_1162912All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium754Open in IMG/M
3300010304|Ga0134088_10170607All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1038Open in IMG/M
3300010304|Ga0134088_10477158All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300010323|Ga0134086_10029987All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1786Open in IMG/M
3300010329|Ga0134111_10233126All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium751Open in IMG/M
3300010333|Ga0134080_10062812All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1478Open in IMG/M
3300010336|Ga0134071_10302852All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300010336|Ga0134071_10769750All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium513Open in IMG/M
3300010360|Ga0126372_12771928All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes542Open in IMG/M
3300011269|Ga0137392_10952017All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300011435|Ga0137426_1142584All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23699Open in IMG/M
3300011444|Ga0137463_1015580All Organisms → cellular organisms → Bacteria2673Open in IMG/M
3300012198|Ga0137364_10151547All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1676Open in IMG/M
3300012198|Ga0137364_10265937All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1269Open in IMG/M
3300012200|Ga0137382_10407447All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes959Open in IMG/M
3300012203|Ga0137399_10149953All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1862Open in IMG/M
3300012203|Ga0137399_10441419All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1088Open in IMG/M
3300012204|Ga0137374_10979679All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium613Open in IMG/M
3300012208|Ga0137376_10678443All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes889Open in IMG/M
3300012209|Ga0137379_10315402All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1474Open in IMG/M
3300012209|Ga0137379_10428481All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1232Open in IMG/M
3300012210|Ga0137378_11699781All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300012211|Ga0137377_10668014All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium974Open in IMG/M
3300012285|Ga0137370_10195290All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1185Open in IMG/M
3300012285|Ga0137370_10288882All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium977Open in IMG/M
3300012350|Ga0137372_10079244All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2801Open in IMG/M
3300012354|Ga0137366_10599474All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium790Open in IMG/M
3300012355|Ga0137369_10137447All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1954Open in IMG/M
3300012356|Ga0137371_10446741All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1001Open in IMG/M
3300012358|Ga0137368_10395906All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium908Open in IMG/M
3300012359|Ga0137385_10497922All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1031Open in IMG/M
3300012359|Ga0137385_11284619All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes594Open in IMG/M
3300012363|Ga0137390_11889850All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300012371|Ga0134022_1123851All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium521Open in IMG/M
