NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064388

Metagenome / Metatranscriptome Family F064388

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064388
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 106 residues
Representative Sequence SGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Number of Associated Samples 98
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.22 %
% of genes near scaffold ends (potentially truncated) 81.25 %
% of genes from short scaffolds (< 2000 bps) 89.84 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (67.969 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(71.094 % of family members)
Environment Ontology (ENVO) Unclassified
(75.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(75.781 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.03%    β-sheet: 36.09%    Coil/Unstructured: 51.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.97 %
UnclassifiedrootN/A32.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008044|Ga0099804_1710807All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa715Open in IMG/M
3300008832|Ga0103951_10414571All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa718Open in IMG/M
3300008998|Ga0103502_10095175All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa1055Open in IMG/M
3300009022|Ga0103706_10155407All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa569Open in IMG/M
3300009269|Ga0103876_1039132All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa645Open in IMG/M
3300009269|Ga0103876_1040521Not Available638Open in IMG/M
3300009276|Ga0103879_10004791All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa846Open in IMG/M
3300009276|Ga0103879_10010098All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa739Open in IMG/M
3300009279|Ga0103880_10016022All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa812Open in IMG/M
3300018612|Ga0193121_1034414Not Available648Open in IMG/M
3300018643|Ga0193431_1022518Not Available663Open in IMG/M
3300018643|Ga0193431_1029811All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa581Open in IMG/M
3300018654|Ga0192918_1062760All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa532Open in IMG/M
3300018673|Ga0193229_1037370All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa579Open in IMG/M
3300018673|Ga0193229_1040721All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa560Open in IMG/M
3300018685|Ga0193086_1040870All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa729Open in IMG/M
3300018685|Ga0193086_1042985All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa708Open in IMG/M
3300018690|Ga0192917_1060046All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa563Open in IMG/M
3300018737|Ga0193418_1077588All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa527Open in IMG/M
3300018782|Ga0192832_1022484All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa808Open in IMG/M
3300018792|Ga0192956_1143106Not Available532Open in IMG/M
3300018794|Ga0193357_1055466Not Available656Open in IMG/M
3300018802|Ga0193388_1055981All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa626Open in IMG/M
3300018835|Ga0193226_1103655All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa633Open in IMG/M
3300018850|Ga0193273_1044913All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa640Open in IMG/M
3300018850|Ga0193273_1058462Not Available577Open in IMG/M
3300018853|Ga0192958_1101412Not Available696Open in IMG/M
3300018856|Ga0193120_1073528All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa820Open in IMG/M
3300018872|Ga0193162_1094164Not Available571Open in IMG/M
3300018882|Ga0193471_1062203Not Available716Open in IMG/M
3300018883|Ga0193276_1123909All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa518Open in IMG/M
3300018901|Ga0193203_10252660Not Available564Open in IMG/M
3300018912|Ga0193176_10167902All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa618Open in IMG/M
3300018923|Ga0193262_10124519All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa501Open in IMG/M
3300018930|Ga0192955_10124618All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa654Open in IMG/M
