NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064607

Metagenome / Metatranscriptome Family F064607

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064607
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 46 residues
Representative Sequence MNGKLRVAAIGLALSVAAILLLLVVRPSLDPAQLRPLPLIIGAWLAF
Number of Associated Samples 119
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 33.59 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.53 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.188 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.562 % of family members)
Environment Ontology (ENVO) Unclassified
(24.219 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.719 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.67%    β-sheet: 0.00%    Coil/Unstructured: 49.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF13489Methyltransf_23 39.06
PF00486Trans_reg_C 8.59
PF00072Response_reg 6.25
PF12847Methyltransf_18 5.47
PF02518HATPase_c 1.56
PF09594GT87 0.78
PF00512HisKA 0.78



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.19 %
UnclassifiedrootN/A7.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_109008218Not Available557Open in IMG/M
3300005186|Ga0066676_10369801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia962Open in IMG/M
3300005343|Ga0070687_100011889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3826Open in IMG/M
3300005345|Ga0070692_10073516All Organisms → cellular organisms → Bacteria1827Open in IMG/M
3300005406|Ga0070703_10147397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria881Open in IMG/M
3300005434|Ga0070709_10798563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300005440|Ga0070705_100138907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1596Open in IMG/M
3300005445|Ga0070708_101777797Not Available572Open in IMG/M
3300005540|Ga0066697_10175773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1270Open in IMG/M
3300005544|Ga0070686_100495038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300005566|Ga0066693_10299291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300005591|Ga0070761_10066627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2040Open in IMG/M
3300005842|Ga0068858_100412966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1297Open in IMG/M
3300006028|Ga0070717_12068942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae512Open in IMG/M
3300006031|Ga0066651_10166674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1160Open in IMG/M
3300006059|Ga0075017_101230967All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300006755|Ga0079222_11340273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300009174|Ga0105241_10066110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2795Open in IMG/M
3300009792|Ga0126374_10286848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1096Open in IMG/M
3300009839|Ga0116223_10771681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales550Open in IMG/M
3300010047|Ga0126382_11054805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300010320|Ga0134109_10040663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1511Open in IMG/M
3300010326|Ga0134065_10027090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1657Open in IMG/M
3300010360|Ga0126372_12058549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300010375|Ga0105239_10228596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2087Open in IMG/M
3300012189|Ga0137388_10248064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1619Open in IMG/M