3300012386|Ga0134046_1147025All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium801Open in IMG/M
3300012405|Ga0134041_1073385All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium503Open in IMG/M
3300012683|Ga0137398_10449460All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300012917|Ga0137395_10167573All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1513Open in IMG/M
3300012924|Ga0137413_11706679All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium518Open in IMG/M
3300012929|Ga0137404_10180120All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1778Open in IMG/M
3300012944|Ga0137410_10184745All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1606Open in IMG/M
3300012944|Ga0137410_11129879All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes672Open in IMG/M
3300012948|Ga0126375_11184086All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes635Open in IMG/M
3300012976|Ga0134076_10299433All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium697Open in IMG/M
3300014154|Ga0134075_10200752All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium858Open in IMG/M
3300014154|Ga0134075_10404969All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300014157|Ga0134078_10237309All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium759Open in IMG/M
3300015264|Ga0137403_10352921All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1357Open in IMG/M
3300015356|Ga0134073_10037265All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1251Open in IMG/M
3300015372|Ga0132256_101536585All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium776Open in IMG/M
3300017656|Ga0134112_10258406All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium692Open in IMG/M
3300018082|Ga0184639_10392075All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium718Open in IMG/M
3300018084|Ga0184629_10347624All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300018433|Ga0066667_10549606All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium958Open in IMG/M
3300019279|Ga0184642_1282182All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1222Open in IMG/M
3300021046|Ga0215015_10067967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1551Open in IMG/M
3300021951|Ga0222624_1158310All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1210Open in IMG/M
3300025910|Ga0207684_10026491All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium4942Open in IMG/M
3300026307|Ga0209469_1103451All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes773Open in IMG/M
3300026308|Ga0209265_1117228All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium673Open in IMG/M
3300026310|Ga0209239_1236236All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium634Open in IMG/M
3300026324|Ga0209470_1039165All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2358Open in IMG/M
3300026325|Ga0209152_10159095All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium853Open in IMG/M
3300026332|Ga0209803_1058181All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1682Open in IMG/M
3300026333|Ga0209158_1021618All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2898Open in IMG/M
3300026342|Ga0209057_1057083All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1792Open in IMG/M
3300026524|Ga0209690_1036828All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2297Open in IMG/M