3300018942|Ga0193426_10146819All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa529Open in IMG/M
3300018949|Ga0193010_10075699All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa579Open in IMG/M
3300018950|Ga0192892_10222699All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa605Open in IMG/M
3300018951|Ga0193128_10177820Not Available512Open in IMG/M
3300018952|Ga0192852_10251160All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa558Open in IMG/M
3300018958|Ga0193560_10158248All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa720Open in IMG/M
3300018964|Ga0193087_10230824All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa587Open in IMG/M
3300018970|Ga0193417_10074599All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa1142Open in IMG/M
3300018974|Ga0192873_10423614Not Available527Open in IMG/M
3300018974|Ga0192873_10430467All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa520Open in IMG/M
3300018974|Ga0192873_10432499All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa518Open in IMG/M
3300018979|Ga0193540_10216877All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa522Open in IMG/M
3300018985|Ga0193136_10185166All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa621Open in IMG/M
3300018985|Ga0193136_10185702All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa620Open in IMG/M
3300018986|Ga0193554_10144957All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa848Open in IMG/M
3300018986|Ga0193554_10169606All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa796Open in IMG/M
3300018986|Ga0193554_10246955Not Available672Open in IMG/M
3300018986|Ga0193554_10246966Not Available672Open in IMG/M
3300018986|Ga0193554_10365883All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa543Open in IMG/M
3300018988|Ga0193275_10296405Not Available509Open in IMG/M
3300018990|Ga0193126_10161140All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa672Open in IMG/M
3300018992|Ga0193518_10184812All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa806Open in IMG/M
3300018995|Ga0193430_10177970All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa520Open in IMG/M
3300018996|Ga0192916_10123651All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa776Open in IMG/M
3300018996|Ga0192916_10126413All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa767Open in IMG/M
3300018998|Ga0193444_10171520All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa571Open in IMG/M
3300018999|Ga0193514_10224632Not Available667Open in IMG/M
3300018999|Ga0193514_10236748Not Available644Open in IMG/M
3300019000|Ga0192953_10081535Not Available756Open in IMG/M
3300019000|Ga0192953_10168777Not Available554Open in IMG/M
3300019004|Ga0193078_10072555All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa745Open in IMG/M
3300019004|Ga0193078_10126149All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa620Open in IMG/M
3300019004|Ga0193078_10128961All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa615Open in IMG/M
3300019007|Ga0193196_10291622All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa702Open in IMG/M
3300019008|Ga0193361_10218069All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa697Open in IMG/M
3300019010|Ga0193044_10164773Not Available718Open in IMG/M
3300019011|Ga0192926_10219975All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa808Open in IMG/M
3300019011|Ga0192926_10363654Not Available615Open in IMG/M
3300019012|Ga0193043_10234850Not Available705Open in IMG/M
3300019012|Ga0193043_10325608All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa546Open in IMG/M
3300019013|Ga0193557_10176406All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa724Open in IMG/M
3300019013|Ga0193557_10189906All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa687Open in IMG/M
3300019018|Ga0192860_10325077All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa548Open in IMG/M
3300019023|Ga0193561_10211072Not Available752Open in IMG/M
3300019023|Ga0193561_10272764Not Available621Open in IMG/M
3300019024|Ga0193535_10285720All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa501Open in IMG/M
