NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063950

Metagenome / Metatranscriptome Family F063950

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063950
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 43 residues
Representative Sequence MRDQAIGQPDVRSLALAEPTQHVRHRWIIGLTLASLGMWMATQ
Number of Associated Samples 114
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.07 %
% of genes near scaffold ends (potentially truncated) 99.22 %
% of genes from short scaffolds (< 2000 bps) 93.02 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.070 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.705 % of family members)
Environment Ontology (ENVO) Unclassified
(17.829 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.364 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.48%    β-sheet: 0.00%    Coil/Unstructured: 53.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF02771Acyl-CoA_dh_N 44.19
PF00583Acetyltransf_1 13.18
PF13581HATPase_c_2 2.33
PF03551PadR 1.55
PF13673Acetyltransf_10 1.55
PF03109ABC1 1.55
PF03029ATP_bind_1 0.78
PF02687FtsX 0.78
PF00905Transpeptidase 0.78
PF00082Peptidase_S8 0.78
PF00296Bac_luciferase 0.78
PF12679ABC2_membrane_2 0.78
PF00005ABC_tran 0.78
PF01717Meth_synt_2 0.78
PF12323HTH_OrfB_IS605 0.78
PF08281Sigma70_r4_2 0.78
PF05223MecA_N 0.78
PF13635DUF4143 0.78
PF04030ALO 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 44.19
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 1.55
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.55
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.55
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.55
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.78
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.78
COG1100GTPase SAR1 family domainGeneral function prediction only [R] 0.78
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.78
COG2229Signal recognition particle receptor subunit beta, a GTPaseIntracellular trafficking, secretion, and vesicular transport [U] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.07 %
UnclassifiedrootN/A20.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_143734All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300000567|JGI12270J11330_10254485Not Available564Open in IMG/M
3300000955|JGI1027J12803_106872147All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300001356|JGI12269J14319_10293614Not Available588Open in IMG/M
3300003505|JGIcombinedJ51221_10019639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2354Open in IMG/M
3300004091|Ga0062387_100300372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1034Open in IMG/M
3300004092|Ga0062389_100371733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1536Open in IMG/M
3300004092|Ga0062389_104456977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300004152|Ga0062386_101040730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia679Open in IMG/M
3300004635|Ga0062388_102426024All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005445|Ga0070708_101993797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300005467|Ga0070706_100167706All Organisms → cellular organisms → Bacteria2050Open in IMG/M
3300005560|Ga0066670_10749181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300005569|Ga0066705_10414311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia844Open in IMG/M
3300005610|Ga0070763_10049313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1997Open in IMG/M
