Basic Information | |
---|---|
Family ID | F064160 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 51 residues |
Representative Sequence | VKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSGGPRRDR |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 53.12 % |
% of genes near scaffold ends (potentially truncated) | 14.73 % |
% of genes from short scaffolds (< 2000 bps) | 58.14 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.372 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.279 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.938 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.814 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF12840 | HTH_20 | 6.20 |
PF04116 | FA_hydroxylase | 3.88 |
PF13450 | NAD_binding_8 | 3.10 |
PF05187 | ETF_QO | 3.10 |
PF00440 | TetR_N | 1.55 |
PF00296 | Bac_luciferase | 1.55 |
PF02817 | E3_binding | 1.55 |
PF00561 | Abhydrolase_1 | 1.55 |
PF01435 | Peptidase_M48 | 0.78 |
PF13419 | HAD_2 | 0.78 |
PF02583 | Trns_repr_metal | 0.78 |
PF00890 | FAD_binding_2 | 0.78 |
PF13581 | HATPase_c_2 | 0.78 |
PF13420 | Acetyltransf_4 | 0.78 |
PF05974 | DUF892 | 0.78 |
PF01594 | AI-2E_transport | 0.78 |
PF13738 | Pyr_redox_3 | 0.78 |
PF13471 | Transglut_core3 | 0.78 |
PF01625 | PMSR | 0.78 |
PF01923 | Cob_adeno_trans | 0.78 |
PF00743 | FMO-like | 0.78 |
PF01370 | Epimerase | 0.78 |
PF13524 | Glyco_trans_1_2 | 0.78 |
PF00117 | GATase | 0.78 |
PF00145 | DNA_methylase | 0.78 |
PF01040 | UbiA | 0.78 |
PF03853 | YjeF_N | 0.78 |
PF00486 | Trans_reg_C | 0.78 |
PF02771 | Acyl-CoA_dh_N | 0.78 |
PF01196 | Ribosomal_L17 | 0.78 |
PF12680 | SnoaL_2 | 0.78 |
PF04343 | DUF488 | 0.78 |
PF14417 | MEDS | 0.78 |
PF02737 | 3HCDH_N | 0.78 |
PF03364 | Polyketide_cyc | 0.78 |
PF00293 | NUDIX | 0.78 |
PF00497 | SBP_bac_3 | 0.78 |
PF01642 | MM_CoA_mutase | 0.78 |
PF03538 | VRP1 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 3.88 |
COG2440 | Ferredoxin-like protein FixX | Energy production and conversion [C] | 3.10 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 3.10 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.55 |
COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 1.55 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.78 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.78 |
COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.78 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.78 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.78 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.78 |
COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.78 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.78 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.78 |
COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.78 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.78 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.78 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.78 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.78 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG0203 | Ribosomal protein L17 | Translation, ribosomal structure and biogenesis [J] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.37 % |
Unclassified | root | N/A | 11.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_104483200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300001405|JGI20186J14852_1001398 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
3300002568|C688J35102_118830074 | Not Available | 602 | Open in IMG/M |
3300002568|C688J35102_120677662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1338 | Open in IMG/M |
3300002568|C688J35102_120987136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7185 | Open in IMG/M |
3300002568|C688J35102_120988268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8430 | Open in IMG/M |
3300002906|JGI25614J43888_10116537 | Not Available | 696 | Open in IMG/M |