3300019039|Ga0193123_10453531All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa501Open in IMG/M
3300019040|Ga0192857_10107940All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa788Open in IMG/M
3300019040|Ga0192857_10110126Not Available783Open in IMG/M
3300019040|Ga0192857_10195962All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa646Open in IMG/M
3300019040|Ga0192857_10251740All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa588Open in IMG/M
3300019040|Ga0192857_10294680All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa553Open in IMG/M
3300019040|Ga0192857_10320657All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa533Open in IMG/M
3300019053|Ga0193356_10181091All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa740Open in IMG/M
3300019091|Ga0192935_1019528All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa607Open in IMG/M
3300019105|Ga0193374_1015151All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa571Open in IMG/M
3300019105|Ga0193374_1017673Not Available527Open in IMG/M
3300019126|Ga0193144_1062148Not Available650Open in IMG/M
3300019131|Ga0193249_1090733Not Available712Open in IMG/M
3300019143|Ga0192856_1025697All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa760Open in IMG/M
3300019143|Ga0192856_1049028All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa601Open in IMG/M
3300019143|Ga0192856_1050248All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa595Open in IMG/M
3300019152|Ga0193564_10194935All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa615Open in IMG/M
3300021951|Ga0222624_1438142All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa553Open in IMG/M
3300030531|Ga0210274_1872276All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa507Open in IMG/M
3300030543|Ga0210289_1489219All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa584Open in IMG/M
3300030545|Ga0210271_10834100All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa573Open in IMG/M
3300030568|Ga0257206_1123871All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa553Open in IMG/M
3300030572|Ga0210258_10475680All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa506Open in IMG/M
3300030573|Ga0210272_1068535All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa779Open in IMG/M
3300030597|Ga0210286_1257998All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa556Open in IMG/M
3300030610|Ga0247613_10071415All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa953Open in IMG/M
3300030626|Ga0210291_11912968All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa591Open in IMG/M
3300030738|Ga0265462_10716993All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa794Open in IMG/M
3300030752|Ga0073953_11497664All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa645Open in IMG/M
3300030842|Ga0075404_11410995All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa526Open in IMG/M
3300030854|Ga0075385_10993006All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa504Open in IMG/M
3300031056|Ga0138346_10362872All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa708Open in IMG/M
3300031113|Ga0138347_10602190All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa542Open in IMG/M
3300031121|Ga0138345_10909465All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa549Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine71.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.84%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water3.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.12%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.12%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.78%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.78%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral0.78%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008044Coral microbial communities from Puerto Morelos, Mexico - Orbicella C A metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300018612Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782446-ERR1711922)EnvironmentalOpen in IMG/M