3300005842|Ga0068858_101514719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300006052|Ga0075029_100776552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300006174|Ga0075014_100566463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia645Open in IMG/M
3300006755|Ga0079222_11130436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia692Open in IMG/M
3300006854|Ga0075425_102346197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300006904|Ga0075424_101940061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300009093|Ga0105240_11295434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300009520|Ga0116214_1168262Not Available819Open in IMG/M
3300009522|Ga0116218_1270933Not Available762Open in IMG/M
3300009683|Ga0116224_10240529Not Available864Open in IMG/M
3300009698|Ga0116216_10246067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1093Open in IMG/M
3300009792|Ga0126374_11039805All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300009824|Ga0116219_10225896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1067Open in IMG/M
3300010047|Ga0126382_11859307All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300010322|Ga0134084_10211846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300010358|Ga0126370_10918689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300010360|Ga0126372_11110277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300010373|Ga0134128_11185186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300010379|Ga0136449_100505655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2096Open in IMG/M
3300010379|Ga0136449_100905172All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300010379|Ga0136449_104063326Not Available545Open in IMG/M
3300010876|Ga0126361_10690462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1635Open in IMG/M
3300012205|Ga0137362_11548857All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300012210|Ga0137378_11793107Not Available518Open in IMG/M
3300012356|Ga0137371_10894923All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012359|Ga0137385_10582273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii942Open in IMG/M
3300012514|Ga0157330_1034951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300012960|Ga0164301_10215797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300015264|Ga0137403_11394673Not Available549Open in IMG/M
3300015356|Ga0134073_10236697All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300015373|Ga0132257_104066299All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300016319|Ga0182033_11018438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300016357|Ga0182032_10817425All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300017822|Ga0187802_10280320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii648Open in IMG/M
3300017823|Ga0187818_10364735Not Available639Open in IMG/M
3300017926|Ga0187807_1067752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1110Open in IMG/M
3300017937|Ga0187809_10435593All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300017955|Ga0187817_10149163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1486Open in IMG/M
3300017970|Ga0187783_10296974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1178Open in IMG/M
3300017972|Ga0187781_11258425Not Available545Open in IMG/M
3300017975|Ga0187782_10434118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300018001|Ga0187815_10210995Not Available822Open in IMG/M
3300018062|Ga0187784_10656613Not Available841Open in IMG/M
3300018086|Ga0187769_10465399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria953Open in IMG/M
3300018468|Ga0066662_12724759Not Available523Open in IMG/M