3300012189|Ga0137388_10356814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1349Open in IMG/M
3300012198|Ga0137364_10807983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300012359|Ga0137385_10392035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1185Open in IMG/M
3300012362|Ga0137361_11870399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300012476|Ga0157344_1008190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300012481|Ga0157320_1004869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria874Open in IMG/M
3300012489|Ga0157349_1000496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1974Open in IMG/M
3300012961|Ga0164302_10328168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1013Open in IMG/M
3300012985|Ga0164308_10604333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria933Open in IMG/M
3300014169|Ga0181531_10123730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1555Open in IMG/M
3300014493|Ga0182016_10567916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300014657|Ga0181522_10288835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300015264|Ga0137403_11254336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300015372|Ga0132256_100319458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1641Open in IMG/M
3300016270|Ga0182036_11097311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300017821|Ga0187812_1007090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3884Open in IMG/M
3300017924|Ga0187820_1085930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria890Open in IMG/M
3300017932|Ga0187814_10363553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300017942|Ga0187808_10174200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria953Open in IMG/M
3300017946|Ga0187879_10305607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia883Open in IMG/M
3300017966|Ga0187776_10841087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia662Open in IMG/M
3300017972|Ga0187781_10797192Not Available685Open in IMG/M
3300017974|Ga0187777_10539039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300017975|Ga0187782_10136015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1823Open in IMG/M
3300017975|Ga0187782_10821042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300017999|Ga0187767_10207676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300018007|Ga0187805_10362005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales671Open in IMG/M
3300018058|Ga0187766_10165945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1379Open in IMG/M
3300018062|Ga0187784_11069510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae641Open in IMG/M
3300018086|Ga0187769_10394796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1040Open in IMG/M
3300019789|Ga0137408_1162740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1870Open in IMG/M
3300019879|Ga0193723_1099138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300020069|Ga0197907_11409635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300021363|Ga0193699_10142003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria986Open in IMG/M
3300021384|Ga0213876_10470126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300021401|Ga0210393_10195569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1633Open in IMG/M
3300021402|Ga0210385_10134969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1753Open in IMG/M
3300021403|Ga0210397_10495813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria924Open in IMG/M