3300003320|rootH2_10207288 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300004643|Ga0062591_102036813 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300005329|Ga0070683_100009440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8344 | Open in IMG/M |
3300005330|Ga0070690_100386754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1024 | Open in IMG/M |
3300005332|Ga0066388_104164145 | Not Available | 737 | Open in IMG/M |
3300005335|Ga0070666_10056798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2644 | Open in IMG/M |
3300005337|Ga0070682_100000026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 191388 | Open in IMG/M |
3300005354|Ga0070675_100000070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 59599 | Open in IMG/M |
3300005365|Ga0070688_100000028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 67085 | Open in IMG/M |
3300005367|Ga0070667_100699400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
3300005434|Ga0070709_11036936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 654 | Open in IMG/M |
3300005436|Ga0070713_100000005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 201526 | Open in IMG/M |
3300005437|Ga0070710_11426123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
3300005535|Ga0070684_100008294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 8116 | Open in IMG/M |
3300005535|Ga0070684_100959710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
3300005544|Ga0070686_101482667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300005548|Ga0070665_100001275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 30231 | Open in IMG/M |
3300005548|Ga0070665_101513085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
3300005577|Ga0068857_100265991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1575 | Open in IMG/M |
3300005578|Ga0068854_100000268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 35449 | Open in IMG/M |
3300005578|Ga0068854_101684923 | Not Available | 579 | Open in IMG/M |
3300005587|Ga0066654_10686981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300005614|Ga0068856_100000136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 74026 | Open in IMG/M |
3300005719|Ga0068861_100053572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 3070 | Open in IMG/M |
3300005841|Ga0068863_100177894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2042 | Open in IMG/M |
3300006163|Ga0070715_10256738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
3300006237|Ga0097621_100161549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1926 | Open in IMG/M |
3300006804|Ga0079221_10118853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1332 | Open in IMG/M |
3300006881|Ga0068865_100000040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 72979 | Open in IMG/M |
3300006881|Ga0068865_100343101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
3300009098|Ga0105245_10000117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 76863 | Open in IMG/M |
3300009098|Ga0105245_10150534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2200 | Open in IMG/M |
3300009174|Ga0105241_10080653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2547 | Open in IMG/M |
3300009177|Ga0105248_10000037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 180751 | Open in IMG/M |
3300009551|Ga0105238_12365053 | Not Available | 567 | Open in IMG/M |
3300009840|Ga0126313_10051481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2905 | Open in IMG/M |
3300009840|Ga0126313_10301044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1254 | Open in IMG/M |
3300009840|Ga0126313_10557744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
3300010335|Ga0134063_10525953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
3300010371|Ga0134125_10172639 | All Organisms → cellular organisms → Bacteria | 2409 | Open in IMG/M |
3300010375|Ga0105239_10448224 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300010375|Ga0105239_10549379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1315 | Open in IMG/M |