3300019787|Ga0182031_1554296Not Available1727Open in IMG/M
3300020581|Ga0210399_10070565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2828Open in IMG/M
3300020581|Ga0210399_10579906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria929Open in IMG/M
3300020582|Ga0210395_10342942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1124Open in IMG/M
3300021384|Ga0213876_10073319Not Available1808Open in IMG/M
3300021401|Ga0210393_11360733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii568Open in IMG/M
3300021403|Ga0210397_11577546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii510Open in IMG/M
3300021405|Ga0210387_10072454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2821Open in IMG/M
3300021405|Ga0210387_10758281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii858Open in IMG/M
3300021433|Ga0210391_10582749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia878Open in IMG/M
3300021474|Ga0210390_10265529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1454Open in IMG/M
3300021474|Ga0210390_11425140All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300021477|Ga0210398_10331493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium1241Open in IMG/M
3300022532|Ga0242655_10300134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300025634|Ga0208589_1110799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii641Open in IMG/M
3300025928|Ga0207700_10648249Not Available941Open in IMG/M
3300025929|Ga0207664_11079003All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300026023|Ga0207677_10880488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300026142|Ga0207698_10431528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1267Open in IMG/M
3300026490|Ga0257153_1076337All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300027604|Ga0208324_1209939Not Available514Open in IMG/M
3300027857|Ga0209166_10407944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii705Open in IMG/M
3300027879|Ga0209169_10452480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii675Open in IMG/M
3300027884|Ga0209275_10422046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii754Open in IMG/M
3300028072|Ga0247675_1045329All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300028709|Ga0307279_10086441Not Available566Open in IMG/M
3300030494|Ga0310037_10207643Not Available865Open in IMG/M
3300030580|Ga0311355_10757209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii896Open in IMG/M
3300030706|Ga0310039_10110249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1143Open in IMG/M
3300031184|Ga0307499_10171726All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300031234|Ga0302325_12836932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii566Open in IMG/M
3300031564|Ga0318573_10594139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M
3300031572|Ga0318515_10725330All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031708|Ga0310686_102415804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1572Open in IMG/M
3300031708|Ga0310686_114209852Not Available923Open in IMG/M
3300031708|Ga0310686_114969352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1134Open in IMG/M
3300031715|Ga0307476_11391245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii511Open in IMG/M
3300031724|Ga0318500_10322970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii759Open in IMG/M
3300031744|Ga0306918_11251853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii572Open in IMG/M
3300031747|Ga0318502_10401491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria815Open in IMG/M