3300021405|Ga0210387_10552567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1024Open in IMG/M
3300021407|Ga0210383_11214664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300021444|Ga0213878_10117433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1089Open in IMG/M
3300021477|Ga0210398_11072884Not Available640Open in IMG/M
3300021478|Ga0210402_10810704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300024317|Ga0247660_1054138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300025906|Ga0207699_10920655Not Available645Open in IMG/M
3300025910|Ga0207684_10728184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300025925|Ga0207650_11501971Not Available573Open in IMG/M
3300025937|Ga0207669_11907105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300026551|Ga0209648_10662242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300026552|Ga0209577_10274054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1266Open in IMG/M
3300026557|Ga0179587_10752540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300027307|Ga0209327_1065866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia532Open in IMG/M
3300027824|Ga0209040_10078498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1914Open in IMG/M
3300027846|Ga0209180_10393585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300028716|Ga0307311_10098853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300028792|Ga0307504_10091427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria953Open in IMG/M
3300028884|Ga0307308_10372298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300029943|Ga0311340_10163970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2302Open in IMG/M
3300030056|Ga0302181_10060778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1958Open in IMG/M
3300030494|Ga0310037_10277689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300030503|Ga0311370_11316281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300031549|Ga0318571_10205541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300031564|Ga0318573_10558313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300031572|Ga0318515_10126663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1353Open in IMG/M
3300031572|Ga0318515_10186307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1111Open in IMG/M
3300031681|Ga0318572_10273220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria996Open in IMG/M
3300031708|Ga0310686_110777409Not Available553Open in IMG/M
3300031713|Ga0318496_10122382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1409Open in IMG/M
3300031719|Ga0306917_11389927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae542Open in IMG/M
3300031724|Ga0318500_10487603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300031744|Ga0306918_11219895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia580Open in IMG/M
3300031747|Ga0318502_10451763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300031747|Ga0318502_10456782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300031747|Ga0318502_10479765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria744Open in IMG/M
3300031747|Ga0318502_10912037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300031751|Ga0318494_10132329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1396Open in IMG/M
3300031764|Ga0318535_10057366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1640Open in IMG/M
3300031765|Ga0318554_10093417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1686Open in IMG/M