3300012496|Ga0157353_1032967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300012892|Ga0157294_10102275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
3300012929|Ga0137404_12167909 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300012955|Ga0164298_10796010 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300012961|Ga0164302_10693253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 753 | Open in IMG/M |
3300012961|Ga0164302_11707042 | Not Available | 528 | Open in IMG/M |
3300012977|Ga0134087_10127102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1090 | Open in IMG/M |
3300012988|Ga0164306_10066307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2246 | Open in IMG/M |
3300013100|Ga0157373_10184721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1469 | Open in IMG/M |
3300013102|Ga0157371_10004648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11895 | Open in IMG/M |
3300013105|Ga0157369_10000051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 165672 | Open in IMG/M |
3300013296|Ga0157374_10437460 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300013296|Ga0157374_10455796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1280 | Open in IMG/M |
3300013306|Ga0163162_10311292 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
3300013307|Ga0157372_10000146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 77952 | Open in IMG/M |
3300013308|Ga0157375_12770275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 586 | Open in IMG/M |
3300014326|Ga0157380_10463486 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300014487|Ga0182000_10097425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
3300014968|Ga0157379_11778515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
3300014969|Ga0157376_12590878 | Not Available | 547 | Open in IMG/M |
3300015197|Ga0167638_1079480 | Not Available | 660 | Open in IMG/M |
3300015200|Ga0173480_10073156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1600 | Open in IMG/M |
3300015264|Ga0137403_10985766 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300015374|Ga0132255_105133318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
3300018433|Ga0066667_10519951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 983 | Open in IMG/M |
3300018920|Ga0190273_10222040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1201 | Open in IMG/M |
3300019356|Ga0173481_10247250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 801 | Open in IMG/M |
3300019889|Ga0193743_1035870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2311 | Open in IMG/M |
3300020061|Ga0193716_1066717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1630 | Open in IMG/M |
3300020070|Ga0206356_10121768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3049 | Open in IMG/M |
3300020081|Ga0206354_11297909 | Not Available | 686 | Open in IMG/M |
3300020082|Ga0206353_10368780 | Not Available | 1010 | Open in IMG/M |
3300020181|Ga0196958_10058522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
3300021339|Ga0193706_1000347 | All Organisms → cellular organisms → Bacteria | 28432 | Open in IMG/M |
3300021339|Ga0193706_1089114 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300021363|Ga0193699_10085430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1261 | Open in IMG/M |
3300022883|Ga0247786_1000480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6831 | Open in IMG/M |
3300024055|Ga0247794_10004379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2991 | Open in IMG/M |
3300024426|Ga0196960_10000054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 42593 | Open in IMG/M |
3300025321|Ga0207656_10000285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17446 | Open in IMG/M |
3300025504|Ga0208356_1000005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 131014 | Open in IMG/M |
3300025903|Ga0207680_10002080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9381 | Open in IMG/M |