3300031747|Ga0318502_10910990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii535Open in IMG/M
3300031753|Ga0307477_10452479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii876Open in IMG/M
3300031765|Ga0318554_10202512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1130Open in IMG/M
3300031768|Ga0318509_10182625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1164Open in IMG/M
3300031769|Ga0318526_10173547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii879Open in IMG/M
3300031805|Ga0318497_10544921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii650Open in IMG/M
3300031805|Ga0318497_10848768All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031846|Ga0318512_10587118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii568Open in IMG/M
3300031859|Ga0318527_10302590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii681Open in IMG/M
3300031879|Ga0306919_10189603Not Available1522Open in IMG/M
3300031890|Ga0306925_11678671All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300031910|Ga0306923_10114147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3058Open in IMG/M
3300031910|Ga0306923_10943473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii942Open in IMG/M
3300031938|Ga0308175_100722029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1084Open in IMG/M
3300032059|Ga0318533_10540228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii855Open in IMG/M
3300032076|Ga0306924_10005379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12605Open in IMG/M
3300032160|Ga0311301_10793794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1303Open in IMG/M
3300032261|Ga0306920_100496854Not Available1810Open in IMG/M
3300032770|Ga0335085_11759244Not Available636Open in IMG/M
3300032770|Ga0335085_12341089All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300032805|Ga0335078_12731033Not Available502Open in IMG/M
3300032828|Ga0335080_10689762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1065Open in IMG/M
3300032828|Ga0335080_12124010Not Available541Open in IMG/M
3300032892|Ga0335081_10117709All Organisms → cellular organisms → Bacteria3893Open in IMG/M
3300032892|Ga0335081_11206141Not Available862Open in IMG/M
3300032892|Ga0335081_11293620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria823Open in IMG/M
3300033134|Ga0335073_12097579Not Available512Open in IMG/M
3300033158|Ga0335077_10058661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4647Open in IMG/M
3300033290|Ga0318519_10952011All Organisms → cellular organisms → Bacteria532Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.71%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil10.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.43%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.10%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.33%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.78%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_023481202199352025SoilMRDQTVGPADALSLALAEPDRHVRHRWILGLTLASLGMW
JGI12270J11330_1025448513300000567Peatlands SoilMRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWMAN
JGI1027J12803_10687214723300000955SoilMRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLG
JGI12269J14319_1029361423300001356Peatlands SoilMRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWMA
JGIcombinedJ51221_1001963943300003505Forest SoilMRHDPAMADQVIGQPDVQSLALAEPTQQVRIRWIVTLTLASLG
Ga0062387_10030037233300004091Bog Forest SoilMDQAIGQTQPQSLALAEPTQHVRVRWIITLTLASLGMWMANQTPSQV
Ga0062389_10037173313300004092Bog Forest SoilMDQAISQPEVQSLALAEPTQHVRIRWIITLTLASLGMWMANQ