3300018643Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782462-ERR1712152)EnvironmentalOpen in IMG/M
3300018654Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000841 (ERX1782169-ERR1712180)EnvironmentalOpen in IMG/M
3300018673Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_048 - TARA_N000000115 (ERX1782433-ERR1712189)EnvironmentalOpen in IMG/M
3300018685Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782360-ERR1712233)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018737Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789417-ERR1719385)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018792Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018802Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789649-ERR1719297)EnvironmentalOpen in IMG/M
3300018835Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000284 (ERX1782152-ERR1712198)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018856Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782473-ERR1712200)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018901Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126)EnvironmentalOpen in IMG/M
3300018912Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243)EnvironmentalOpen in IMG/M
3300018923Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001123 (ERX1789560-ERR1719496)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018949Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002172 (ERX1782262-ERR1712034)EnvironmentalOpen in IMG/M
3300018950Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789413-ERR1719427)EnvironmentalOpen in IMG/M
3300018951Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860)EnvironmentalOpen in IMG/M
3300018952Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000539 (ERX1782281-ERR1712142)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018990Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001334 (ERX1782458-ERR1711911)EnvironmentalOpen in IMG/M
3300018992Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_146 - TARA_N000003240 (ERX1789485-ERR1719233)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019013Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003089EnvironmentalOpen in IMG/M
3300019018Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789537-ERR1719348)EnvironmentalOpen in IMG/M
3300019023Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_145 - TARA_N000003231EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019091Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001510 (ERX1782237-ERR1711876)EnvironmentalOpen in IMG/M
3300019105Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001942 (ERX1782301-ERR1712219)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030565Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030568Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030583Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030593Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030597Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030610Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030752Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0099804_171080713300008044CoralKLRMPHSGRSSSLMHPGGDHLYRPVMEKVEYLVSHMDGDEDLVCLNEDFEEVFFKLSPDREDTYGKITECIEKGQDEGKDVYVTVLEGPKKTGDNIEVLQIVTEAKAVNPQ*
Ga0103951_1041457123300008832MarineMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE*
Ga0103502_1009517523300008998MarineMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE*
Ga0103706_1015540723300009022Ocean WaterMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKI
Ga0103876_103913213300009269Surface Ocean WaterDLKFSKTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE*
Ga0103876_104052113300009269Surface Ocean WaterLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEPQ*
Ga0103879_1000479123300009276Surface Ocean WaterGMPGTVSDLKFSKTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE*
Ga0103879_1001009813300009276Surface Ocean WaterMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEPQ*
Ga0103880_1001602213300009279Surface Ocean WaterGMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLAEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE*