3300026540|Ga0209376_1358367All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes549Open in IMG/M
3300026548|Ga0209161_10015560All Organisms → cellular organisms → Bacteria5593Open in IMG/M
3300026548|Ga0209161_10574884All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium504Open in IMG/M
3300027671|Ga0209588_1057275All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1260Open in IMG/M
3300027775|Ga0209177_10338474All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium585Open in IMG/M
3300027903|Ga0209488_11045927All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes562Open in IMG/M
3300028884|Ga0307308_10408993All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300030997|Ga0073997_11867482All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23533Open in IMG/M
3300031576|Ga0247727_10097494All Organisms → cellular organisms → Bacteria3112Open in IMG/M
3300031949|Ga0214473_11477111All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes687Open in IMG/M
3300032180|Ga0307471_101793821All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium765Open in IMG/M
3300032955|Ga0335076_11687463All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23522Open in IMG/M
3300033417|Ga0214471_10242459All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300034177|Ga0364932_0241775All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes683Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil28.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil27.34%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil14.06%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.25%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.34%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.56%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.78%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010126Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012371Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012405Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030997Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25385J37094_1011844223300002558Grasslands SoilGPALGVPEIGATLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH*
JGI25389J43894_103689633300002916Grasslands SoilEIVPSINGGAGPALGVPEIGATLLFGGLFLLSFGWFGALFLLSFGWFGARYPMLSPRLAADTLERERH*
Ga0066674_1016853613300005166SoilIGVALFFGGLFFLSWAWFAGRYPIISPRLAANALEREHH*
Ga0066673_1064635823300005175SoilPEIGVTLLFAGLFLLSYGWFGSRYPMLSPRLAADTLERERH*
Ga0066684_1083692723300005179SoilGLPETASTLLFGGLFLLSYGWFGGRYPMLSPRLAADALERERH*
Ga0066685_1015410013300005180SoilEVGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLEREQH*
Ga0066678_1029868513300005181SoilGLPEVGVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH*
Ga0070703_1001490043300005406Corn, Switchgrass And Miscanthus RhizosphereEIGVALLFGGLFLASLGWFGARYPMLSPRLAADALERERH*
Ga0070681_1082088733300005458Corn RhizosphereEVGTTLFFAGLFFLSWAWFAGRYPIVSPRLAADALEREAH*
Ga0070699_10195491823300005518Corn, Switchgrass And Miscanthus RhizosphereEIGTGLFFLGLFLLAWAWFASRYPMVSPRLAEDALEREHH*
Ga0070697_10009683343300005536Corn, Switchgrass And Miscanthus RhizosphereLTEAGVTLFFAGLFFLSWAWFAGRYPIISPRLAADALQRAPH*
Ga0070697_10038736933300005536Corn, Switchgrass And Miscanthus RhizosphereLTEAGVTLFFAGLFFLSWAWFAGRYPIISPRLAADALQREPH*