3300031778|Ga0318498_10408020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia603Open in IMG/M
3300031779|Ga0318566_10406172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300031780|Ga0318508_1126030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria720Open in IMG/M
3300031797|Ga0318550_10457867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300031805|Ga0318497_10178430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300031821|Ga0318567_10074012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1805Open in IMG/M
3300031831|Ga0318564_10165446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300031846|Ga0318512_10366224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300031910|Ga0306923_12348094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae530Open in IMG/M
3300032043|Ga0318556_10158459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300032089|Ga0318525_10446460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300032091|Ga0318577_10402073Not Available654Open in IMG/M
3300032174|Ga0307470_10665248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300032205|Ga0307472_101188200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300032261|Ga0306920_102146044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300032782|Ga0335082_11631878Not Available518Open in IMG/M
3300032783|Ga0335079_11637616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300032783|Ga0335079_12122129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia538Open in IMG/M
3300032805|Ga0335078_10130776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3577Open in IMG/M
3300032805|Ga0335078_10750625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1199Open in IMG/M
3300032828|Ga0335080_10862361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria931Open in IMG/M
3300033134|Ga0335073_11072873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300033134|Ga0335073_11518094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300033289|Ga0310914_11131269Not Available684Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.03%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland7.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.25%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.25%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.69%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.34%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.34%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.56%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.78%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.78%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024317Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027307Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10900821813300000955SoilMNGKLRVAAIGVALSVAAMLLLLVVRPSLDPAQLRPLPLITG
Ga0066676_1036980123300005186SoilMNGKLRAAAIGLALSVAAVLLLLVVRPSLDPANLRPLPLIIGAWLAF
Ga0070687_10001188963300005343Switchgrass RhizosphereMNGKLRVAAIGVALIVAAMLLLLVVRPSLDPAQLRPLPLIIGAWLAF
Ga0070692_1007351633300005345Corn, Switchgrass And Miscanthus RhizosphereMNGKLRVAAIGVALSVTAMLLLLVVRPSLDPAQLRPLPLIIGAWLAFLVAAW
Ga0070703_1014739713300005406Corn, Switchgrass And Miscanthus RhizosphereMNGKLRVAAIGLALSVAAVLLLLVVRPSLDPANLRPLPLIIGAWLAFLA
Ga0070709_1079856323300005434Corn, Switchgrass And Miscanthus RhizosphereMNGKLRVAAIGVALSVAAMLLLLVVRPSLDPAQLRPLPLITGAWLAFLVAAWLLRK
Ga0070705_10013890733300005440Corn, Switchgrass And Miscanthus RhizosphereMNGKLRVAAIGVALSVAAMLLLLVVRPSLDPAQLRPLPLI