Ga0193121_103441423300018612MarineTWGLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193431_102251813300018643MarineMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKTREEVYTKVTETIENGQDDGKDVYVTVLEGPRKNESGKIEILQIITEAKAVNPE
Ga0193431_102981123300018643MarineRMPHSGRASSAMHPGGDHLCKPVMEKIEYLVSHMDGDEDLVCLNDDFEEIFFKLSPEREDVYKTVTECIENGQDSGKDVYVTVLEGPKKVGDLIEILQIVTDVKAVEPQN
Ga0192918_106276013300018654MarineKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEPQ
Ga0193229_103737013300018673MarineHSGRASSAMHPGGDHLTRPVMEKIEYLVSHYDKNSEELSCLDEDFEEIFFKLSKTREEVHKKVTECIENGQNEGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0193229_104072113300018673MarinePVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEPQ
Ga0193086_104087013300018685MarineGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEP
Ga0193086_104298513300018685MarineHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0192917_106004613300018690MarineGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEPQ
Ga0193418_107758813300018737MarinePHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREETYTKVTETIESGQNDGKDVYVTVLEGPRKVGDKIEILQSVTEAKAVNPE
Ga0192832_102248413300018782MarineKHGHAKFTYKLRMPHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIENGQNDGKDVYVTVLEGPRKVGDKIDILQSVTEAKAVNPE
Ga0192956_114310613300018792MarineSILMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNDDYEEIYFKLSQKDRPEVYKEITECIENGQSDGKDVFVTVLEGPKKLGSKLDILQLVTDAKSVNPE
Ga0193357_105546613300018794MarineKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKTREEVYTKVTETIENGQDDGKDVYVTVLEGPRKNESGKIEILQIITEAKAVNPE
Ga0193388_105598113300018802MarineMQFTYKLRMPHSGRASSAMHPGGDHLCRPVMEKIEYLVSHMDGDEDLVCLNEDFEEVFFKLDPSREDVYKAVTECIETGQDEGKDVYVNVLEGPKKVGDNIEILQIVTEAKAVVPT
Ga0193226_110365513300018835MarineGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEPQ
Ga0193273_104491323300018850MarineHGHMDGEEDLVCLDEDFEEIFFKISKTREEVYTKVTEMIENGQNDGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0193273_105846213300018850MarineHMDGEEDLVCLDEDFEEIFFKLSKTREEIYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0192958_110141213300018853MarineGRASILMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNDDFEEIYFKLSEKDRPEVYKEITECIENGQSDGKDVFVTVLEGPKKLGSKLDILQLVTDAKSVNPE
Ga0193120_107352813300018856MarineMGGMPGTVSDLKFSKTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193162_109416413300018872MarineEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTKVTECIENGQNDGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0193471_106220313300018882MarineGGDHLVRPVMEKIEYLVSHMDGDEDLVCLNDDYEEIYFKLSQKDRPDVHKEITECIENGQNDGKDVYVTVLEGPKKLGDKLEILQIVTDAKSVNPE
Ga0193276_112390913300018883MarineSSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEIYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193203_1025266013300018901MarineAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREETYTKVTETIESGQNDGKDVYVTVLEGPRKVGDKIEILQSVTEAKAVNPE
Ga0193176_1016790213300018912MarineTVSDLKFSKTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193262_1012451913300018923MarineFTYKLRMPHSGRASNLMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLNDDFEEIYFKLSQKDRPEVYKEITECIENGQGDGKDVFITVLEGPKKLGDKLDILQLVTDAKSVNPE
Ga0192955_1012461813300018930MarineMGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLCRPVMEKIEYLVSHMDGDEELVCLNDDFEEIFFKLSPEREDVYKTVTETIETGQDEGKDVYVTVLEGPKKDAKGIEILQIVTDVKAVDPQ
Ga0193426_1014681913300018942MarineAKFTYKLRMPHSGRASSAMHPGGDHLCKPVMEKIEYLVSHMDGDEDLVCLNDDFEEIFFKLSPEREDVYKTVTECIENGQDSGKDVYVTVLEGPKKVGDQIEILQIVTDVKAVDPQ
Ga0193010_1007569913300018949MarineSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREETYTKVTETIETGQNDGKDVYVTVLEGPRKVGDKIEILQSVTEAKAVNPE
Ga0192892_1022269913300018950MarineLVSHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIETGQNDGKDVYVTVLEGPRKFGDKIDILQSVTEAKAVNPE
Ga0193128_1017782013300018951MarineHGHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTECIENGQDDGKDVYVTVLEGPKKLGDKIEILQIVMEAKAVEPQ
Ga0192852_1025116013300018952MarineTWVPHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIENGQNDGKDVYVTVLEGPRKVGDKIDILQSVTEAKAVNPE