Ga0066697_1061752323300005540SoilAVGIPEIGVTLLYGGLFLLSMAWFALRYPMISPRLAADTLEREAH*
Ga0070696_10068567813300005546Corn, Switchgrass And Miscanthus RhizosphereEVGMALFFGGLFLLSWGWFAGRYPIISPRLAADALEREHH*
Ga0066701_1004675943300005552SoilELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLEREQH*
Ga0066661_1087439823300005554SoilLLFGGLFLAALGWFGARYPMLSPRLAADAVERERH*
Ga0066692_1016315333300005555SoilPELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLEREQH*
Ga0066692_1048571813300005555SoilGIPEVGVALLFGGLYLLSIAWFAGRYPMISPRLAADTLEREQH*
Ga0066692_1083510323300005555SoilLLFGGLFLASLGWFGARYPMLSPRLAADALERERH*
Ga0066704_1020164043300005557SoilPAIGLPELGVTALFGGLYLLSIAWFAARRPMLSPRLAADTLEREQH*
Ga0066700_1010619013300005559SoilTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH*
Ga0066705_1044620813300005569SoilINGGAGPAIGLPEDGVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLEREGH*
Ga0066694_1001789553300005574SoilGVTALFAGLYLLSIAWFAARRPMLSPRLAADTLEREAH*
Ga0066694_1005463913300005574SoilAGVTLLFAGLFLLAMGWFATRYPMISPRLAADTLQREAH*
Ga0066691_1005783243300005586SoilGVALFFGGLFFLSWAWFAGRYPIISPRLAANALEREHH*
Ga0066654_1043340123300005587SoilGAGPALGVPEIGVALLFGGLFLLSLGWFGARYPMLSPRLAADAVERERH*
Ga0066651_1022495513300006031SoilGAGPAIGVPELGVTALFAGLYLLSIAWFAARRPMLSPRLAADTLEREAH*
Ga0066696_1042741533300006032SoilLGVPEIGVALLFGGLFLASLGWFGARYPMLSPRLAADAVERERH*
Ga0066656_1113576413300006034SoilVTLFFAGLFFLSWGWFAGRYPIISPRLAADALQREQH*
Ga0066652_10021162213300006046SoilIGIPEIGVTLLYGGLFLLSMAWFALRYPMLSPRLAADTLEREAH*
Ga0079222_1108566313300006755Agricultural SoilATLLFGGLFVLSFGWFGARYPMLSPRLAADTVEREHH*
Ga0066665_1067633513300006796SoilIGVTLLFAGLFLVSFGWFGARYPMLSPRLAADALERERH*
Ga0066659_1032048013300006797SoilIGVTLLFAGLFLLSFGWFGARYPMLSPRLAADTLERERH*
Ga0066659_1036065213300006797SoilGPALGVPEIGVALLFGGLFLLSLGWFGARYPMLSPRLAADAVERERH*
Ga0075433_1092037733300006852Populus RhizosphereFAGLFALSYSWFAGRYPMLSPRLAADTLDREHGH*
Ga0075434_10024217543300006871Populus RhizosphereLLFAGLFILSWAFFASRYPIISPRLAADALEREQH*
Ga0075429_10036515143300006880Populus RhizosphereGVPEVGTAMFFAGLFLLAWAWFAGRYPIISPRHAADALEREAH*
Ga0099791_1037900213300007255Vadose Zone SoilVTVLFGGLFLLAMGWFATRYPMISPRLAADTLEREQH*
Ga0099791_1064763823300007255Vadose Zone SoilLFFGGLFFISWAWFARKYPIISPRLAADALEREQH*
Ga0099793_1041883123300007258Vadose Zone SoilFFGGLFFLSWAWFANRYPIISPRLAADALEREQH*
Ga0066710_10182097123300009012Grasslands SoilGPELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLEREQH
Ga0066710_10419432723300009012Grasslands SoilGPELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLERERH
Ga0099827_1049583813300009090Vadose Zone SoilLFFGGLFFLAWAWFAGRYPIISPRLAANALEREHH*
Ga0066709_10044301343300009137Grasslands SoilLFFAGVFFLSWAWFARRYPIISPRLAADALEREQH*
Ga0127482_116291233300010126Grasslands SoilPALGMPEVGVTLLFAGLFLLSLGWFGARYPMLSPRLAADTLERERH*
Ga0134088_1017060713300010304Grasslands SoilLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH*
Ga0134088_1047715823300010304Grasslands SoilLPELGVTALFGGLFLLSLGWFAARYPMVSPRLAADTLEREHH*
Ga0134086_1002998743300010323Grasslands SoilGVTLFFGGLFCMSWAWFASRYPIISPRLAADALEREQH*
Ga0134111_1023312623300010329Grasslands SoilPELGVTVLFGGLFLMAMGWFGARYPMISPRLAADTLEREAH*
Ga0134080_1006281233300010333Grasslands SoilGVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH*
Ga0134071_1030285233300010336Grasslands SoilFFGGLFFLSWAWFAGRYPIISPRLAANALEREHH*
