NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063869

Metagenome / Metatranscriptome Family F063869

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063869
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 39 residues
Representative Sequence QFDPKVVEVFLSIPERHWVELRENLGSPFRLAHLKNL
Number of Associated Samples 110
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.78 %
% of genes near scaffold ends (potentially truncated) 99.22 %
% of genes from short scaffolds (< 2000 bps) 82.17 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.124 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(20.930 % of family members)
Environment Ontology (ENVO) Unclassified
(27.132 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.488 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.08%    β-sheet: 0.00%    Coil/Unstructured: 56.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF01041DegT_DnrJ_EryC1 19.38
PF00510COX3 8.53
PF00578AhpC-TSA 3.88
PF13432TPR_16 3.10
PF13620CarboxypepD_reg 3.10
PF00155Aminotran_1_2 2.33
PF00300His_Phos_1 0.78
PF10263SprT-like 0.78
PF12704MacB_PCD 0.78
PF13649Methyltransf_25 0.78
PF13358DDE_3 0.78
PF07676PD40 0.78
PF03840SecG 0.78
PF13395HNH_4 0.78
PF07843DUF1634 0.78
PF00115COX1 0.78
PF00012HSP70 0.78
PF00117GATase 0.78
PF06202GDE_C 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 19.38
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 19.38
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 19.38
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 19.38
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 19.38
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 19.38
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 8.53
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.78
COG1314Protein translocase subunit SecGIntracellular trafficking, secretion, and vesicular transport [U] 0.78
COG3408Glycogen debranching enzyme (alpha-1,6-glucosidase)Carbohydrate transport and metabolism [G] 0.78
COG4272Uncharacterized membrane proteinFunction unknown [S] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.12 %
UnclassifiedrootN/A3.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000789|JGI1027J11758_12185351All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300000955|JGI1027J12803_108640668All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300004082|Ga0062384_100480836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4819Open in IMG/M
3300004120|Ga0058901_1417340All Organisms → cellular organisms → Bacteria → Acidobacteria1215Open in IMG/M
3300004152|Ga0062386_100321552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1236Open in IMG/M
3300004152|Ga0062386_100966458All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300004479|Ga0062595_102001553All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300004635|Ga0062388_102067333All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300005332|Ga0066388_102169562All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300005332|Ga0066388_108310603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae518Open in IMG/M
3300005454|Ga0066687_10720279All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005545|Ga0070695_101406659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae578Open in IMG/M
3300005556|Ga0066707_10380871All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300005568|Ga0066703_10011062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4348Open in IMG/M
3300005569|Ga0066705_10769805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 146576Open in IMG/M
3300005575|Ga0066702_10354410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae892Open in IMG/M
3300006162|Ga0075030_100008285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9235Open in IMG/M
3300006176|Ga0070765_100732004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae934Open in IMG/M
3300006176|Ga0070765_101287410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae690Open in IMG/M
3300006796|Ga0066665_10016451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4499Open in IMG/M
3300006854|Ga0075425_101478968All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300006871|Ga0075434_101696813All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300007076|Ga0075435_100780372All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300007265|Ga0099794_10283106All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300009089|Ga0099828_10882535All Organisms → cellular organisms → Bacteria → Acidobacteria799Open in IMG/M
3300009137|Ga0066709_100465309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1772Open in IMG/M
3300009143|Ga0099792_11065222All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300009162|Ga0075423_10170672All Organisms → cellular organisms → Bacteria2283Open in IMG/M
3300010043|Ga0126380_11017409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium699Open in IMG/M
3300010048|Ga0126373_10056071All Organisms → cellular organisms → Bacteria → Acidobacteria3517Open in IMG/M
3300010048|Ga0126373_10242387All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1770Open in IMG/M
3300010343|Ga0074044_11136425Not Available510Open in IMG/M
3300010361|Ga0126378_12924245All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010362|Ga0126377_11563286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium734Open in IMG/M
3300010366|Ga0126379_10001084All Organisms → cellular organisms → Bacteria → Acidobacteria16118Open in IMG/M
3300010371|Ga0134125_11010049All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300010373|Ga0134128_10054427All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4618Open in IMG/M
3300010376|Ga0126381_101723243All Organisms → cellular organisms → Bacteria → Acidobacteria905Open in IMG/M
3300011120|Ga0150983_13599827All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1132Open in IMG/M
3300011120|Ga0150983_16139328All Organisms → cellular organisms → Bacteria → Acidobacteria995Open in IMG/M
3300011269|Ga0137392_10198129All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300012199|Ga0137383_10833773All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300012202|Ga0137363_11055559All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300012203|Ga0137399_10833342All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300012203|Ga0137399_11563628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300012211|Ga0137377_10204207All Organisms → cellular organisms → Bacteria1897Open in IMG/M
3300012349|Ga0137387_10287244All Organisms → cellular organisms → Bacteria → Acidobacteria1188Open in IMG/M
3300012351|Ga0137386_10428985All Organisms → cellular organisms → Bacteria → Acidobacteria952Open in IMG/M
3300012363|Ga0137390_10864646All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300012363|Ga0137390_11548037All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300012923|Ga0137359_10141200All Organisms → cellular organisms → Bacteria → Acidobacteria2144Open in IMG/M
3300012923|Ga0137359_10304980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1418Open in IMG/M
3300012924|Ga0137413_11047898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6642Open in IMG/M
3300012925|Ga0137419_10021436All Organisms → cellular organisms → Bacteria → Acidobacteria3784Open in IMG/M
3300012925|Ga0137419_10122181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1840Open in IMG/M
3300012925|Ga0137419_11843751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300012930|Ga0137407_10094809All Organisms → cellular organisms → Bacteria2545Open in IMG/M