Ga0193560_1015824813300018958MarineMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193087_1023082413300018964MarineRMPHSGRASSAMHPGGDHLCKPVMEKIEYLVSHMDGDEDLVCLNDDFEEIFFKLSPEREDVYKTVTECIENGQDSGKDVYVTVLEGPKKVGDQIEILQIVTDVKAVDPQ
Ga0193417_1007459923300018970MarineMHPGGDHLTRPVMEKIEYLVSHYDKNSEELSCLDEDFEEIFFKLSKTREEVHKKVTECIENGQNAGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0192873_1042361413300018974MarineMGDFEEIYFKLSKVDRPEVYEEITELIENGQGDGKDVYVTVLEGPKKLGDKLEILQIVTDAKAVNPE
Ga0192873_1043046723300018974MarineMGPVMEKVEYLVSHMDGDEDLVCLNEDFEEIFFKLSPERAEVYTEVTETITNGQDEGKDVYVTVLEGPKKVNDNIEILQIVTEVKAVVPQ
Ga0192873_1043249913300018974MarineKHGHAKFTYKLRMPHSGRASSAMHPGGDHLCRPVMEKIEYLVSHMDGDEDLVCLNEDFEEVFFKLDPSREDVYKLVTELIETGQDEGKDVYVNVLEGPKKVGDKIEILQIVTDAKAVVPT
Ga0193540_1021687713300018979MarineKLRMPHSGRASSAMHPGGDHLSRPVMEKVEYLVSHMDGDEDLVCLNEDFEEIFFKLSPERAEVYTEVTETITNGQDEGKDVYVTVLEGPKKVNDNIEILQIVTEVKAVVPQ
Ga0193136_1018516613300018985MarineKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193136_1018570213300018985MarineHGHAKFTYKLRMPHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIENGQNDGKDVYVTVLEGPRKVGDKIDILQSVTEAKAVNPE
Ga0193554_1014495723300018986MarineHGGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193554_1016960613300018986MarineTWGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193554_1024695523300018986MarineTWDLIRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSPSRADVYKEVTETIENGQNDGKDVFVTILEGPRKTGDKIEILQIVTDVKAVNPE
Ga0193554_1024696623300018986MarineTWDLIRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSPSRADVYKEVTETIENGQNDGKDVFVTILEGPRKTGDKIDILQIVTDVKAVNPE
Ga0193554_1036588313300018986MarineLRMPRSGRASSAMHPGGDHLYRPVMEKVEYLVSHMDGDEDLVCLNEDFEEIFFKLSSEREDVYNTVTETITTGQDEGKDVYVTVLEGPKKVNDNVEILQIVTEVKAVNP
Ga0193275_1029640513300018988MarineTWVVCLNEDFEEIYFKLSKTREEVYTKVTECIETGQDDGKDVYVTVLEGPKKNESGKIEILQIITEAKAINPE
Ga0193126_1016114013300018990MarineHAKFTYKLRMPHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTEMIENGQDDGKDVYVTVLEGPKKLGDKIEILQIVMEAKAVEPQ
Ga0193518_1018481213300018992MarineSKTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIEEGQNDGKDVYVTVLEGPRKFGDKIDILQSVTEAKAVNPE
Ga0193430_1017797013300018995MarineMGHAKFTYKLRMPHSGRASSAMHPGGDHLSRPVMEKVEYLVSHMDGEDDLVCLNEDFEEIFFKLSPKREEVYANVTETIQSGQDEGKDVYVTVLEGPKKVNDTIEILQIVTEVKAVNP
Ga0192916_1012365123300018996MarineTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKISKTREEVYTKVTECIENGQNDGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0192916_1012641323300018996MarineGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193444_1017152013300018998MarineEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEPQ
Ga0193514_1022463223300018999MarineGPVMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193514_1023674813300018999MarineHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKTREEVYTKVTETIENGQDDGKDVYVTVLEGPRKNESGKIEILQIITEAKAVNPE
Ga0192953_1008153513300019000MarineSILMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNDDYEEIYFKLSQKDRPEVYKEITECIENGQSDGKDVYVTVLEGPKKLGSKLDILQLVTDAKSVNPE
Ga0192953_1016877713300019000MarineSILMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNDDYEEIYFKLSQKDRPEVYKEITECIENGQSDGKDVYVTVLEGPKKLGSKLDILQMVTDAKAVNPE
Ga0193078_1007255523300019004MarineKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVFLDEDFEEIFFKISKTREEVYTKVTEMIENGQNDGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0193078_1012614913300019004MarineHGGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLSRPVMEKTEYLVSHMDGDEDLVCLNEDFEEVFFKLSAEREDVYKSVTECIETGQNDGKDVYVTVLEGPKKVGDSIEILQIVMDAKAVVPQ
Ga0193078_1012896113300019004MarineSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193196_1029162213300019007MarineAKFTYKLRMPHSGRASSAMPPGGDHLIRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSPSRADVYKEVTETIENGQNDGKDVFVTILEGPRKTGDKIEILQIVTDVKAVNPE
Ga0193361_1021806913300019008MarineTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLTRPVMEKTEYLVSHYDKTSEELSCLDEDFEEIFFKLSKTREEVHKKVTECIENGQNEGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0193044_1016477313300019010MarineTWDGDEDLVCLNDDYEEIYFKLSQKDRPDVHKEITECIENGQNDGKDVYVTVLEGPKKLGDKLEILQIVTDAKSVNPE