Ga0062389_10445697723300004092Bog Forest SoilMADQAISQPDVQSLALAEPTQHVRVRWIVVLTLASLGMWMANQTPSQVLLAL
Ga0062386_10104073023300004152Bog Forest SoilMRDQVIGQPDVHSPALAEPTQHVRSRWITGLALASLGMWM
Ga0062388_10242602423300004635Bog Forest SoilMRDQAIGQPGVGSLALAEPTQYVRYRWITGLALASLGMWMATQT
Ga0070708_10199379713300005445Corn, Switchgrass And Miscanthus RhizosphereMIHVMRDLTIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQVM
Ga0070706_10016770633300005467Corn, Switchgrass And Miscanthus RhizosphereMADQVIGQPDVQSLALAEPTQHVRVRWLFGLTLASLGMWMA
Ga0066670_1074918113300005560SoilMRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMWMATQTPLQ
Ga0066705_1041431113300005569SoilMRETIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQVMLA
Ga0070763_1004931313300005610SoilVRDQAIGQPDAASLALAEPTKFVRNRWVIGLTLASLGMWMA
Ga0068858_10151471913300005842Switchgrass RhizosphereMRDQTVGPADALSLALAEPDQHVRRRWILGLTLASL
Ga0075029_10077655213300006052WatershedsMRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWMANQT
Ga0075014_10056646323300006174WatershedsMADQAIGQPQVQSLALAEPDQHVRIRWIVYLTLASLGMWMANQTPS
Ga0079222_1113043623300006755Agricultural SoilMRETIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQVMLALQLQD
Ga0075425_10234619723300006854Populus RhizosphereMTDQTIGQPDVQSLALAEPTEHVRRRWVFGLTLASLGMWMATQTP
Ga0075424_10194006123300006904Populus RhizosphereMRDQTIGQADALSRALAEPTEHVRRRWVFGLALASLGMWMATQTP
Ga0105240_1129543423300009093Corn RhizosphereMRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMW
Ga0116214_116826223300009520Peatlands SoilMRDEAIGRPDVGSLALAEPTVHVRPRWIVGLTLAMLG
Ga0116218_127093313300009522Peatlands SoilMRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWLANQTP
Ga0116224_1024052913300009683Peatlands SoilMRDQAIGQPDVSSLALAEPTRHVRRRWIVGLTLASLGMWM
Ga0116216_1024606723300009698Peatlands SoilMRDQAIGQPDVSSLALAEPTRHVRRRWIVGLTLASLG
Ga0126374_1103980513300009792Tropical Forest SoilMTDQTIGQPDVLSLALAEPTQHVRRGWIVGLTLASLGMWMA
Ga0116219_1022589613300009824Peatlands SoilMRDQAIGQPDVSSLALAEPTRHVRRRWIVGLTLASLGMWMANQT
Ga0126382_1185930713300010047Tropical Forest SoilMSDQVIGPPDVQSPALAEPTQHVRYRWIVGLTLASLGMWM
Ga0134084_1021184613300010322Grasslands SoilMRETIGQADALSLALAEPDQHVRHRWILGLTLASL
Ga0126370_1091868913300010358Tropical Forest SoilMRDQTVGPADALSLALAEPDQHVRHRWILGLTLASLGMWMAMQ
Ga0126372_1111027723300010360Tropical Forest SoilMRHDLGDEGVMRDQTVGPADALSLALAEPDQHVRHRWILGLTLASLGMWMA
Ga0134128_1118518623300010373Terrestrial SoilMRDQTIGPPDVQSLALAEPTEHVRHRWVYGLTLASLGMWMATQTPQ
Ga0136449_10050565513300010379Peatlands SoilMRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLAS
Ga0136449_10090517213300010379Peatlands SoilMRDQAIGQPEVSSLALAEPTRHVRRRWIVGLTLASLGMWMANQT
Ga0136449_10406332623300010379Peatlands SoilMRDQAIGQPDLSLALAEPTQHVRRRWIIGLTLASLGMWMATQTP
Ga0126361_1069046233300010876Boreal Forest SoilMADQVIGQPDVQSLALAEPTQQVRVRWIVTLTLASLGMWMANQTPSQVLLALQL
Ga0137362_1154885713300012205Vadose Zone SoilMRHHPAMADQVIGQPDVQSLALAEPTQHVRIRWIIGLTLASL
Ga0137378_1179310723300012210Vadose Zone SoilMRDQTIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMA
Ga0137371_1089492323300012356Vadose Zone SoilMRDQTTGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQV
Ga0137385_1058227313300012359Vadose Zone SoilMRDQVIGQPDVSSLALAEPIQHVRHRWVIGLTLASLG
Ga0157330_103495123300012514SoilMRDQAVGPADALSLALAEPDQHVRHRWILGLTLASLG
Ga0164301_1021579713300012960SoilMRDQTVGQADALSLALAEPDQHVRRRWILGLTLASLGMWMA
Ga0137403_1139467313300015264Vadose Zone SoilMGDQTIGQPGVQSLALAEPTEHVRRRWIFGLALASL
Ga0134073_1023669713300015356Grasslands SoilMRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGM
Ga0132257_10406629913300015373Arabidopsis RhizosphereMSDQAIGQQDVQSLARAEPTQHVRYRWIVGLTLASLGMWMATQT
Ga0182033_1101843823300016319SoilMSDQAIGQPDVQSLALAEPTQHVRYRWIVGLTLASLGMWMATQTP
Ga0182032_1081742523300016357SoilMSDQVIGQPDVQSLALAEPTRHVRYRWIVGLTLASLGMWMATQ
Ga0187802_1028032023300017822Freshwater SedimentVADQVVGQPKVQSLALAEPSQHVRIRWIIWLTLASLGMWMA
Ga0187818_1036473523300017823Freshwater SedimentMRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWM
Ga0187807_106775213300017926Freshwater SedimentMGQAISQPDVQSLALAEPNQHVRIRWIIYLTLASLGMWMATQ
Ga0187809_1043559313300017937Freshwater SedimentMSDQVIGQPGVQSPALAEPTQHVRYRWIVGLTLASL
Ga0187817_1014916343300017955Freshwater SedimentMDQAISQPDVRSPALAEPTEHVRIRWILGLTLASLGMWMANQTPSQV
Ga0187783_1029697433300017970Tropical PeatlandMRDEAIGRPDADSRALAEPVQFVRYRWILGLSLASLGMWMANQTPSQVMLAL
Ga0187781_1125842523300017972Tropical PeatlandMRDQVIGQQDALTLALAEPTRHVRYRWIFGLTLASLGMWMATQTPL
Ga0187782_1043411833300017975Tropical PeatlandMRDQAIGEPDVRSLALAEPTRHVRYGWIIGLTLASLGMWMATQTPL
Ga0187815_1021099523300018001Freshwater SedimentMRDEAIDRPDVRSLALAEPTTHVRPRWIVGLTLAMLGMWMA
Ga0187784_1065661313300018062Tropical PeatlandMRDEAIGRTGVRSLALAEPTNHVRNRWIVGLVLASLGMWMANQTPSQ
Ga0187769_1046539923300018086Tropical PeatlandMRHDPAMRDQAIGQPDVASLALAEPTRHVRYRWITGLTLASLGM
Ga0066662_1272475913300018468Grasslands SoilMRETIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTP
Ga0182031_155429623300019787BogMRDQARGQPDVLSLALAEPTQHVRYRWITGLSLASLGM
Ga0210399_1007056513300020581SoilMADQVIGQPDVQSLALAEPTQHVRIRWIVTLTLASLGMWMANQTPSQVML
Ga0210399_1057990623300020581SoilMSDQTIGQPDVQSLALAEPTQHVRYRWIVGLTLASLGMWMATQTPLQGML
Ga0210395_1034294223300020582SoilMRETIGQADALSLALAEPDQHVRRRWILGLTLASLGMWMATQTP
Ga0213876_1007331923300021384Plant RootsMSDQTVGQEDVQPAALAEPIQYVRYRWISGLTLASLGMWMATQTPL
Ga0210393_1136073313300021401SoilMRHDPAMADQVIGQPGVQSLALAEPTQQVRIRWIV
Ga0210397_1157754623300021403SoilMADQVIGQPDVQSLALAEPTQHVRIRWIVTLTLASLGMWMANQTPSQVMLALQMQ
Ga0210387_1007245413300021405SoilMADQVIGQPDVQSLALAEPTQHVRIRWIVTLTLASLGMWMANQTPSQVMLALQMQAIT
Ga0210387_1075828113300021405SoilMADQVIGQPGVQSLALAEPTQQVRIRWIVTLTLASL
Ga0210391_1058274923300021433SoilMRDQEIGQADVGSLALAEPTQHVRIRWIVTLTLASVGMWMANQTPSQVLLALQLQDI
Ga0210390_1026552913300021474SoilMRHDPAMADQAISQPDVQSLALAEPTQHVRVRWIF
Ga0210390_1142514023300021474SoilMSDQTIGQEDVQSLALAEPTQHVRYRWIVGLTLASLGMWMA
Ga0210398_1033149313300021477SoilMAMRDDAIGQREVVSRALAEPDQHVRYRWIIGLTLASLGMW
Ga0242655_1030013413300022532SoilDALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQVMLALNMPVPYCVY
Ga0208589_111079913300025634Arctic Peat SoilMADQVIGQPGVQSLALAEPTQHVRVRWIITLTLASLGMWMANQTPSQVMLALQLQD
Ga0207700_1064824923300025928Corn, Switchgrass And Miscanthus RhizosphereMRDQTIGPPDVQSLALAEPTEHVRHRWVFGLTLASLGMWMA
Ga0207664_1107900323300025929Agricultural SoilMRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMWMA
Ga0207677_1088048813300026023Miscanthus RhizosphereMRDQTVGPADALSLALAEPDQHVRRHWILGLTLASL
Ga0207698_1043152823300026142Corn RhizosphereMRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMWM
Ga0257153_107633713300026490SoilMRPSYVMIWVMRDQTIGQADALSLALAEPDQHVRRRWILGLTLASLGMWMATQTPLQ
Ga0208324_120993913300027604Peatlands SoilMRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWLANQ
Ga0209166_1040794413300027857Surface SoilMADQVIGQPDVQSLALAEPTQQVRVRWIVTLTLASLGMWMANQTP
Ga0209169_1045248013300027879SoilMRHDPAMADQVVGQSDVQSLALAEPTQHVRIRWIFTLTLASLGMWMANQTPSQVMLAL
Ga0209275_1042204623300027884SoilMRHDPAMADQAISQPDVQSLALAEPTQHVRIRWIFGLTLAS