Ga0134071_1076975023300010336Grasslands SoilSINGGAGPAIGVPELGVTALFAGLYFLCIAWFAARRPMLSPRLAADTLERESH*
Ga0126372_1277192823300010360Tropical Forest SoilHGPITSVLFFGGLFALSYSWFAGRYPMVSPRLAADTLEREHGH*
Ga0137392_1095201713300011269Vadose Zone SoilTLLFGGLFLLSFGWFGGRYPMLSPRLAADTLERERH*
Ga0137426_114258413300011435SoilPAIGVPEIGTTLLFGGLFLLALGWFAGRYPMLSPRLAADTLEREAH*
Ga0137463_101558053300011444SoilGVPELGAVLFFGGLYALSYSWFAGRYPMISPRLAADTLEREHGH*
Ga0137364_1015154733300012198Vadose Zone SoilLLYSGLFLLSMAWFALRYPMISPRLAADTLEREAH*
Ga0137364_1026593713300012198Vadose Zone SoilEIGVTLFFGGVFLLAWAWFAARYPIISPRLAADALEREAH*
Ga0137382_1040744733300012200Vadose Zone SoilIGIPEVGVTLLYSGLFLLSMAWFALRYPMISPRSASDTLEREAY*
Ga0137399_1014995313300012203Vadose Zone SoilPEVGVALFFGGLFLLSWTWFASRYPIISPRLAADALEREQH*
Ga0137399_1044141933300012203Vadose Zone SoilLPEIGATLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH*
Ga0137374_1097967923300012204Vadose Zone SoilGVTALFAGLYLLSIAWFAARRPMLSPRLAADTLERESH*
Ga0137376_1067844313300012208Vadose Zone SoilIGVTLLYGGLFLLSMAWFALRYPMISPRLAADTLEREAH*
Ga0137379_1031540233300012209Vadose Zone SoilLFGGLFLLSIAWFARRDPMISPRLAADTLEREAH*
Ga0137379_1042848113300012209Vadose Zone SoilLFAGLYLLSIAWFAARRPMLSPRLAADTLERESH*
Ga0137378_1169978123300012210Vadose Zone SoilAGGLCFAGLFLLAYAWFAGRYPMLSPRLAADTLEREHH*
Ga0137377_1066801443300012211Vadose Zone SoilAPVLGVPEIGVALLFGGLFLASLGWFAARYPMLSPRLAADALERERH*
Ga0137370_1019529033300012285Vadose Zone SoilVPELGVTALFAGLYFLSIAWFAARRPMLSPRLAADTLEREQH*
Ga0137370_1028888233300012285Vadose Zone SoilEIGVALLFGGLFLASLGWFGARYPMLSPRLAADAVERERH*
Ga0137372_1007924413300012350Vadose Zone SoilVTALFAGLYLLSIAWFAARRPMLSPRLAADTLERESH*
Ga0137367_1058616423300012353Vadose Zone SoilPSINNGAGPAIGVPELGVTALFAGLYLLSIAWFAARRPMLSPRLAADTLERESH*
Ga0137366_1059947413300012354Vadose Zone SoilAIGLPEAGVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH*
Ga0137369_1013744713300012355Vadose Zone SoilLFFAGLFLLAWAWFAGRYPIISPRLAADALEREAH*
Ga0137371_1044674133300012356Vadose Zone SoilLTEAGVTLFFAGLFFLSWGWFAGRYPIISPRLAADALEREQH*
Ga0137368_1039590613300012358Vadose Zone SoilEIGVTLLFGGLFLSSLGWFAARYPMLSPRLAADTLERERH*
Ga0137385_1049792213300012359Vadose Zone SoilAGVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH*
Ga0137385_1128461923300012359Vadose Zone SoilGPAIGIPELGVTCFFGGLYLLSIAWFAGRYPMLSPRLAADTLEREQH*
Ga0137390_1188985023300012363Vadose Zone SoilVALFFGGLFFLSWAWFASRYPIISPRLAADALEREQH*
Ga0134022_112385123300012371Grasslands SoilGVTLLFGGLFLVSLGWFGARYPMLSPRLAADTLERERH*
Ga0134046_114702533300012386Grasslands SoilPAIGVPEIGVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH*
Ga0134041_107338513300012405Grasslands SoilIGVALLFGGLFLASLGWFGARYPMLSPRLAADAVERERH*
Ga0137398_1044946013300012683Vadose Zone SoilVMLLGVFLLAYGAFARKYPMVSPRLAADTLEREDSH*
Ga0137395_1016757333300012917Vadose Zone SoilVTLLFAGLFLLSFGWFGGRYPMLSPRLAADTLERERH*
Ga0137413_1170667923300012924Vadose Zone SoilVTLLFGGLFLLSFGWFGGRYPMLSPRLAADTLERERH*
Ga0137404_1018012013300012929Vadose Zone SoilVTLLFGGLFLLSFGWFGACYPMLSPRLAADTLERERH*
Ga0137410_1018474533300012944Vadose Zone SoilFFAGLFLLSWAWFAARYPIISPRLAADALEREQH*
Ga0137410_1112987913300012944Vadose Zone SoilPEVGVALFFGGLFLLSWTWFASRYPIISPRLAADALEREGH*
Ga0126375_1118408613300012948Tropical Forest SoilELGGLLFFSGLYALSYSWFAGRYPMISPRLAADTLEREHGH*
Ga0134110_1043530823300012975Grasslands SoilVPSINGGAGPAIGLPEIAVTSLFGGLFLLSLGWFAARYPMLSPRLAADTLERERH*