Ga0192926_1021997513300019011MarineHGHAKFTYKLRMPHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKTREEVYTKVTETIENGQDDGKDVYVTVLEGPRKNESGKIEILQIITEAKAVNPE
Ga0192926_1036365413300019011MarineMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSPSRADVYKEVTETIENGQNDGKDVFVTILEGPRKTGDKIEILQIVTDVKAVNPE
Ga0193043_1023485023300019012MarineMDGDEDLVCLNDDYEEIYFKLSQKDRPDVHKEITECIENGQNDGKDVYVTVLEGPKKLGDKLEILQLVTDAKSVNPE
Ga0193043_1032560813300019012MarineLPHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTEMIENGQDDGKDVYVTVLEGPKKLGDKIEILQIVMEAKAVEPQ
Ga0193557_1017640623300019013MarineYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIEEGQNDGKDVYVTVLEGPRKFGDKIDILQSVTEAKAVNPE
Ga0193557_1018990613300019013MarineYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIENGQNDGKDVYVTVLEGPRKVGDKIDILQSVTEAKAVNPE
Ga0192860_1032507713300019018MarineHSGRSSSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREETYTKVTETIETGQNDGKDVYVTVLEGPRKVGDKIEILQSVTEAKAVNPE
Ga0193561_1021107213300019023MarineGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNDDYEEIYFKLSQKDRPEVYKEITECIENGQSDGKDVYVTVLEGPKKLGSKLDILQLVTDAKSVNPE
Ga0193561_1027276423300019023MarineSGKRGRAKFMYKLRMPHSGRTSWAMQWKEDHLICPVMETIEYLVSHIDGDENLVCLNKDFEEIYFKLSKVERPKVYTEIAGLIESGQSDGKDVYVTVLEGPGKLGDKMDILQIVTGAKAVVPQ
Ga0193535_1028572013300019024MarineGHAKFTYKLRMPHSGRSSSLMHPGGDHLYRPVMEKVEYLVSHMDGDEDMVCLNDDYEEVFFKLSPEREDAYTKITECIEKGQDEGKDVYVTVLEGPKKVGDTIEVLQIVTEAKAVAPQ
Ga0193123_1045353113300019039MarineKFTYKLRMPHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTEMIENGQDDGKDVYVTVLEGPKKLGDKIEILQIVMEAKAVEPQ
Ga0192857_1010794013300019040MarineMGFSKTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSPDRADVYKEVTETIENGQNDGKDVFVTILEGPRKRGDNIEILQIVTDVKAVNPE
Ga0192857_1011012613300019040MarineAMHPGGDHLTRPVMEKVEYLVSHMDGDEDLVCLNEDFEEIFFKLSKEREETYTKITETIETGQNDGKDVYVTVLEGPRKVGDKIEILQSVTEAKAVNPE
Ga0192857_1019596223300019040MarineVCLNDDFEEVFFKLTKDRETVYNEVTTMIETGQEEGKDVYVTVLEGPKKVGDNIEILQIVMDAKAVVPQDN
Ga0192857_1025174013300019040MarineHGGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIENGQNDGKDVYVTVLEGPRKVGDKIDILQSVTEAKAVNPE
Ga0192857_1029468013300019040MarineTWAKFTYKLRMPHSGRASSAMQHGGDHLCRPVMEKIEYLVSHMDGDEDLVCLNEDFEEVFFKLDPGREDVYKSVTETIETGQDEGKDVYVNVLEGKKGR
Ga0192857_1032065713300019040MarineIEYLVSHMDGDEDLVCLNDDFEEIFFKLSPEREDVYKQVTECIENGQDSGKDVYVTVLEGPKKVGDLIEILQIVTDVKAVEPQN
Ga0193356_1018109123300019053MarineKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0192935_101952813300019091MarineRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTEMIENGQDDGKDVYVTVLEGPKKLGDKIEILQIVMEAKAVEPQ
Ga0193374_101515113300019105MarineSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEPQ
Ga0193374_101767313300019105MarineHLTRPVMEKTEYLVSHYDKNSEELSCLDEDFEEIFFKLSKSREEVHKKVTECIENGQNAGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0193144_106214833300019126MarineHGVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193249_109073313300019131MarineRPVMEKIEYLVSHMDGDEDLVCLNDDYEEIYFKLSQKDRPDVHKEITECIENGQNDGKDVYVTVLEGPKKLGDKLEILQIVTDAKSVNPE
Ga0192856_102569713300019143MarineSKTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIFFKLSKKREEVYTKVTETIENGQDDGKDVYVTVLEGPRKQGDKIEILQIITEAKAVEPQ
Ga0192856_104902813300019143MarinePHSGRASSAMHPGGDHLTRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIENGQNDGKDVYVTVLEGPRKVGDKIDILQSVTEAKAVNPE
Ga0192856_105024813300019143MarineVRPVMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEVYTAVTECIENGQNDGKDVYVTVLEGPKKQGDKIEILQIVTDAKAVNPE
Ga0193564_1019493513300019152MarineKLRMPHSGRASSAMHPGGDHLIRPVMEKIEYLVSHMDGDEDLVCLNEDFEEIYFKLSPSRADVYKEVTETIENGQNDGKDVFVTILEGPRKTGDKIEILQIVTDVKAVNPE
Ga0181504_115082213300019258PeatlandCDDKSGLPGVVSEVKMSKTGKHGHAKFTYKLRMPHSGRSANLMHPGGDHLLRPVMEKIDYLVSHMDGEEDLVCLDENFQEVFFKLSKEREDVYPKILETIETGQAESKDVIVTVLEGPMKKGDEVQIIQIVIEAKAVNPQA
Ga0222624_143814213300021951Groundwater SedimentVVSEVKMSKTGKHGHAKFTYKLRMPHSGRASSLMHPGGDHLLRPVMEKVEFLVSHMDGEEDLVCLDENFEEVYFKLSKEREEVYPKIVETIEKGQAEGKDVLVTVLEGPMKQGDETQVIQIVIEAKAVNPQ
Ga0210274_187227613300030531SoilPGVVSDLKCSTTGKHGHSKFTYKLRMPHSGRSASLMHPGGDHLLRPVMEKVEFLVSHLEGEEDLVCIDENFEEVYFKLCKEREDVYPKIIETIEKGQAENKDVIVTVLEGPMKTNDEILILQIIIEAKAVVPQ