Ga0070708_10177779713300005445Corn, Switchgrass And Miscanthus RhizosphereMNAKVRVAAICLLLVTLAGLVLLVVRPSLNPAHVRPLPLI
Ga0066697_1017577313300005540SoilMNGKLRVAAIGLALSVAAVLLLLVVRSSLDPARLRPLPLIAGAWLAFLV
Ga0070686_10049503813300005544Switchgrass RhizosphereMNGKLRVAAIGVALSVAAMLLLLVVRPSLDPAQLRPLPLITGAWLAFLV
Ga0066693_1029929123300005566SoilMNGKLRVAAIGVALIVAATLLLLVVRPSLDPAQLRPLPLITGAWL
Ga0070761_1006662743300005591SoilMNAKLRVAAIGLAIVIMAGLVLLVVRPGLNPARIRPLPLIAAAW
Ga0068858_10041296633300005842Switchgrass RhizosphereMNGKLRVAAISVALIVAAMLLLLVVRPSLDPAQLRPLPLITGAWLAFL
Ga0070717_1206894223300006028Corn, Switchgrass And Miscanthus RhizosphereMNAKLRLVGIGLALSVLAGLVLLIVRPSVDPARLRPLPLLIG
Ga0066651_1016667433300006031SoilMNGKLRVAAIGLALSVAAILLLLVVRPSLDPAQLRPLPLIIGAWLAF
Ga0075017_10123096713300006059WatershedsMNGKLRVAAIGLALAVLAGLVLLLVRPSINPARIRPLPLLI
Ga0079222_1134027313300006755Agricultural SoilMNGKLRVAGIGLALAVMAVMVLLIVRPSLDPARIRP
Ga0105241_1006611013300009174Corn RhizosphereMNGKLRVAAIGLALSVAAVLLLLVVRPSLDPANLRPLPLIIGAWLAF
Ga0126374_1028684813300009792Tropical Forest SoilVINGKLRVAAIGVALSVAAMLLLLVVRPSLDPARLRPLPLIAGAWLA
Ga0116223_1077168113300009839Peatlands SoilMNAKLRVVAIGVAIVIMAGLILLVVQPGLNPARIRPLPLIAAAWVA
Ga0126382_1105480513300010047Tropical Forest SoilMNGKLRVAAIGLALSVAGMLLLLVVRPSLDPARIRPLPLIIGAWLAFL
Ga0134109_1004066313300010320Grasslands SoilMNGKLRVAGIGLALSVMAGLVLLIVRPSLDPARIRPLPLIIAAWLAFGVAA
Ga0134065_1002709013300010326Grasslands SoilMNVKLRVAGIGLALAVMAVLVLLIVRPSLDPARIRPLPLIIGAWLAF
Ga0126372_1205854913300010360Tropical Forest SoilMDGTLRTMNGKLRVAGIGLALSVMGGLVLLVVRPSLDPAQIRPLPLIAGA
Ga0105239_1022859613300010375Corn RhizosphereMNGKLRVAAISVALIVAAMLLLLVVRPSLDPAQLRPLPLITGAWLAFLVAAW
Ga0137388_1024806413300012189Vadose Zone SoilMNGKLRVAAIGLALSVMAGLVLLLVRPSIDPARIRWLP
Ga0137388_1035681413300012189Vadose Zone SoilMYGKLRVAAIGLALAVLAGLVLLLVRPSINPAQIRPLPLLIGAWFAFLAGA
Ga0137364_1080798313300012198Vadose Zone SoilMNGKLRVAGIGLALAVMAVLVLLIVRPSLDPARIRPLPLIIGAWLAF
Ga0137385_1039203513300012359Vadose Zone SoilMNGKLRVAAIGLALAVLAGLVLLLVRPSINPAQIRPLPLLIGAWLAFIAAAWL
Ga0137361_1187039913300012362Vadose Zone SoilMNGKLRVAATGLALSVLAGLVLLLVRPSLNPAQIRPLPLLIGAWIA
Ga0157344_100819013300012476Arabidopsis RhizosphereMNGKLRVAAIGVALSVAAMLLLLVVRPSLDPAQLRPLPLITGAWLAFLVAA
Ga0157320_100486913300012481Arabidopsis RhizosphereMNGKLRVAAIGVALSVAAMLLLLVVRPSLDPARLRPLPLITGAWLAF
Ga0157349_100049643300012489Unplanted SoilMNGKLRVAAIGVALIVAAMLLLLVVRPSLDPAQLRPLPLI
Ga0164302_1032816823300012961SoilMNGKLRAAAIGLALSVAAVLLLLVVRPSLDPANLRPLPLIIGAWLAFLVA
Ga0164308_1060433313300012985SoilMNGKLRAAAIGLALSVAAVLLLLVVRPSLDPANLRPLPLIIGAWLAFLVAAWL
Ga0181531_1012373033300014169BogMNAKLRVAAISLALIVIAGLVLLLVRPALDPARVRPLALLIGAWMAFIAAAWL
Ga0182016_1056791623300014493BogMNARLRVAAISLALIVIAGLVLLLVRPAHDPARLRPLPLLIGAWMAFIVAAWL
Ga0181522_1028883523300014657BogMNAKARVAAICLALMALAGLVLLVVRPSLNPAHVRPLPVI
Ga0137403_1125433623300015264Vadose Zone SoilMNGKLRVAAVSVALVVLAGLVLLIVRPGLNPARIR
Ga0132256_10031945813300015372Arabidopsis RhizosphereMDGTLRTMNGKLRVVGIALALSVMGGLVQLVVRPSLDPANLRPLPLIIGAWLAFLVAA
Ga0182036_1109731113300016270SoilMNGKLRVAGIGLALSVSAVLVLLTVRPSLDPARIRPLPLIIGAWLAFLVAAWLLRK
Ga0187812_100709013300017821Freshwater SedimentMNAKLRVVAIGLAIVIMAGLVLLVVRPGLNPARIRPLPLIAAAWVAFLVAA
Ga0187820_108593013300017924Freshwater SedimentMNVKVRVVAICLALSALGGLVLLVVRPSLNPANVRPLPLIALAW
Ga0187814_1036355323300017932Freshwater SedimentMNVKVRVAAICLALTALAGLVLLVVRPSLNPANVR
Ga0187808_1017420033300017942Freshwater SedimentMNARLRVAGICLALLVMAGLILLVVRPSLNPAQIRPLPLIAGAWI
Ga0187879_1030560713300017946PeatlandKLRVAAISLALIVIAGLVLLLVRPAHDPARVRPLRC