Ga0247675_104532913300028072SoilMRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMWMATQ
Ga0307279_1008644113300028709SoilMRDQTVGQADALSLALAEPDQHVRRRWILGLTLASLGM
Ga0310037_1020764313300030494Peatlands SoilMAAMRDQAIGQPDVSSLALAEPTRHVRRRWIVGLTLAS
Ga0311355_1075720923300030580PalsaVRDQAIGQADVGSLALAEPTQFVRYRWVIGLTLASLGMWMA
Ga0310039_1011024913300030706Peatlands SoilMDQAISQPDVQSLALAEPAEHVRIRWILGLTLASLGMWMANQTPSQVML
Ga0307499_1017172623300031184SoilMRDQTIGQADALSLALAEPDRHVRHRWILGLTLASLGMWMAAQ
Ga0302325_1283693213300031234PalsaMADQAISQPNVQSPALAEPTQHVRVRWIVVLTLASLGM
Ga0318573_1059413913300031564SoilMADQVVGQPQAQSLALAEPDQHVRVRWIGYLTLASLGMWMA
Ga0318515_1072533013300031572SoilMSGQVIGQPGVQSLALAEPTKHVRHRWIVGLTLASLGMW
Ga0310686_10241580433300031708SoilMRHDPAMDQAIGQAQSLALAEPTQHVRIRWIGTLTLASLGMWMANQTPSQVMLALQMQDI
Ga0310686_11420985213300031708SoilMRDEAIGRPDVQSLALAEPTTHVRPRWIIGLTLAMLGMWMAVQAPSQVVLA
Ga0310686_11496935223300031708SoilMSDQVIGQPDVRSMALAEPTVYVRYRWIVGLTLASLGMWMANQT
Ga0307476_1139124513300031715Hardwood Forest SoilMRHDPAMADQAISQPDVQSLALAEPTQHVRVRWIVVLTLASLGMWMANQ
Ga0318500_1032297023300031724SoilVADQVIGQPEVQSLALAEPTRHVRIRWIIGLTLASLG
Ga0306918_1125185313300031744SoilMADQVIGQPQAQSLALAEPDQHVRIRWISYLTLAS
Ga0318502_1040149123300031747SoilMSDQVIGQPDVQSLALAEPTQHVRYRWIVGLTLASLG
Ga0318502_1091099023300031747SoilMDQAIGQPDVQSLALAEPNQHVRIRWIIYLTLASLGMWMATQTPLQVV
Ga0307477_1045247913300031753Hardwood Forest SoilMADQVVGQPQVQSLALAEPTQHVRVRWIITLTLASLGMW
Ga0318554_1020251233300031765SoilMADQVIGHPELHSLALAEPTRHVRIRWIICLALASLGM
Ga0318509_1018262533300031768SoilMADQVIGQPEVQSLALAEPTRHVRIRWIIGLTLAIHMPR
Ga0318526_1017354723300031769SoilMADQVVGQPQAQSLALAEPDQHVRVRWIGYLTLASLGMWMAVQTPSQV
Ga0318497_1054492123300031805SoilMADQVIGHPELHSLALAEPTRHVRIRWIICLALASLGMSMATQTPLQ
Ga0318497_1084876823300031805SoilMRDQVVGQPGAPSLALAEPTRHVRYRWIVGLTLASLGMWMAT
Ga0318512_1058711813300031846SoilMADQVIGHPELHSLALAEPTRHVRIRWIICLALASLGMSMATQT
Ga0318527_1030259023300031859SoilMDQAISQPDVQSLALAEPDQHVRIRWIIYLTLASLGMWMATQTPL
Ga0306919_1018960313300031879SoilMSDQVIGQPGVQSPALAEPTQHVRYRWIVGLTLAS
Ga0306925_1167867123300031890SoilMSDQVIGQPGVQSPALAEPTQHVRYRWIVGLTLASLGMWMATQTP
Ga0306923_1011414753300031910SoilVADQVIGQPEVQSLALAEPTRHVRIRWIIGLTLASLGMWMAT
Ga0306923_1094347313300031910SoilMDQAIGQPDVQSLALAEPNQHVRIRWIIYLTLASLGMWMATQTPLQV
Ga0308175_10072202923300031938SoilMRDQTIGQPDVQSLALAEPTEHVRRRWIFGLTLASLGMWMATQ
Ga0318533_1054022823300032059SoilVADQVIGQPEVQSLALAEPTRHVRIRWIICLTLASLGMWMATQTPL
Ga0306924_1000537913300032076SoilMSGQVIGQPGVQSLALAEPTKHVRHRWIVGLTLASLGMWMAT
Ga0311301_1079379433300032160Peatlands SoilMRAQAIGRPDVGSLALAEPTQHVRIRWIVTLTLASLGMWMANQT
Ga0306920_10049685423300032261SoilMSDQAIGQPGVQSPALAEPTQHVRYRWIVGLTLASLGMWMATQTP
Ga0335085_1175924413300032770SoilMRDQAIGQPDVRSLALAEPTQHVRHRWIIGLTLASLGMWMATQ
Ga0335085_1234108913300032770SoilMSDQVIGQPGVQSPALAEPTRHVRYRWIVGLTLAG
Ga0335078_1273103313300032805SoilMSDQVIGQPGVQSPALAEPTRHVRHRWIVGLTLASL
Ga0335080_1068976223300032828SoilMRDQAIGQPGTRSLALAEPTQHVRYRWITGLTLASLGMWMANQTP
Ga0335080_1212401023300032828SoilMSDQVVGQPGLQSLALAEPTRHVRYRWIVGLTLASLGMWMATQ
Ga0335081_1011770943300032892SoilMRDQAVGQPDVRSLALAEPTQHVRYRWITGLTLASLGMWMANQTPSQVMLALQLQD
Ga0335081_1120614113300032892SoilMSDQAIGQQEVQSRALAEPTKHVRRRWIVGLTLASLGMWM
Ga0335081_1129362023300032892SoilMSDQVVGQPGLQSLALAEPTRHVRYRWIVGLTLASLGMWMA
Ga0335073_1209757913300033134SoilMSDQTIGQPDVQPAALAEPTRHVKYRWITGLTLASLGMWMANQT
Ga0335077_1005866113300033158SoilMRDQAIGQPGTRSLALAEPTQHVRYRWITGLTLASLGMWMANQTPSQVM
Ga0318519_1095201123300033290SoilMSDQVIGQPGVQSPALAEPTQHVRYRWIVGLTLASLGMW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.