3300025905|Ga0207685_10217052 | Not Available | 907 | Open in IMG/M |
3300025913|Ga0207695_10587833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 994 | Open in IMG/M |
3300025924|Ga0207694_11577223 | Not Available | 553 | Open in IMG/M |
3300025926|Ga0207659_10000018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 156920 | Open in IMG/M |
3300025927|Ga0207687_10000070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 77432 | Open in IMG/M |
3300025927|Ga0207687_10087299 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
3300025928|Ga0207700_10000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 500797 | Open in IMG/M |
3300025938|Ga0207704_10000079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 58183 | Open in IMG/M |
3300025938|Ga0207704_11000692 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300025941|Ga0207711_10000011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 518817 | Open in IMG/M |
3300025944|Ga0207661_10000239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 36056 | Open in IMG/M |
3300025986|Ga0207658_10453790 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300026067|Ga0207678_11149229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
3300026078|Ga0207702_10000202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 70333 | Open in IMG/M |
3300026116|Ga0207674_11099927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
3300026118|Ga0207675_100076031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 3143 | Open in IMG/M |
3300026142|Ga0207698_10002679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10595 | Open in IMG/M |
3300026308|Ga0209265_1167685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300026319|Ga0209647_1025976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3518 | Open in IMG/M |
3300027164|Ga0208994_1046588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300027895|Ga0209624_10007072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7379 | Open in IMG/M |
3300028379|Ga0268266_10001389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 29082 | Open in IMG/M |
3300028379|Ga0268266_10795391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
3300028712|Ga0307285_10000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 246966 | Open in IMG/M |
3300028721|Ga0307315_10143089 | Not Available | 723 | Open in IMG/M |
3300028754|Ga0307297_10044884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1346 | Open in IMG/M |
3300028768|Ga0307280_10000021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 51932 | Open in IMG/M |
3300028778|Ga0307288_10000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 219644 | Open in IMG/M |
3300028790|Ga0307283_10079882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
3300028876|Ga0307286_10261460 | Not Available | 635 | Open in IMG/M |
3300030510|Ga0268243_1026695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1170 | Open in IMG/M |
3300032080|Ga0326721_10000051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 96017 | Open in IMG/M |
3300032205|Ga0307472_100017886 | All Organisms → cellular organisms → Bacteria | 3795 | Open in IMG/M |
3300034000|Ga0334918_004875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1807 | Open in IMG/M |
3300034172|Ga0334913_060134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
3300034173|Ga0334925_116913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300034687|Ga0334905_000676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4998 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.28% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.10% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.88% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.33% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.33% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.33% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 2.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.55% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.55% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.55% |
Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 1.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.55% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.78% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.78% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001405 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300024426 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034000 | Biocrust microbial communities from Mojave Desert, California, United States - 14HMC | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
3300034173 | Biocrust microbial communities from Mojave Desert, California, United States - 21HNC | Environmental | Open in IMG/M |
3300034687 | Soil microbial communities from Mojave Desert, California, United States - 1NOC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1044832001 | 3300000364 | Soil | YGRVKLLLVPFAILAFILFLIVVGAIGLGVAFAVIYVFGRIWRLLNRGGPRLRS* |
JGI20186J14852_10013983 | 3300001405 | Arctic Peat Soil | VKFLLVPFAIVAFVLFLLLLGAIGLVVSMAVLSVSGRIWRLVMRR* |
C688J35102_1188300742 | 3300002568 | Soil | VKLLLIPFAILAFVLFLLVLGAIGFAVAFAVLAVLGRAWRLVSSGRPSRR* |
C688J35102_1206776622 | 3300002568 | Soil | VKLLFVPIAIVAFMIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARTR* |
C688J35102_1209871367 | 3300002568 | Soil | VKLLLIPVVIVAFVIFLLVLGAIGFAVAFGVLALLGRAWRLVAGGRHSR* |
C688J35102_1209882685 | 3300002568 | Soil | VKLILVPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLISGARPRPR* |
JGI25614J43888_101165372 | 3300002906 | Grasslands Soil | VKFLLIPLGILAFVLFLLLLGAIGLAAAMSVLWVVGRVWRFVTGVGRARSA* |
rootH2_102072883 | 3300003320 | Sugarcane Root And Bulk Soil | GRRRAPRSLVPSLLPSPLQDYAAVHILLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARTR* |
Ga0062591_1020368132 | 3300004643 | Soil | MVKVLLVPLAILAFVVFLLVLGAVGMAVSLAVLWVLGRVWRFVTRADRRDRRRQQT* |
Ga0070683_1000094408 | 3300005329 | Corn Rhizosphere | LPLQDYGGVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYVCGAAWRLVAGGRRHNR* |
Ga0070690_1003867542 | 3300005330 | Switchgrass Rhizosphere | LQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRDR* |
Ga0066388_1041641451 | 3300005332 | Tropical Forest Soil | VKLLLVPLAIVAFVVFLLVLGAIGFAVAFAVLAVLGRVWRLVTGGRRSP* |
Ga0070666_100567982 | 3300005335 | Switchgrass Rhizosphere | VKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRDR* |
Ga0070682_100000026105 | 3300005337 | Corn Rhizosphere | VKLLLVPFAIVAFILFLLLLGAIGFAVAFAVLAVLGRAWRLVFRRAH* |
Ga0070675_10000007055 | 3300005354 | Miscanthus Rhizosphere | VKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSRDPRRNR* |
Ga0070688_10000002822 | 3300005365 | Switchgrass Rhizosphere | LKLLFVPIVVIAFVVFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGT* |
Ga0070667_1006994002 | 3300005367 | Switchgrass Rhizosphere | VVKVLLVPLAILAFVVFLLVLGAIGMAVSLAVLWVFGRIWRFVSRVDRRDRRRQQT* |
Ga0070709_110369362 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VCVKFLLIPLAIVAFILFLLLLGAIGLVVAMGVLAFFGRIWRFVSGGSRGRTRSA* |
Ga0070713_10000000544 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLLIPLAIVAFVIFLLILGAIGLAVAFAVLYVLGKFWRLISRAGRPRRRRASA* |
Ga0070710_114261232 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LIPLAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRSRTR* |
Ga0070684_1000082942 | 3300005535 | Corn Rhizosphere | VKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYVCGAAWRLVAGGRRHNR* |
Ga0070684_1009597102 | 3300005535 | Corn Rhizosphere | MAILAFVLFLLLLGAIGLAVSFAVLYVLGQAWRLVAGGRPRRR* |
Ga0070686_1014826672 | 3300005544 | Switchgrass Rhizosphere | VKLLLVPLAIVAFVLFLLLLGAIGLAISFAVIYVVGGAWRLVSGGRRRDR* |
Ga0070665_1000012758 | 3300005548 | Switchgrass Rhizosphere | LQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRAS* |
Ga0070665_1015130852 | 3300005548 | Switchgrass Rhizosphere | VKLLLVPLAVVAFVLFLLLLGAIGLAISFAVIYVVGGAWRLVTGGRRRNR* |
Ga0068857_1002659912 | 3300005577 | Corn Rhizosphere | LQDYAGVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYAFGRAWRLVSRDPRPRR* |
Ga0068854_10000026832 | 3300005578 | Corn Rhizosphere | VKLLLIPFAIVAFILFLLLLGAIGFAVAFAVLAVFGRAWRLVFRRSH* |
Ga0068854_1016849232 | 3300005578 | Corn Rhizosphere | LQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAIAFAVIYVVGGAWRFVSGGRRRGR* |
Ga0066654_106869812 | 3300005587 | Soil | DVKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGHARTHGTR* |
Ga0068856_10000013633 | 3300005614 | Corn Rhizosphere | VKLLLIPFVVIAFVVFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARSGRSA* |
Ga0068861_1000535723 | 3300005719 | Switchgrass Rhizosphere | VKVLFVPLAILAFVLFLLLLGAIGMAISMAVISAVGKLWRVASRADRRDRRRQQA* |
Ga0068863_1001778942 | 3300005841 | Switchgrass Rhizosphere | VKLLFVPLAIVAFVLFLLVLGAIGLVVSMGVLAFFGKIWRVVMRR* |
Ga0070715_102567382 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLLVPFAIVAFVLFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTS* |
Ga0097621_1001615492 | 3300006237 | Miscanthus Rhizosphere | VKVLFVPLAILAFVLFLLVLGAIGMAISMAVISAFGKIWRVASRADRRDRRRQQA* |
Ga0079221_101188532 | 3300006804 | Agricultural Soil | VKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARTR* |
Ga0068865_10000004049 | 3300006881 | Miscanthus Rhizosphere | VKLLLIPFAILAFVIFLLVLGAIGFAVAFAVLAVLGRAWRLVSGGRPGRRRKAA* |
Ga0068865_1003431012 | 3300006881 | Miscanthus Rhizosphere | VKLLFVPCAIVAFVLFLLLLGAIGLVVSMAVLAFFGKLWRLVMRR* |
Ga0105245_1000011757 | 3300009098 | Miscanthus Rhizosphere | LKLLFVPILVIAFVVFLLVLGAIGFAVSFAVLAVLGRAWRLLSGGRSRGA* |
Ga0105245_101505342 | 3300009098 | Miscanthus Rhizosphere | VKLLLIPFAIVAFVLFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTG* |
Ga0105241_100806533 | 3300009174 | Corn Rhizosphere | VKLLLVPFAIVAFIFFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGH* |
Ga0105248_10000037111 | 3300009177 | Switchgrass Rhizosphere | VKILFVPIVIVAFVLFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGA* |
Ga0105238_123650531 | 3300009551 | Corn Rhizosphere | LQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAIAFAVIYVVGGAWRFVSGGRRRAG* |
Ga0126313_100514814 | 3300009840 | Serpentine Soil | MEDYGGVKLLFVPIVAVAFLIFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRPRRR* |
Ga0126313_103010442 | 3300009840 | Serpentine Soil | VKLLLVPLAIVAFVLFLLLLGAIGLAISFAVIYVVGGAWRLVAGGRRRNR* |
Ga0126313_105577442 | 3300009840 | Serpentine Soil | VKVLFVPLAILAFIVFLLVLGTIGMAVSLAVLSVLGRLWRFVTGAKRRDRRRRQT* |
Ga0134063_105259531 | 3300010335 | Grasslands Soil | SPESPVPSPLPLPLQDYAAVKLLLVPFAILAFVIFLLVLGAIGFAVAFAVLAVLGRAWRLVSGGRARTR* |
Ga0134125_101726393 | 3300010371 | Terrestrial Soil | VKLLFVPFAIVAFVLFLLLLGAIGLVVSMGVLAFFGKIWRVVMRRY* |
Ga0105239_104482242 | 3300010375 | Corn Rhizosphere | VKFVLIPLGIVAFVLFLLMLGAIGLVAAMGVLSVFGRLWRVVMRR* |
Ga0105239_105493792 | 3300010375 | Corn Rhizosphere | VKLLLVPFAIVAFVLFLLLLGAIGFAVAFAVLAVLGRAWRLVFRGGGAR* |
Ga0157353_10329672 | 3300012496 | Unplanted Soil | VKLLLVPLAIFAFVLFLLVLGAIRLAVAFAVLAALGRAWRLAFRGRAPR* |
Ga0157294_101022751 | 3300012892 | Soil | ITCRSAAVGPITLQDYGGVKLLLVPLAIIAFVLFLLILGAIGLAISFAVLYVFSGAWRLVSGGRARGR* |
Ga0137404_121679092 | 3300012929 | Vadose Zone Soil | VENRGVTLLLIPAAIVAFVLFLLLLGAIGLIVAMGVLWFFGRIWRLVMRR* |
Ga0164298_107960101 | 3300012955 | Soil | VKLLLVPFAILAFIIFLIVVGAIGLGVAFAVIYVFGRIWRLLNRGGPRLRS* |
Ga0164302_106932532 | 3300012961 | Soil | PIAIVAFVVFLLVLGAIGLAVAFAVLAVLGRLWRLVFRRGAAA* |
Ga0164302_117070422 | 3300012961 | Soil | LPLQDYADVKLLLIPFAILAFVIFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSAGA* |
Ga0134087_101271022 | 3300012977 | Grasslands Soil | VKLLLIPFAILAFVLFLLLLGAIGFAVAFAVLAVLGRAWRLVSGGRPSRR* |
Ga0164306_100663072 | 3300012988 | Soil | VKLLFVPLAIVAFVLFLLLLGAIGLVISMGVLAFFGKVWRVIMRR* |
Ga0157373_101847212 | 3300013100 | Corn Rhizosphere | VKLLLIPFAILAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLISGGRPGRRRKTA* |
Ga0157371_1000464813 | 3300013102 | Corn Rhizosphere | VHILLVPFAVVAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVAGGRARPR* |