Ga0210289_148921913300030543SoilVSEVHMSKTGKHGHAKFTYKLRMPHSGRASSLMHPGGDHLSRPVMEKVEFLVSHMEGEEDLVCLNENFEEVYFKLSKEREDVYPKIIETIDKGQAEGKDVVVTVLEGPTKQVTKFKFYKL
Ga0210271_1083410023300030545SoilMPHSGRAASAMHPGGDQLYQPVMIKLEYLVSHLDGDEDLVCLDENYEEIYFKISPEREDVYTKLKETIEEGQKDGKDVYATVLEGPMKEKDEILILQIVVDAKAILPQN
Ga0247635_103723713300030565SoilMPNYGRSSSQMHPGGDHLLKPIMEKIEYLVSHMDGEEDLVCLDDNYEEIYFKLSKSRDDVYGKVVETISKASDEGKDCYVTVLEGPMKSGEAVQILQIVTEAKLVNPQES
Ga0257206_112387123300030568Host-AssociatedPGIISEVKMSKTGKHGHAKFTYKLRMPHTGRTASLMHPGGDHLSRPVMEKIEFLVSHMDGEEDLVCLDENFQEVYFKLSKEREDFYPKIVETIETGQAEGKDVMVTVLEGPMKKGEEIQIVQIVVEAKAVNPQ
Ga0210258_1047568013300030572SoilASSLMHPGGDHLSRPVMEKVEFLVSHMEGEEDLVCLNENFEEVYFKLSKEREDVYPKILETIEKGQAEGKDVLVTVLEGPMKQTEEVQIIQIVIEAKAVNPQ
Ga0210272_106853523300030573SoilMSAKTGKHGHAKFTYKLRMPHSGRSANLMHPGGDHLLRPVMEKLDYLVSHMDGEEDLVCLDENFQEVFFKLSKEREDVYPKIIETIETGQAEGKDVIITVLEGPMKKGDDVQIIQIVIEAKAVNPQA
Ga0210262_122635513300030583SoilAKFTYKLRMPFSGRSASLMHPGGDHLLRPVIEKTDFLVSHMDGEEDLVCLDENYEEIYFKLSPDREDVYQRVMDTITKAQEEGKDCMVTVLEGPMKINEKVDIVQIVTEAKMVAPAKGGE
Ga0210263_113756313300030593SoilGKHGHAKFTYKLRMPFSGRSASLMHPGGDHLLRPVIEKTDFLVSHIDGEEDLVCLDENYEEIYFKLSPERDDVYQRVLETISKAQEEGKDCMVTVLEGPMKVNEKVDIIQIVTEAKTVAAAKGGE
Ga0210278_113942613300030596SoilPFSGRSASLMHPGGDHLLRPVIEKTDFLVSHMDGEEDLVCLDENYEEIYFKLSPDREDVYQRVLDTISKAQEEGKDCMVTVLEGPMKINEKVDIVQIVTEAKMVAPAKGGE
Ga0210286_125799813300030597SoilKTGKHGHAKFTYKLRMPHSGRASSLMHPGGDHLSRPVMEKVEFLVSHMEGEEDLVCLNENFEEVYFKLSKEREDVYPKILETIEKGQAEGKDVLVTVLEGPMKQTEEVQIIQIVIEAKAVNPQ
Ga0247637_107393113300030604SoilGKHGHAKFTYKIRMPHSGRSAALMHPGGDHLLRPVMDKIDYLVYHLDGEDDLVCLDENFEEIYFKLSPQREDIYERVKETIAKAQEENKDVMVTVLEGPMKLNEKIDIIQIVTEAKMVAANKGE
Ga0247634_1044462213300030609SoilTYKIRMPHSGRSASLMHPGGDHLLRPVMEKTDYLVSHIDGEEDLVCLDENFEEIYFKLSPDREDVYQRVVETISKAQEEGKDCMVTVLEGPMKVAEKVDIIQIVTEAKMVAAAKGGE
Ga0247613_1007141513300030610SoilAKFTYKLRMPHSGRSSSQMHPGGDHLLKPIMEKVEYLVSHMDGEEDLVCLDDNYEEIYFKLSKSRDDVYGKVVETISKASDEGKDCYVTVLEGPMKSGEAVQILQIVTEAKLVNPQES
Ga0210291_1191296813300030626SoilMPHSGRSANLMHPGGDHLLRPVMEKLDYLVSHMDGEEDLVCLDENFQEVFFKLSKEREDVYPKIIETIETGQAEGKDVIITVLEGPMKKGDDVQIIQIVIEAKAVNPQA
Ga0210279_1050424623300030631SoilGKHGHAKFTYKLRMPFSGRSASLMHPGGDHLLRPVIEKTDFLVSHMDGEEDLVCLDENYEEIYFKLSPDREDVYQRVLDTISKAQEEGKDCMVTVLEGPMKINEKVDIVQIVTEAKMVAPAKGGE
Ga0265462_1071699323300030738SoilSLMHPGGDHLLRPVMEKVEFLVSHLEGEEDLVCLDENFEEVYFKLSKEREDVYPKIVETIEKGQAEGKDVIVTVLEGPVKTGDEVQVLQIVIEAKAVNPQ
Ga0265459_1328513513300030741SoilSLMHPGGDHLLRPVIEKTDFLVSHIDGEEDLVCLDENYEEIYFKLSPERDDVYQRVLETISKAQEEGKDCMVTVLEGPMKVNEKVDIIQIVTEAKTVAAAKGGE
Ga0073953_1149766413300030752MarineKTGKHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGDEDLVCLDEDFEEIFFKLSKTREEVYTKVTEMIENGQNDGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0075404_1141099513300030842SoilSKTGKHGHAKFTYKLRMPHTGRTASLMHPGGDHLSRPVMEKIEFLVSHMDGEEDLVCLDENFQEVYFKLSKEREDFYPKIVETIETGQAEGKDVMVTVLEGPMKKGEEIQIVQIVVEAKAVNPQ
Ga0075385_1099300613300030854SoilAKFTYKLRMPHTGRTASLMHPGGDHLSRPVMEKIEFLVSHMDGEEDLVCLDENFQEVYFKLSKEREDFYPKIVETIETGQAEGKDVMVTVLEGPMKKGEEIQIVQIVVEAKAVNPQ
Ga0138346_1036287223300031056MarineHMDGDEDLVCLNEDFEEIYFKLSKEREEVYTKVTETIEEGQNDGKDVYVTVLEGPRKFGDKIDILQSVTEAKAVNPE
Ga0138347_1060219013300031113MarineKHGHAKFTYKLRMPHSGRASSAMHPGGDHLCKPVMEKIEYLVSHMDGDEDLVCLNDDFEEIFFKLSPDRGDVYKSVTECIENGQNDGKDVYVTVLEGPKKVGDNIEILQIVTEAKAVNPQ
Ga0138345_1090946513300031121MarineHGHAKFTYKLRMPHSGRASSAMHPGGDHLVRPVMEKIEYLVSHMDGEEDLVCLDEDFEEIFFKISKTREEVYTKVTECIENGQNDGKDVYVTVLEGPKKLGDKIEILQIVTEAKAVNPE
Ga0170823_1156992713300031128Forest SoilYKLRMPFSGRSASLMHPGGDHLLRPVIEKTDFLVSHMDGEEDLVCLDENYEEIYFKLSPDREDVYQRVMDTITKAQEEGKDCMVTVLEGPMKINEKVDIVQIVTEAKMVAPAKGGE
Ga0170824_10512071113300031231Forest SoilKMSKTGKHGHAKFTYKLRMPHSGRSAALMHPGGDHLLRPVMDKTDFLVSHLDGEEDLVCLDENFEEIYFKLSPDREDVYQRVMDTMAKAQEEGKDCLVTVLEGPMKINEKIDIIQIVTEAKMAAAAKGGE
Ga0170820_1616250013300031446Forest SoilAKFTYKIRMPFSGRSASLMHPGGDHLLRPIMDKADYLVSHLEEDDLVCMDENYEEIYFKLSADREDIYKRVVETLAKAQEEGKDCMVTVLEGPMKVGEKIDIIQIVTEAKMAAPNKGE
Ga0170818_10646211613300031474Forest SoilFTYKLRMPHSGRSAALMHPGGDHLLRPVIEKTDYLVSHLDGEEDLVCLDENYEEIFFKLSPDREDVYQRVVETLNKAQEEGKDCMVTVLEGPMKVNEKVDIIQIVTEAKMVAAAKGGE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.