Ga0187776_1084108713300017966Tropical PeatlandMNVKVRVVAICLALSALAGLVLLVVRPSLNPAHVRPLPLIALAWIVFLTAAW
Ga0187781_1079719213300017972Tropical PeatlandMNAKLRVAAISLLLASLGGLVLLVVRPSLNPAHVRPLP
Ga0187777_1053903913300017974Tropical PeatlandMNGKIRVAAICLALSLMAGLVLLLVRPSLNPARVKPLPLLIGAW
Ga0187782_1013601513300017975Tropical PeatlandMNAKVRVAAICLAISVLAGLVLLLVRPSLDPARVRPLPLLIGAWIAF
Ga0187782_1082104213300017975Tropical PeatlandMNAKLRVAAICLALLALTGLVLLVVRPSLNPAHVRQLPLIALGWIAFLTAAWL
Ga0187767_1020767613300017999Tropical PeatlandMNGKLRVAAIGLALSVLAGLMLLLVRPSINPARVQPLPLLIGAWIAF
Ga0187805_1036200513300018007Freshwater SedimentMNVKVRVAAICLALAALAGLVLLVVRPSLNPANVRPLPLI
Ga0187766_1016594513300018058Tropical PeatlandMNARLRVAAICLALSVMAGLLLLVVRPSLNPAQIRP
Ga0187784_1106951023300018062Tropical PeatlandMIGLLLLVVTGLTLLLVRPRLDPAKIQPLPLVACAWIAFLAALWLLRKVR
Ga0187769_1039479613300018086Tropical PeatlandMNAKLRVIAIGLAIVVMAGLVLLVVRPGLNPARIRPLPLIAAAWAAFL
Ga0137408_116274043300019789Vadose Zone SoilMNGKLRVAAIGLALSVAAMLLLLVLRPSLDPAQLRPLPLIIGAWLAFLTAAW
Ga0193723_109913813300019879SoilMNGKLRVAAIGLALSVAAMLLLLVIRPSLDPAQLRPLPLIIGAWLAFLVA
Ga0197907_1140963513300020069Corn, Switchgrass And Miscanthus RhizosphereMNGKLRVAAIGVALIVAAMLLLLVVRPSLDPAQLRPLPLITG
Ga0193699_1014200313300021363SoilMNGKLRVAAIGLALSAAAVLLLLVVRPSLDPARLRPLPLITGAWLAFLVAAWLLRKV
Ga0213876_1047012623300021384Plant RootsVPVINGKLRVAAVSMALAVLAGLILMVVRPGLDPARIRPLALIA
Ga0210393_1019556913300021401SoilMYGKLRVAAIGLALSVLAGLVLLLVRPSINPARIRPLPLLIAAWIAF
Ga0210385_1013496913300021402SoilMNVKLRVTAICLALAVLAGLVLVVVRPSLNPAHVRPLPVIALAWMVF
Ga0210397_1049581323300021403SoilMYGKLRVAAIGLALSVLAALVLLLVRPSIDPARIRPC
Ga0210387_1055256723300021405SoilMNAKLRLVGIGLALSVLAGLVLLIVRPSVDPARLRPLPLLIGAWIAFIVAA
Ga0210383_1121466423300021407SoilMNVKVRVAAICLALIALAGLVLLVVRPSLNPAHVRPLPLISLAWIAFLTAAF
Ga0213878_1011743313300021444Bulk SoilMNAKVRVVAICLALSALAVLVLLVVRPSLNPAHVRPLPLIA
Ga0210398_1107288413300021477SoilMNGKLRVAAIGLALSVTAAMILLLLWPQLDPARLRWLPLLIGAWLAFISAAW
Ga0210402_1081070413300021478SoilMNGKLRVAGIGLALAVMAGLVLLIVRPSLDPARVRPLPLIIGAWLAFLAA
Ga0247660_105413813300024317SoilMNGKLRVAAISVALIVAAMLLLLVVRPSLDPAQLRPLPLITGAWLAFLVAAWLLRKV
Ga0207699_1092065523300025906Corn, Switchgrass And Miscanthus RhizosphereMNGKLRVAAIGLALSVAAVLLLLVVRPSLDPANLRPLPLIIGAWLAFL
Ga0207684_1072818413300025910Corn, Switchgrass And Miscanthus RhizosphereMNGKLRVATIGLALSVAAMLLLLVVRPSLDPAQLRPLPLIIGAWLAFLTAAW
Ga0207650_1150197113300025925Switchgrass RhizosphereMNGKLRVAVIGVALSVAAMLLLLVVRPSLDPAQLRPLPL
Ga0207669_1190710513300025937Miscanthus RhizosphereMNGKLRVAAIGLALSVAAVLLLLVVRPSLDPANLRPLPLIIGAW
Ga0209648_1066224213300026551Grasslands SoilMNGKLRVAAIGLALSVLAGLVLLLVRPSLNPAQIRPLPLL
Ga0209577_1027405413300026552SoilMNGKLRVAGIGLALAVMAVLVLLIVRPSLDPARIRPLPLIIGA
Ga0179587_1075254023300026557Vadose Zone SoilMNGKLRAAAIGLALSVAAVLLLLVVRPSLDPANLR
Ga0209327_106586623300027307Forest SoilMNGKLRVAGIGLALSVMGGLVLLVVRPSLDPAQIRPLPLIAGAWLAFLVAAWLLI
Ga0209040_1007849813300027824Bog Forest SoilMNGKLRVAAIGLALSVMAALILLLVRPSLDPARIRWLPLLIGAWIAFIAAAW
Ga0209180_1039358523300027846Vadose Zone SoilMNGKLRVAAIGLALSVMAGLVLLVRPSIDPARIRRLPLL
Ga0307311_1009885313300028716SoilMNGKLRVAAIGLALSVAAMLLLLVIRPSLDPAQLRPLPLIIGAWLAFL
Ga0307504_1009142723300028792SoilMNGKLRAAAIGLALSVAAVLLLLVVRPSLDPANLRPLPLIIG
Ga0307308_1037229823300028884SoilMNGKLRVAAIGLALSVAAMLLLLVVRPSLDPAQLRPLPLIIGAWLAFLTAAWLLRKV
Ga0311340_1016397013300029943PalsaVSEKLRVAATGLLLAVLAGLVLLVVRPSLNPAQVR
Ga0302181_1006077813300030056PalsaVSEKLRVAATGLLLAVLAGLVLLVVRPSLNPAQVRPLPLIALAWIAFLTA