Ga0134076_1029943333300012976Grasslands SoilGVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH*
Ga0134075_1020075213300014154Grasslands SoilVPSINGGAGPAIGVPELGVTALFAGLYFLSIAWFAARRPMLSPRLAA
Ga0134075_1040496913300014154Grasslands SoilTALFGGLFLLSLGWFAARYPMVSPRLAADTLEREHH*
Ga0134078_1023730933300014157Grasslands SoilAGPASGVPEVGVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH*
Ga0137403_1035292133300015264Vadose Zone SoilLGVPEVGVTLLFAGLFLLSLGWFGARYPMLSPRLAADTLERERH*
Ga0134073_1003726513300015356Grasslands SoilPEIGVTLLYGGLFLLSMAWFALRYPMISPRLAADTLEREAH*
Ga0132256_10153658523300015372Arabidopsis RhizosphereVGMALFFGGLFLLSWGWFAGRYPIISPRLAADALEREHH*
Ga0134112_1025840623300017656Grasslands SoilGVPEIAVTLLFGGLFLLSYGWFGARYPMLSPRLAADTLHREHH
Ga0184639_1039207523300018082Groundwater SedimentFFGGLYALSVAWFAGRYPMISPRLAADTLEREHGH
Ga0184629_1034762433300018084Groundwater SedimentALFFGGLFLLSWAWFAGRYPIISPRLAADALEREQH
Ga0066667_1013964613300018433Grasslands SoilPSINGGAGPAIGIPEIGVTLLYGGLFLLSMAWFALRYPMLSPRLAADTLEREAH
Ga0066667_1054960633300018433Grasslands SoilVPEIGVTLLFAGLFLLSYGWFGSRYPMLSPRLAADTLERERH
Ga0184642_128218213300019279Groundwater SedimentVGVTLLFGGLFLLSIGWFGARYPMLSPRLAADTLERERH
Ga0215015_1006796723300021046SoilVLIFGGLFLLSYGWFGARYPMPSRRLAADTLEREHH
Ga0222624_115831013300021951Groundwater SedimentEIGTGVFFLGLFLLAWAWFASRYPMVSPRLAADALEREAP
Ga0207684_1002649163300025910Corn, Switchgrass And Miscanthus RhizosphereEIGVTLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH
Ga0209469_110345123300026307SoilAGPAIGVPELGVTALFAGLYLLSIAWFAARRPMLSPRLAADTLEREAH
Ga0209265_111722813300026308SoilGGAGPALGVPEIGVALLFGGLFLLSLGWFGARYPMLSPRLAADAVERERH
Ga0209239_123623623300026310Grasslands SoilGVTLLFGGLFLLSFGWFAGRYPMLSPRLAADTLEREHH
Ga0209470_103916543300026324SoilVTLFFGGLFCMSWAWFASRYPIISPRLAADALEREQH
Ga0209152_1015909533300026325SoilAGPAIGLPELGVTALFGGLYLLSIAWFAARRPMLSPRLAADTLEREQH
Ga0209803_105818133300026332SoilEIGATLLFGGLFLLSFGWFGARYPMLSPRLAADTLERERH
Ga0209158_102161813300026333SoilNGGAGPAIGLPELGVTALFGGLYLLSIAWFAARRPMLSPRLAADTLEREQH
Ga0209057_105708313300026342SoilVPEIGVTLLFAGLFLLSYGWFGARYPMLSPRLAVDTLERERH
Ga0209690_103682853300026524SoilLGLPELGVTALFGGLFLLSLGWFAARYPMLSPRLAADTLERENH
Ga0209376_135836713300026540SoilTALFAGLYLLSIAWFAARRPMLSPRLAADTLEREAH
Ga0209161_1001556083300026548SoilPELGATLLFAGLFLLSFGWFGARYPMLSPRLAADAIEREQH
Ga0209161_1057488423300026548SoilLGGPELGVTLLFGGLYLLAIGWFAARFPMISPRLAADTLERERH
Ga0209588_105727533300027671Vadose Zone SoilIGVPEIGVTLLFGGLFLLSFGWFGGRYPMLSPRLAADTLERERH
Ga0209177_1033847413300027775Agricultural SoilSVNGGAGPAIGLPELAATLLFGGLFVLSLGWFGARYPMLSPRLAADTVEREHH
Ga0209488_1104592723300027903Vadose Zone SoilGVFFLGLFLISWAWFARKYPIISPRLSADALEREAH
Ga0307308_1040899313300028884SoilVTLFFGGLFFMSWAWFASRYPIISPRLAADALEREHH
Ga0073997_1186748223300030997SoilGVTLLFGGLFLLAFGWFAARYPMLSPRLAADTLEREAH
Ga0247727_1009749413300031576BiofilmVTLFFLGLFLLAYAAFAARYPMVSPRLAADTIEREQH
Ga0214473_1147711113300031949SoilVALLFFGLFLLSLAWFASRYPMLSPRLAADTLEREGH
Ga0307471_10179382133300032180Hardwood Forest SoilGVPEIGVTLLFGGLFLLSLGWFGARYPMLSPRLAADTLERERH
Ga0335076_1168746323300032955SoilPEIGVTLLYLGLFLLALGWFAKRYPLISPRLAADTLEREAH
Ga0214471_1024245913300033417SoilTALFFGGLFLLAWAWFAARYPIVSPRLAADALERERH
Ga0364932_0241775_1_1083300034177SedimentFFGGLYALSVAWFAGRYPMLSPRLAADTLEREHGH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.