Basic Information | |
---|---|
Family ID | F063977 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 44 residues |
Representative Sequence | VTVETRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVST |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 44.35 % |
% of genes near scaffold ends (potentially truncated) | 94.57 % |
% of genes from short scaffolds (< 2000 bps) | 66.67 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.295 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.954 % of family members) |
Environment Ontology (ENVO) | Unclassified (17.829 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.287 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF13517 | FG-GAP_3 | 3.10 |
PF00578 | AhpC-TSA | 2.33 |
PF07589 | PEP-CTERM | 2.33 |
PF08238 | Sel1 | 1.55 |
PF13432 | TPR_16 | 1.55 |
PF00486 | Trans_reg_C | 1.55 |
PF12704 | MacB_PCD | 1.55 |
PF12867 | DinB_2 | 1.55 |
PF13649 | Methyltransf_25 | 0.78 |
PF00005 | ABC_tran | 0.78 |
PF13683 | rve_3 | 0.78 |
PF14329 | DUF4386 | 0.78 |
PF00210 | Ferritin | 0.78 |
PF05985 | EutC | 0.78 |
PF14534 | DUF4440 | 0.78 |
PF07676 | PD40 | 0.78 |
PF14312 | FG-GAP_2 | 0.78 |
PF00654 | Voltage_CLC | 0.78 |
PF09699 | Paired_CXXCH_1 | 0.78 |
PF13473 | Cupredoxin_1 | 0.78 |
PF00069 | Pkinase | 0.78 |
PF12850 | Metallophos_2 | 0.78 |
PF02895 | H-kinase_dim | 0.78 |
PF01977 | UbiD | 0.78 |
PF13601 | HTH_34 | 0.78 |
PF10431 | ClpB_D2-small | 0.78 |
PF00083 | Sugar_tr | 0.78 |
PF11984 | DUF3485 | 0.78 |
PF01370 | Epimerase | 0.78 |
PF01039 | Carboxyl_trans | 0.78 |
PF09685 | DUF4870 | 0.78 |
PF00924 | MS_channel | 0.78 |
PF06742 | DUF1214 | 0.78 |
PF09579 | Spore_YtfJ | 0.78 |
PF00072 | Response_reg | 0.78 |
PF11854 | MtrB_PioB | 0.78 |
PF00501 | AMP-binding | 0.78 |
PF05117 | DUF695 | 0.78 |
PF00149 | Metallophos | 0.78 |
PF05378 | Hydant_A_N | 0.78 |
PF08281 | Sigma70_r4_2 | 0.78 |
PF12695 | Abhydrolase_5 | 0.78 |
PF11412 | DsbC | 0.78 |
PF01739 | CheR | 0.78 |
PF14559 | TPR_19 | 0.78 |
PF13646 | HEAT_2 | 0.78 |
PF16576 | HlyD_D23 | 0.78 |
PF13476 | AAA_23 | 0.78 |
PF00892 | EamA | 0.78 |
PF01966 | HD | 0.78 |
PF12327 | FtsZ_C | 0.78 |
PF03544 | TonB_C | 0.78 |
PF15780 | ASH | 0.78 |
PF01435 | Peptidase_M48 | 0.78 |
PF13174 | TPR_6 | 0.78 |
PF02371 | Transposase_20 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.10 |
COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.55 |
COG0643 | Chemotaxis protein histidine kinase CheA | Signal transduction mechanisms [T] | 1.55 |
COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 1.55 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.78 |
COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.78 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.78 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.78 |
COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.78 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.78 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.78 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.78 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.29 % |
Unclassified | root | N/A | 21.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10069087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2619 | Open in IMG/M |
3300005187|Ga0066675_11344229 | Not Available | 525 | Open in IMG/M |
3300005435|Ga0070714_100455064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1216 | Open in IMG/M |
3300005435|Ga0070714_100647074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
3300005435|Ga0070714_101600019 | Not Available | 636 | Open in IMG/M |
3300005436|Ga0070713_100630918 | Not Available | 1019 | Open in IMG/M |
3300005439|Ga0070711_100167761 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
3300005526|Ga0073909_10000092 | All Organisms → cellular organisms → Bacteria | 33390 | Open in IMG/M |
3300005529|Ga0070741_10229177 | Not Available | 1785 | Open in IMG/M |
3300005538|Ga0070731_10786406 | Not Available | 632 | Open in IMG/M |
3300005542|Ga0070732_10828665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300005542|Ga0070732_10981263 | Not Available | 516 | Open in IMG/M |
3300005575|Ga0066702_10032570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2680 | Open in IMG/M |
3300005614|Ga0068856_100469898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1278 | Open in IMG/M |