Ga0310037_1027768923300030494Peatlands SoilMNGKLRVAAIGLALSVTAALILLLVRPGLDPARLRWLPLLIGAWIAFIA
Ga0311370_1131628113300030503PalsaVSEKLRVAATGLLLAVLAGLVLLVVRPSLNPAQVRPLP
Ga0318571_1020554113300031549SoilMNARLRVAAICLALSVMAGLVLLVVRPSLNPAQIRPLP
Ga0318573_1055831313300031564SoilMNGKLRVAGIGLALSVSAVLVLLTVRPSLDPARIR
Ga0318515_1012666333300031572SoilMNVKIRVAAIGLALSALTGLVLLLVRPSIDPARIRPLPLLI
Ga0318515_1018630723300031572SoilMNVKVRVVAICLALSALAGLVLLVIRPSLNPAHVRPLPLIALAWIAFLT
Ga0318572_1027322013300031681SoilMNVKIRVAAIGLALSALAGLVLLLVRPSIDPARIRPLPLLIGAWLA
Ga0310686_11077740913300031708SoilMNVKLRVAAIVLALSVMAGLVLLVVRPSLNPAQIRPLPL
Ga0318496_1012238213300031713SoilMNVKVRVVAICLALSALAGLVLLVIRPSLNPAHVRPLPLIALA
Ga0306917_1138992713300031719SoilMNGKLRVAGIGLALSVMAGLVLLIVRPSLDPARIRPLPLIIGAWLA
Ga0318500_1048760313300031724SoilMNVKVRVAAICLALTALAGLVLLVVRPSLNPAHVRPLPLIALAWIAFLTAAFLL
Ga0306918_1121989513300031744SoilMNVKIRVAAIGLALSALAGLVLLLVRPSIDPARIRPLPLLIGAWIAFL
Ga0318502_1045176323300031747SoilMNVKVRVVAICLALSALAGLVLLVVRPSLNPAHVRPLPLIALAWIAFLTAA
Ga0318502_1045678223300031747SoilMNAKVRVVAICLALSALAGLVLLVVRPSLNPAHVRPLPLIALA
Ga0318502_1047976523300031747SoilMNVKIRVAAIGLALSALTGLVLLLVRPSIDPARIRPLPLLIGAWIAFLAAAWLLRK
Ga0318502_1091203713300031747SoilMNGKLRVAGIGLALSVSAVLVLLTVRPSLDPARIRPLPLIIGAWLA
Ga0318494_1013232933300031751SoilMNAKLRVAAICLALSALAGLVLLVVRPSLNPAHVRPLP
Ga0318535_1005736633300031764SoilMNARLRVAAICLALSVMAGLVLLVVRPSLNPAQIRPLPLIAAAWIT
Ga0318554_1009341713300031765SoilMNGKIRVAGIGLALSVMAGLVLLIVRPSLDPARIRPLPLIIG
Ga0318498_1040802013300031778SoilMNVKVRVVAICLALSALAGLVLLVVRPSVNPAHHQ
Ga0318566_1040617223300031779SoilMNGKLRVAGIGLALSVMGGLVLLVVRPSLDPAQIRPLP
Ga0318508_112603023300031780SoilMNVKVRVVAICLALSALAGLVLLVVRPSVNPAHVR
Ga0318550_1045786713300031797SoilMNGKLRVAGIGLALSVSAVLVLLTVRPSLDPARIRPL
Ga0318497_1017843023300031805SoilMNAKLRVAAICLALSALAGLVLLVVRPSLNPAHVRPLPLITLAWITFL
Ga0318567_1007401243300031821SoilMNARLRVAAICLALSVMAGLVLLVVRPSLNPAQIRPLPLIAAAWITFL
Ga0318564_1016544623300031831SoilMNVKVRVAAICLALTALASLVLLVVRPSLNPAHVRPLPLIALA
Ga0318512_1036622413300031846SoilMNGKLRVAAIGLALSVLAGLVLLLVRPSLNPARVQPLALLI
Ga0306923_1234809423300031910SoilMNGKLRVAGIGLALSVMGGLVLLVVRPSLDPAQIRPLPLIAGAWLAFLVAAW
Ga0318556_1015845913300032043SoilMNGKLRVAGIGLALSVSAVLVLLTVRPSLDPARIRPLPLIIGAWLAFLVAAW
Ga0318525_1044646013300032089SoilMNVKVRVVAICLALSALAGLVLPVIRPSLNPAHVRPLPLIALA
Ga0318577_1040207323300032091SoilMNARLRVAAICLALSVMAGLVLLVVRPSLNPAQIRPLPLIAAAWITF
Ga0307470_1066524823300032174Hardwood Forest SoilMNGKLRVAAIGLALSVAAVLLLLVVRPSLDPARLRPLPLITGAWLAFLV
Ga0307472_10118820023300032205Hardwood Forest SoilMNGKLRVAGIGLALSVMAGLVLLVVRPALDPARVRPLPLLVGAW
Ga0306920_10214604413300032261SoilMNGKLRVAGIGLALSVMGGLVLLVVRPSLDPAQIRPLPLIAGAWLAFLVAAWLL
Ga0335082_1163187823300032782SoilMNGKLRVAGIGLALSVMAGLVLLIVRPSLDPARIRPLPLIIGAWLAFLVAAWL
Ga0335079_1163761623300032783SoilMNGKLRVAAIGLALSVLAGLVLLLVRPSLNPARVQPLPLLIGAWMAF
Ga0335079_1212212923300032783SoilMNGKLRVAAIGLALSVLAGLVLLLVRPSLNPARVQPLSLLIGAWMAF
Ga0335078_1013077613300032805SoilMNAKLRVAAIGLALSVMAGLVLLLVRPSINPARIRPLPLL
Ga0335078_1075062513300032805SoilMNVKLRAAAIGLLLAVLGGLVLLVVRPSLNPAHVRPLPVIALAWM
Ga0335080_1086236123300032828SoilMNAKIRVAAIGLALSLLAGLVVLLVRPSIDPARIRPLPLLIGAWTAFLAAAWLL
Ga0335073_1107287323300033134SoilMHPAMSSRLRVSAICAALAVLVMMVLLLVRPSLDPARIRPLPLLIMAWVAFLAAAWL
Ga0335073_1151809423300033134SoilMNAKIRAAAIGLLLSVLTGLVLLLVRPSLDPARIRPLALLIGAWLAFITAAFLLR
Ga0310914_1113126923300033289SoilMNGKLRVAGIGLALSVMGGLVLLVVRPSLDPAQIRPLPLIAGAWLAFLV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.