Ga0157369_10000051120 | 3300013105 | Corn Rhizosphere | LEDYGALKFLFVPIVVIAFVVFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGS* |
Ga0157374_104374601 | 3300013296 | Miscanthus Rhizosphere | VKLLFVPLAVVAFVLFLLVLGAIGLVVSVGVLAFFGKIWRVVMRR* |
Ga0157374_104557962 | 3300013296 | Miscanthus Rhizosphere | VKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRSGRRRKAA* |
Ga0163162_103112922 | 3300013306 | Switchgrass Rhizosphere | VVKVLLVPLAILAFVVFLLVLGAIGMAVSLAVLWVFGRVWRLISRADRRGRRRQQT* |
Ga0157372_1000014664 | 3300013307 | Corn Rhizosphere | VKLLLIPFAIVAFILFLLLLGAIGFAVAFAVLAVFGRAWRLVFRRGH* |
Ga0157375_127702752 | 3300013308 | Miscanthus Rhizosphere | MKILFVPFAILAFLLFLLLLGAIGLAVATAVLAMLGRVWRFVMRR* |
Ga0157380_104634863 | 3300014326 | Switchgrass Rhizosphere | LPLQDYAGVKLLLVPLAILAFVFFLLVLGAIGLAISFAVIYVVGGAWRLVSGGRRRAG* |
Ga0182000_100974252 | 3300014487 | Soil | VKLLFVPIVVAAFLVFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGA* |
Ga0157379_117785151 | 3300014968 | Switchgrass Rhizosphere | IIAFVVFLLILGAIGLAISFGILYVLGGAWRLVTGGRSRNR* |
Ga0157376_125908782 | 3300014969 | Miscanthus Rhizosphere | LQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRNR* |
Ga0167638_10794802 | 3300015197 | Glacier Forefield Soil | VKFLLVPFAIVAFVLFLLLLGAIGLLASMAVLSVFGRIWRLVMRR* |
Ga0173480_100731562 | 3300015200 | Soil | VKLLLVPLAIIAFVLFLLILGAIGLAISFAVLYVFSGAWRLVSGGRARGR* |
Ga0137403_109857662 | 3300015264 | Vadose Zone Soil | VTLLLIPAAIVAFVLFLLLLGAIGLIVAMGVLWFFGRIWRLVMRR* |
Ga0132255_1051333182 | 3300015374 | Arabidopsis Rhizosphere | VKFLLVPFAIAAFVAFLLLLGAIGLVIAMTVLSAFGRLWRFLNRSGRRQRS* |
Ga0066667_105199512 | 3300018433 | Grasslands Soil | VLPWVPSPLQDYAGVKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARAR |
Ga0190273_102220403 | 3300018920 | Soil | VKFLLIPLAIIAFVLFLLILGAIGLAIAFGVIYVVGGAWRLVSGGRPARR |
Ga0173481_102472502 | 3300019356 | Soil | AIIAFILFLLILGAIGLAISFAVLYVFGGAWRLISGGRARGR |
Ga0193743_10358703 | 3300019889 | Soil | VAKLLLIPFAVVAFVLFLLLLGAIGLTIALGVLWVFGRAWGLVSRGGRRRRS |
Ga0193716_10667172 | 3300020061 | Soil | VKVLLIPFAIVLFVLFLLLLGAIGLAVSMTVLSAFGRLWRLLNRSAQPRRS |
Ga0206356_101217684 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIAAFVVFLLVLGAIGLAISFAILYLLSGAWRLVSGLGRLGRTRSR |
Ga0206354_112979091 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | FAIVAFILFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTS |
Ga0206353_103687802 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLLVPFAIVAFILFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTS |
Ga0196958_100585222 | 3300020181 | Soil | VKFLLIPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLLTGGRAGRR |
Ga0193706_10003479 | 3300021339 | Soil | VKFLLVPFAIVAFVAFLLLLGAIGLVIAMGVLAVFGRIWRLVMRR |
Ga0193706_10891141 | 3300021339 | Soil | AGGQSRRVKFLLVPFAILAFVLFLLLLGAIGLVIAMTVLSAFGRIWRLVMRR |
Ga0193699_100854302 | 3300021363 | Soil | VKFLLVPFAIVALVLLLLLLGAIGLVVSMAVLTVFGKIWRLVMRR |
Ga0247786_10004809 | 3300022883 | Soil | LQDYAGVKLLLVPFAILAFVLFLLLLGAIGLAIAFAVLYVFGRAWRLVGGGPRRDR |
Ga0247794_100043793 | 3300024055 | Soil | VKLLLIPFAVIAFVIFLLVLGAIGFAVAFSVLAVLGRGWRLVSGGRARTR |
Ga0196960_1000005424 | 3300024426 | Soil | VKFLLIPLAIIAFVIFLLILGAIGLAISFAVLYVFGRAWRLVTGGGPGRR |
Ga0196960_101385332 | 3300024426 | Soil | FVLFLLVLGAIGLAISFGVIYVFGRIWRLITGGRPGRRGRGSAMS |
Ga0207656_1000028520 | 3300025321 | Corn Rhizosphere | VKLLLIPFAIVAFILFLLLLGAIGFAVAFAVLAVFGRAWRLVFRRSH |
Ga0208356_100000544 | 3300025504 | Arctic Peat Soil | VKFLLVPFAIVAFVLFLLLLGAIGLVVSMAVLSVSGRIWRLVMRR |
Ga0207680_100020804 | 3300025903 | Switchgrass Rhizosphere | VKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRDR |
Ga0207685_102170522 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLLVPFAIVAFVLFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTS |
Ga0207695_105878332 | 3300025913 | Corn Rhizosphere | VKLLFVPLAIVAFVLFLLVLGAIGLVVSMGVLAFFGKIWRVVMRR |
Ga0207694_115772232 | 3300025924 | Corn Rhizosphere | LVPLAIVAFVLFLLVLGTIGLAIAFAVIYVVGGAWRFVSGGRRRAG |