3300005843|Ga0068860_100794246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
3300005921|Ga0070766_10357255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis | 949 | Open in IMG/M |
3300006028|Ga0070717_10199655 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
3300006028|Ga0070717_10498505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
3300006028|Ga0070717_11800375 | Not Available | 553 | Open in IMG/M |
3300006052|Ga0075029_100652808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300006102|Ga0075015_100489857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300006162|Ga0075030_100373180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
3300006162|Ga0075030_100461002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
3300006173|Ga0070716_101603347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 534 | Open in IMG/M |
3300006175|Ga0070712_100986787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 728 | Open in IMG/M |
3300006176|Ga0070765_100006465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7864 | Open in IMG/M |
3300006176|Ga0070765_100014157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5730 | Open in IMG/M |
3300006893|Ga0073928_10001050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 55828 | Open in IMG/M |
3300009093|Ga0105240_10118931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3184 | Open in IMG/M |
3300010048|Ga0126373_11861739 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300010339|Ga0074046_10000003 | All Organisms → cellular organisms → Bacteria | 242991 | Open in IMG/M |
3300010339|Ga0074046_10000073 | All Organisms → cellular organisms → Bacteria | 79881 | Open in IMG/M |
3300010339|Ga0074046_10000156 | All Organisms → cellular organisms → Bacteria | 56809 | Open in IMG/M |
3300010339|Ga0074046_10000412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 39442 | Open in IMG/M |
3300010343|Ga0074044_10000033 | All Organisms → cellular organisms → Bacteria | 131630 | Open in IMG/M |
3300010343|Ga0074044_10548852 | Not Available | 754 | Open in IMG/M |
3300010373|Ga0134128_10623055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
3300010379|Ga0136449_101322059 | Not Available | 1121 | Open in IMG/M |
3300010379|Ga0136449_101448787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1056 | Open in IMG/M |
3300010379|Ga0136449_101879342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
3300011120|Ga0150983_11795090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2070 | Open in IMG/M |
3300012984|Ga0164309_11950752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 503 | Open in IMG/M |
3300013296|Ga0157374_12038428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300013296|Ga0157374_12325209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300013307|Ga0157372_10040568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5142 | Open in IMG/M |
3300013307|Ga0157372_10086373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3559 | Open in IMG/M |
3300013307|Ga0157372_10240566 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
3300013307|Ga0157372_10764921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1123 | Open in IMG/M |
3300013307|Ga0157372_11010147 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300014658|Ga0181519_11035754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300015371|Ga0132258_10106164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6635 | Open in IMG/M |
3300015371|Ga0132258_10677797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2594 | Open in IMG/M |
3300015371|Ga0132258_11062920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Pleomorphomonas → unclassified Pleomorphomonas → Pleomorphomonas sp. COJ-58 | 2046 | Open in IMG/M |
3300015371|Ga0132258_11491700 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
3300015372|Ga0132256_100016212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6534 | Open in IMG/M |
3300015372|Ga0132256_102319005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300015373|Ga0132257_100023245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6584 | Open in IMG/M |
3300015374|Ga0132255_100223718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Pleomorphomonas → unclassified Pleomorphomonas → Pleomorphomonas sp. COJ-58 | 2675 | Open in IMG/M |
3300017947|Ga0187785_10528653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300017955|Ga0187817_10471400 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300017959|Ga0187779_10060824 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
3300017961|Ga0187778_10110208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1716 | Open in IMG/M |
3300017961|Ga0187778_10586803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 746 | Open in IMG/M |
3300017961|Ga0187778_10916550 | Not Available | 603 | Open in IMG/M |
3300017970|Ga0187783_10947516 | Not Available | 620 | Open in IMG/M |
3300017995|Ga0187816_10376323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300018006|Ga0187804_10299932 | Not Available | 700 | Open in IMG/M |
3300018007|Ga0187805_10568079 | Not Available | 535 | Open in IMG/M |
3300018046|Ga0187851_10262537 | Not Available | 1009 | Open in IMG/M |
3300020150|Ga0187768_1007391 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
3300020583|Ga0210401_10156401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema ishimotonii | 2129 | Open in IMG/M |
3300021088|Ga0210404_10000086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 68142 | Open in IMG/M |
3300021180|Ga0210396_10009154 | All Organisms → cellular organisms → Bacteria | 9369 | Open in IMG/M |
3300021180|Ga0210396_10029832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5044 | Open in IMG/M |
3300021180|Ga0210396_11101748 | Not Available | 668 | Open in IMG/M |
3300021181|Ga0210388_11038292 | Not Available | 701 | Open in IMG/M |
3300021407|Ga0210383_10616195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
3300021432|Ga0210384_10413969 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300021432|Ga0210384_10990268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300021433|Ga0210391_10820961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
3300021477|Ga0210398_10565307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
3300021478|Ga0210402_10453636 | Not Available | 1191 | Open in IMG/M |
3300021479|Ga0210410_10003044 | All Organisms → cellular organisms → Bacteria | 14923 | Open in IMG/M |
3300021559|Ga0210409_10000378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 79871 | Open in IMG/M |
3300021559|Ga0210409_10045297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4155 | Open in IMG/M |
3300021559|Ga0210409_10115104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2474 | Open in IMG/M |
3300021559|Ga0210409_10560936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
3300021861|Ga0213853_10234652 | Not Available | 598 | Open in IMG/M |
3300025494|Ga0207928_1058540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300025527|Ga0208714_1056814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
3300025905|Ga0207685_10020100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2213 | Open in IMG/M |
3300025906|Ga0207699_10440097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
3300025916|Ga0207663_10175866 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300025916|Ga0207663_10403919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1045 | Open in IMG/M |
3300025916|Ga0207663_11061730 | Not Available | 650 | Open in IMG/M |
3300025921|Ga0207652_10611160 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 977 | Open in IMG/M |
3300025928|Ga0207700_10551423 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300027297|Ga0208241_1008540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1404 | Open in IMG/M |
3300027565|Ga0209219_1079633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
3300027729|Ga0209248_10027628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1768 | Open in IMG/M |
3300027729|Ga0209248_10086837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
3300027898|Ga0209067_10325386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 849 | Open in IMG/M |
3300027911|Ga0209698_10170514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1774 | Open in IMG/M |
3300028800|Ga0265338_10257473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena → unclassified Anabaena → Anabaena sp. CRKS33 | 1284 | Open in IMG/M |
3300028906|Ga0308309_11202131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300029636|Ga0222749_10024013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2543 | Open in IMG/M |