Ga0207659_100000189 | 3300025926 | Miscanthus Rhizosphere | LQDYAGVKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSRDPRRNR |
Ga0207687_1000007038 | 3300025927 | Miscanthus Rhizosphere | LKLLFVPILVIAFVVFLLVLGAIGFAVSFAVLAVLGRAWRLLSGGRSRGA |
Ga0207687_100872992 | 3300025927 | Miscanthus Rhizosphere | VKLLLIPFAIVAFVLFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTG |
Ga0207700_10000003234 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLLIPLAIVAFVIFLLILGAIGLAVAFAVLYVLGKFWRLISRAGRPRRRRASA |
Ga0207704_1000007917 | 3300025938 | Miscanthus Rhizosphere | VKLLLIPFAILAFVIFLLVLGAIGFAVAFAVLAVLGRAWRLVSGGRPGRRRKAA |
Ga0207704_110006922 | 3300025938 | Miscanthus Rhizosphere | IVAFVLFLLLLGAIGLVVSMAVLAFFGKLWRLVMRR |
Ga0207711_10000011432 | 3300025941 | Switchgrass Rhizosphere | VKILFVPIVIVAFVLFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGA |
Ga0207661_100002394 | 3300025944 | Corn Rhizosphere | VKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYVCGAAWRLVAGGRRHNR |
Ga0207658_104537902 | 3300025986 | Switchgrass Rhizosphere | VVKVLLVPLAILAFVVFLLVLGAIGMAVSLAVLWVFGRIWRFVSRVDRRDRRRQQT |
Ga0207678_111492292 | 3300026067 | Corn Rhizosphere | LQDYAGVKLLLVPLAILAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVTGGRHRGR |
Ga0207702_1000020247 | 3300026078 | Corn Rhizosphere | VKLLLIPFVVIAFVVFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARSGRSA |
Ga0207674_110999272 | 3300026116 | Corn Rhizosphere | LQDYAGVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYAFGRAWRLVSRDPRPRR |
Ga0207675_1000760313 | 3300026118 | Switchgrass Rhizosphere | VKVLFVPLAILAFVLFLLLLGAIGMAISMAVISAVGKLWRVASRADRRDRRRQQA |
Ga0207698_100026797 | 3300026142 | Corn Rhizosphere | LQDYAALKLLLVPVAIVAFVLFLLVLGAIGLAISFAVIYVVGGAWRLVSGGRRRR |
Ga0209265_11676851 | 3300026308 | Soil | DVKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGHARTHGTR |
Ga0209647_10259765 | 3300026319 | Grasslands Soil | VKFLLIPLGILAFVLFLLLLGAIGLAAAMSVLWVVGRVWRFVTGVGRARSA |
Ga0208994_10465882 | 3300027164 | Forest Soil | VKFLLIPLGIIAFILFLLLLGAIGLAIAMGVLSALGRIWRLLSRRGYPQRS |
Ga0209624_100070728 | 3300027895 | Forest Soil | VKLLLVPFAIVAFVLFLLMLGAIGLLIAMGVLAVCGRVWRLVMRR |
Ga0268266_1000138911 | 3300028379 | Switchgrass Rhizosphere | LQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRAS |
Ga0268266_107953912 | 3300028379 | Switchgrass Rhizosphere | VKLLLVPLAVVAFVLFLLLLGAIGLAISFAVIYVVGGAWRLVTGGRRRNR |
Ga0307285_1000000473 | 3300028712 | Soil | LQDYAGVKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSGGPRRDR |
Ga0307315_101430892 | 3300028721 | Soil | MEDYGGVKLLLVPFAVLAFVVFLLVLGAIGFAVAFAVLAVLGRAWRLVSGGRSRGA |
Ga0307297_100448841 | 3300028754 | Soil | VKFLFVPIVVVAFLIFLLVLGAIGFAVSFAVLAVLGRAWRLISG |
Ga0307280_1000002121 | 3300028768 | Soil | LQDYAAVKLLLVPLAIIAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRNR |
Ga0307288_10000004213 | 3300028778 | Soil | LQDYAGVKLLLVPLAILAFVLFLLLLGSIGLAISFAVLYVFGWAWRLVSGGRRRGR |
Ga0307283_100798822 | 3300028790 | Soil | AIIAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRNR |
Ga0307286_102614602 | 3300028876 | Soil | VKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSGGPRRDR |
Ga0268243_10266952 | 3300030510 | Soil | VKLLFVPIVVAAFLVFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGA |
Ga0326721_1000005195 | 3300032080 | Soil | VKFLLIPLAILAFVLFLLILGAIGLAIAFGVIYVVGGAWRLVSGGRPGRRKASG |
Ga0307472_1000178865 | 3300032205 | Hardwood Forest Soil | QVPPSLPSSLQDYAGVHILLVPFAVIAFVIFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRTP |
Ga0334918_004875_1669_1806 | 3300034000 | Hypolithic Biocrust | LIPLAILAFVCFLLLLGAIGLAISFAVIYLVVGAWRLVSGGHRRG |
Ga0334913_060134_596_763 | 3300034172 | Sub-Biocrust Soil | LQDYAGVKLLLIPLAILAFVCFLLLLGAIGLAISFAVIYLVGGAWRLVSGGHRRG |
Ga0334925_116913_352_522 | 3300034173 | Hypolithic Biocrust | LQDYGAVKLLLVPIAILAFAVFLLVLGAIGFAVSFAVLAVLGRAWRVVSAGRPRRR |
Ga0334905_000676_1350_1502 | 3300034687 | Soil | VKVLFVPIVAIAFVVFLLVLGAIGFAVSFAVLAALGRLWRLVSGGSSRSG |
⦗Top⦘ |