3300031057|Ga0170834_110225134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1194 | Open in IMG/M |
3300031344|Ga0265316_10104294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2152 | Open in IMG/M |
3300031718|Ga0307474_10116859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2000 | Open in IMG/M |
3300032160|Ga0311301_10952938 | Not Available | 1145 | Open in IMG/M |
3300032160|Ga0311301_10970981 | Not Available | 1129 | Open in IMG/M |
3300032160|Ga0311301_11628108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300032160|Ga0311301_11985420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300032174|Ga0307470_10625091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Sandaracinaceae → Sandaracinus → Sandaracinus amylolyticus | 809 | Open in IMG/M |
3300032174|Ga0307470_10950427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300032783|Ga0335079_10015319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8768 | Open in IMG/M |
3300032828|Ga0335080_10916938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 897 | Open in IMG/M |
3300032893|Ga0335069_10045728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5794 | Open in IMG/M |
3300032893|Ga0335069_10883169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
3300032893|Ga0335069_11438277 | Not Available | 744 | Open in IMG/M |
3300032895|Ga0335074_10940928 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 774 | Open in IMG/M |
3300032955|Ga0335076_10314493 | Not Available | 1454 | Open in IMG/M |
3300033004|Ga0335084_10447754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1328 | Open in IMG/M |
3300033433|Ga0326726_10254153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1637 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.08% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.20% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.20% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.43% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.65% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 4.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.10% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.10% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.10% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.33% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.55% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.55% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.55% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.78% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.78% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_100690871 | 3300001593 | Forest Soil | VWPDKITVETRWDEKAGLRRDAVRSQVIDVLEAQIKRRPAMKKVSTVR |
Ga0066675_113442292 | 3300005187 | Soil | MTGEIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVS |
Ga0070667_1003743132 | 3300005367 | Switchgrass Rhizosphere | LRTATIIADNRWDEKAGLRAGCGVRSQVIDVLEAQIKRRPAMKKVS |
Ga0070714_1004550644 | 3300005435 | Agricultural Soil | MRTTAVNRWDEKAGLQTGCGVRSQVIGVLEAQLKGEAMKKGSTAV |
Ga0070714_1006470743 | 3300005435 | Agricultural Soil | MVEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKIS |
Ga0070714_1016000192 | 3300005435 | Agricultural Soil | VFHQSVVGENRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVST |
Ga0070713_1006309181 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDVIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKI |
Ga0070711_1001677613 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VVDVNRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTA |
Ga0073909_1000009234 | 3300005526 | Surface Soil | MSTDENRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKK |
Ga0070741_102291771 | 3300005529 | Surface Soil | VIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSTA |
Ga0070731_107864061 | 3300005538 | Surface Soil | MSGENRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMKKISTAS |
Ga0070732_108286652 | 3300005542 | Surface Soil | LSLVSIDENRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVA |
Ga0070732_109812631 | 3300005542 | Surface Soil | LTVVDETRWDEKAGLRTGCGVRSQVIDVLRGTRDKRRPAMKKVS |
Ga0066702_100325707 | 3300005575 | Soil | MLMAGVSRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVST |
Ga0068854_1002054742 | 3300005578 | Corn Rhizosphere | LRTATIIADNRWDEKAGLRAGCGVRSQVIDVLEAQIKRRPAMKKVST |
Ga0068856_1004698983 | 3300005614 | Corn Rhizosphere | MTDENRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSTVA |
Ga0068860_1007942462 | 3300005843 | Switchgrass Rhizosphere | LPITDEKAGLRAGCGVRSQVIDVLEAQIKRRPAMKKVST |
Ga0070766_103572552 | 3300005921 | Soil | MAYETRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMKKV |
Ga0070717_101996552 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSHKSPVTVENRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKK |
Ga0070717_104985051 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRALTELSVADEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKISTA |
Ga0070717_118003751 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSPSGEFYRIVDVTRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVS |
Ga0075029_1006528081 | 3300006052 | Watersheds | MGIRHLTVETRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMK |
Ga0075015_1004898572 | 3300006102 | Watersheds | MRKRIPVVNRWDEKAGLRTGCGVRSQVIDVLKAQIRRRPAMKK |
Ga0075030_1003731801 | 3300006162 | Watersheds | VVVVIRWDEKAGLPAGCGVRSQVIEVLEAQIKRRPAMKKGSTR |
Ga0075030_1004610021 | 3300006162 | Watersheds | MSYSLTDEIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSTRA |
Ga0070716_1016033472 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VVDVNRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTAATKQS |
Ga0070712_1009867871 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VVDVNRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTAA |
Ga0070765_1000064651 | 3300006176 | Soil | MIVINRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMKKISTVA |
Ga0070765_1000141571 | 3300006176 | Soil | VIAVVTRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMKKISTVAA |
Ga0073928_100010501 | 3300006893 | Iron-Sulfur Acid Spring | LVLRDDNRWDEKAGLRRDALSSQAIGALEAHEIRRPAMKKPSTKMV |
Ga0105240_101189311 | 3300009093 | Corn Rhizosphere | MMTVDNRWDEKAGLRTGCGVRSQVINVLEAQIKRRP |
Ga0126373_118617391 | 3300010048 | Tropical Forest Soil | LALSIGVTRWDEKAGLRTGCRVCSQVIDVLEAQIKRRPAMKKVSTAVAK |
Ga0074046_10000003209 | 3300010339 | Bog Forest Soil | MSTDAIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVS |
Ga0074046_100000731 | 3300010339 | Bog Forest Soil | VRTLTVVSRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTAVM |
Ga0074046_100001561 | 3300010339 | Bog Forest Soil | VTVETRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVST |
Ga0074046_1000041236 | 3300010339 | Bog Forest Soil | LVTVANRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTAVM |
Ga0074044_100000331 | 3300010343 | Bog Forest Soil | MSTDAIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTAVM |
Ga0074044_105488522 | 3300010343 | Bog Forest Soil | MITVVNRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMKKVSTAAVK |
Ga0134128_106230554 | 3300010373 | Terrestrial Soil | MVEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVST |
Ga0136449_1013220592 | 3300010379 | Peatlands Soil | LVPILIRVPVETRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVAA |
Ga0136449_1014487872 | 3300010379 | Peatlands Soil | MVDAIRWDEKAGLRRDAVRSQVIDVLEAQIKRRPAMKKVSTAA |
Ga0136449_1018793423 | 3300010379 | Peatlands Soil | MALWHIVDEIRWDEKAGLRRDAVRSQVIDVLEAQIKRRPAMKKVSTAATM |
Ga0136449_1024648651 | 3300010379 | Peatlands Soil | MVSMITVEDRWDEKAGLRRDAVRSQVIDVLEAQIKRRPAMKKVSTAATM |
Ga0150983_117950901 | 3300011120 | Forest Soil | MAGVNRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKK |
Ga0164309_119507521 | 3300012984 | Soil | VVDVNRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVST |
Ga0157374_120384281 | 3300013296 | Miscanthus Rhizosphere | MIVEIRWDEKAGLRRDAIRSQVIDVLKAQIKRRPAMKRVSTVGT* |
Ga0157374_123252091 | 3300013296 | Miscanthus Rhizosphere | MVEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKRVSTVGT* |
Ga0157372_100405681 | 3300013307 | Corn Rhizosphere | MHRASTAVIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKK |
Ga0157372_100863731 | 3300013307 | Corn Rhizosphere | MACTEMITDENRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVST |
Ga0157372_102405661 | 3300013307 | Corn Rhizosphere | MSGITNGRRLSVGNRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTA |
Ga0157372_107649213 | 3300013307 | Corn Rhizosphere | LALDENRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVST |
Ga0157372_110101471 | 3300013307 | Corn Rhizosphere | VFTTVAIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKV |
Ga0181519_110357542 | 3300014658 | Bog | LFRVTKPSTVEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPTMKKVSTVAA |
Ga0132258_101061648 | 3300015371 | Arabidopsis Rhizosphere | MTVVTRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVTAKQS |
Ga0132258_106777974 | 3300015371 | Arabidopsis Rhizosphere | VIPVYGQTDVNRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVA |
Ga0132258_110629201 | 3300015371 | Arabidopsis Rhizosphere | VPAAIGLQPTVANRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVA |
Ga0132258_114917001 | 3300015371 | Arabidopsis Rhizosphere | MIVVIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSTAG |
Ga0132256_1000162121 | 3300015372 | Arabidopsis Rhizosphere | MMTVENRWNEKAGLRTGCGVRSQVIDVLKAQIKRRPA |
Ga0132256_1023190052 | 3300015372 | Arabidopsis Rhizosphere | VTTDENRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKV |
Ga0132257_1000232451 | 3300015373 | Arabidopsis Rhizosphere | MTVVTRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVTAK |
Ga0132255_1002237184 | 3300015374 | Arabidopsis Rhizosphere | VPAAIGLQPTVANRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKK |
Ga0187785_105286532 | 3300017947 | Tropical Peatland | MTGENRWDEKAGLRTGCGVRSQVIDVLKAQRQRRPAMKK |
Ga0187817_104714002 | 3300017955 | Freshwater Sediment | MPKADVNRWDEKAGLRRDAVRSQVIEVLEAQIKRR |
Ga0187779_100608244 | 3300017959 | Tropical Peatland | MIDETRWDEKAGLRTGCSVCSQVIDVLEAQIKRRPAMKKVSI |
Ga0187778_101102081 | 3300017961 | Tropical Peatland | VLATAVIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSTAR |
Ga0187778_105868032 | 3300017961 | Tropical Peatland | MVYETRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMK |
Ga0187778_109165502 | 3300017961 | Tropical Peatland | MVDTIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVST |
Ga0187783_109475162 | 3300017970 | Tropical Peatland | VITVVTRWDEKAGLRTGCSVCSQVIDVLEAQIKRRPAMKKVSTAVA |
Ga0187816_103763232 | 3300017995 | Freshwater Sediment | VYLSVPTVAIRWDEKAGLRRDAVRSQVIDVLEAQIKRRPAMKKVSTA |
Ga0187804_102999321 | 3300018006 | Freshwater Sediment | VSLAARLIGITVATRWDEKAGLRTGCGVRSQIIDVLEAQI |
Ga0187805_105680792 | 3300018007 | Freshwater Sediment | LYRIVDVSRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKK |
Ga0187851_102625373 | 3300018046 | Peatland | MLVVAESRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTR |
Ga0187768_10073911 | 3300020150 | Tropical Peatland | MIDETRWDEKAGLRTGCSVCSQVIDVLEAQIKRRPAMKKVSITATMQ |
Ga0210401_101564011 | 3300020583 | Soil | LISSARPTGVAVANRWDEKAGLRRDAVRSQVINVLEAQIKRRPAMKKVSTVRAAQ |
Ga0210404_100000861 | 3300021088 | Soil | MVAVEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVAAKP |
Ga0210396_100091541 | 3300021180 | Soil | LDRWDEKAGLRRDAIRSQVIDVLEAQIKRRPAMKKVSIVTAAQS |
Ga0210396_100298321 | 3300021180 | Soil | MTDVIRWDEKAGLRRDAIRSQVIDVLEAQIKRRPAMKKVSIVTAAQS |
Ga0210396_111017482 | 3300021180 | Soil | VDVIRWDEKAGLRAGCGVRSQVIDVLRGTRDKRRPAMKKV |
Ga0210388_110382921 | 3300021181 | Soil | VPIGIIGEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVA |
Ga0210383_106161951 | 3300021407 | Soil | IAGEWLALIDEIRWDEKAALRTGCGVRSQVIDVLKAQIKRRPAMKRLAP |
Ga0210384_104139691 | 3300021432 | Soil | VDVIRWDEKAGLRAGCGVRSQVIDVLRGTRDKRRP |
Ga0210384_109902681 | 3300021432 | Soil | LSLVSIDENRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPA |
Ga0210391_108209611 | 3300021433 | Soil | VIAVVTRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMKK |
Ga0210398_105653071 | 3300021477 | Soil | MAGVNRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKSS |
Ga0210402_104536362 | 3300021478 | Soil | VGFVVVVTRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAGG |
Ga0210410_100030441 | 3300021479 | Soil | MAEAIRWDEKAGLRRDAIRSQVIDVLEAQIKRRPAMKKVSIVTAAQS |
Ga0210409_1000037892 | 3300021559 | Soil | LDRWDEKAGLRRDAIRSQVIDVLEAQIKRRPAMKKVSIVTAAQ |
Ga0210409_100452971 | 3300021559 | Soil | VGELIDEVIRWDEKAGLRAGCGVRSQVIDVLRGTRDKRRPAMKKVSTAVA |
Ga0210409_101151044 | 3300021559 | Soil | MSLAGSDIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAM |
Ga0210409_105609361 | 3300021559 | Soil | MTALNRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSTAA |
Ga0213853_102346522 | 3300021861 | Watersheds | VTVEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKGSTVA |
Ga0207928_10585401 | 3300025494 | Arctic Peat Soil | VTGGQHLIITVETRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAM |
Ga0208714_10568143 | 3300025527 | Arctic Peat Soil | MVAVIRWDEKAGLRRDAARSQVIDVLKAQIKRRPAMKKIST |
Ga0207685_100201003 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEANRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSTAIAK |
Ga0207699_104400971 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDETRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAM |
Ga0207663_101758663 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVGEIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSSVAGQASRK |
Ga0207663_104039193 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTDANRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTA |
Ga0207663_110617301 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MIYEIRWGEKAGLRTGCGVRSQVIDVLKAQVKRRPAMKKVSTAATEQSR |
Ga0207652_106111601 | 3300025921 | Corn Rhizosphere | LKIADENRWDEKAGLRTGCGVRSQVIDVLKAQIKRRP |
Ga0207700_105514231 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VRSIVEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMK |
Ga0207640_104731992 | 3300025981 | Corn Rhizosphere | LRTATIIADNRWDEKAGLRAGCGVRSQVIDVLEAQIKRRPAMKKVSTTTAKQSR |
Ga0208241_10085403 | 3300027297 | Forest Soil | MAGVNRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKSSTIA |
Ga0209219_10796332 | 3300027565 | Forest Soil | VWPDKITVETRWDEKAGLRRDAVRSQVIDVLEAQIKRRPAMK |
Ga0209248_100276281 | 3300027729 | Bog Forest Soil | LILDENRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMK |
Ga0209248_100868371 | 3300027729 | Bog Forest Soil | LKQSIVEIRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMK |
Ga0209067_103253861 | 3300027898 | Watersheds | VIDGNRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKK |
Ga0209698_101705144 | 3300027911 | Watersheds | MGIRHLTVETRWDEKAGLRTGCGVRTQVIDVLKAQIKR |
Ga0268264_107330451 | 3300028381 | Switchgrass Rhizosphere | LRTATIIADNRWDEKAGLRAGCGVRSQVIDVLEAQIKRRPAMKKVSTTT |
Ga0265338_102574731 | 3300028800 | Rhizosphere | MLASSTVVNRWDEKAGLRRDAVRSQVIDVLEAQIKRRPAMKKISTVA |
Ga0308309_112021311 | 3300028906 | Soil | VIAVVTRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMKKISTVAAKPS |
Ga0222749_100240131 | 3300029636 | Soil | MVAVEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVST |
Ga0170834_1102251341 | 3300031057 | Forest Soil | VGVENRWDEKAGLRRDAVRSQVIDVLKAQIKRRPAMKKI |
Ga0265316_101042943 | 3300031344 | Rhizosphere | MTVVIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAM |
Ga0307474_101168593 | 3300031718 | Hardwood Forest Soil | VETRWDEKAGLRRDAIRSQVIDVLEAQIKRRPAMKKVSTVAAA |
Ga0311301_109529381 | 3300032160 | Peatlands Soil | MRSVNRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKGST |
Ga0311301_109709812 | 3300032160 | Peatlands Soil | LVPILIRVPVETRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVAAKP |
Ga0311301_116281082 | 3300032160 | Peatlands Soil | LKHVDVSRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTVAAKP |
Ga0311301_119854203 | 3300032160 | Peatlands Soil | MALWHIVDEIRWDEKAGLRRDAVRSQVIDVLEAQIKRRPAMKKVSTAATMQS |
Ga0307470_106250912 | 3300032174 | Hardwood Forest Soil | MVDEIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMK |
Ga0307470_109504271 | 3300032174 | Hardwood Forest Soil | LGIVDETRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMK |
Ga0335079_100153191 | 3300032783 | Soil | MIDATRWDEKAGLRAGCGVRSQVIDVLKAQIKRRPAMKKVSTVAA |
Ga0335080_109169381 | 3300032828 | Soil | LASDSRLTTVIVEIRWDEKAGLRAGCGVRSQVIDVLKAQIKRRPAMKK |
Ga0335069_100457288 | 3300032893 | Soil | LVTVINRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSTAATK |
Ga0335069_108831692 | 3300032893 | Soil | MTDEIRWDEKAGLRTGCSVRSQVIDVLEAQIKRRPAMKKV |
Ga0335069_114382772 | 3300032893 | Soil | VDVRSKARLIDVIRWDEKAGLRTGCGVRSQVIDVLEAQIKRRPAMKKVSTAATK |
Ga0335074_109409281 | 3300032895 | Soil | VDVVTRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKVSTAATMESR |
Ga0335076_103144931 | 3300032955 | Soil | VNASTVLTRWDEKAGLRTGCGVRSQVIDVLKAQIRRRPAMK |
Ga0335084_104477543 | 3300033004 | Soil | VTDVTRWNEKAGLRRDAVRSQVIDVLEAQIKRRPAMKKTSTAVTKQ |
Ga0326726_102541533 | 3300033433 | Peat Soil | MRLLGEIRWDEKAGLRTGCGVRSQVIDVLKAQIKRRPAMKKISTAAAR |
⦗Top⦘ |