3300012944|Ga0137410_10293935All Organisms → cellular organisms → Bacteria → Acidobacteria1285Open in IMG/M
3300012960|Ga0164301_11148907All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300015053|Ga0137405_1237426All Organisms → cellular organisms → Bacteria → Acidobacteria847Open in IMG/M
3300015054|Ga0137420_1208768All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300015241|Ga0137418_10085493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2855Open in IMG/M
3300015245|Ga0137409_10169743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1983Open in IMG/M
3300015245|Ga0137409_10302054All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300016270|Ga0182036_10437946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1025Open in IMG/M
3300016294|Ga0182041_10909829All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300016341|Ga0182035_10016940All Organisms → cellular organisms → Bacteria → Acidobacteria4428Open in IMG/M
3300016341|Ga0182035_10596316All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300016341|Ga0182035_12031198All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300016422|Ga0182039_10021800All Organisms → cellular organisms → Bacteria3968Open in IMG/M
3300017822|Ga0187802_10420872All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300017934|Ga0187803_10298350All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300017942|Ga0187808_10257718All Organisms → cellular organisms → Bacteria → Acidobacteria781Open in IMG/M
3300017942|Ga0187808_10566653All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300018006|Ga0187804_10214553All Organisms → cellular organisms → Bacteria → Acidobacteria825Open in IMG/M
3300019882|Ga0193713_1138885All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300020199|Ga0179592_10167549All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1002Open in IMG/M
3300020581|Ga0210399_10042178All Organisms → cellular organisms → Bacteria3656Open in IMG/M
3300020582|Ga0210395_10165521All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1654Open in IMG/M
3300020583|Ga0210401_10089270All Organisms → cellular organisms → Bacteria2899Open in IMG/M
3300021171|Ga0210405_10272338All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300021178|Ga0210408_10627145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae850Open in IMG/M
3300021180|Ga0210396_10127502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2294Open in IMG/M
3300021401|Ga0210393_10918681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300021401|Ga0210393_11158784All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300021403|Ga0210397_10252524All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300021407|Ga0210383_10065982All Organisms → cellular organisms → Bacteria3024Open in IMG/M
3300021559|Ga0210409_10521835All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300022726|Ga0242654_10137443All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300024251|Ga0247679_1033019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium871Open in IMG/M
3300024287|Ga0247690_1004627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1648Open in IMG/M
3300024290|Ga0247667_1048622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300026467|Ga0257154_1050535Not Available644Open in IMG/M
3300026481|Ga0257155_1090280All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300026529|Ga0209806_1303357All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300026547|Ga0209156_10212495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300026551|Ga0209648_10027749All Organisms → cellular organisms → Bacteria → Acidobacteria4947Open in IMG/M
3300027061|Ga0209729_1026923All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300027064|Ga0208724_1027713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300027667|Ga0209009_1023494All Organisms → cellular organisms → Bacteria → Acidobacteria1506Open in IMG/M
3300027853|Ga0209274_10470912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300027910|Ga0209583_10065828All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300028047|Ga0209526_10879599All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300029993|Ga0302304_10238429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300030509|Ga0302183_10088725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1220Open in IMG/M
3300030707|Ga0310038_10271763All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300031057|Ga0170834_107414011Not Available648Open in IMG/M
3300031122|Ga0170822_13597443Not Available1268Open in IMG/M
3300031231|Ga0170824_127430526All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300031561|Ga0318528_10038930All Organisms → cellular organisms → Bacteria → Acidobacteria2369Open in IMG/M
3300031564|Ga0318573_10527113All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300031708|Ga0310686_106658253All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300031719|Ga0306917_11443969All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300031753|Ga0307477_11066215All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300031754|Ga0307475_10258454All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300031771|Ga0318546_10238419All Organisms → cellular organisms → Bacteria → Acidobacteria1250Open in IMG/M
3300031771|Ga0318546_11092924All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300031820|Ga0307473_10160665All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300031962|Ga0307479_10094642All Organisms → cellular organisms → Bacteria2899Open in IMG/M
3300031962|Ga0307479_10720348All Organisms → cellular organisms → Bacteria → Acidobacteria976Open in IMG/M
3300031962|Ga0307479_11523376All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300032001|Ga0306922_11451002All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300032043|Ga0318556_10222341All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300032160|Ga0311301_10351605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2304Open in IMG/M
3300032180|Ga0307471_100649344All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300032180|Ga0307471_102861970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300032261|Ga0306920_103561814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300032893|Ga0335069_10016544Not Available10282Open in IMG/M
3300033755|Ga0371489_0011508All Organisms → cellular organisms → Bacteria8019Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil20.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.98%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.43%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.43%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.10%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.10%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.33%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.33%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.55%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004120Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300024287Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027064Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J11758_1218535113300000789SoilDPKVVEVFLSIPDDHWKELRANLGSPFRLAHLRNLQS*
JGI1027J12803_10864066823300000955SoilQRCSGTQFDPKVVEVFLSIAELHWKELRESLGSPFRLAHLKNLNAS*
Ga0062384_10048083623300004082Bog Forest SoilKVVEVFMSIPDQHWIELRQNLGSPFRLAHLKSAMRNSLGG*
Ga0058901_141734023300004120Forest SoilRCSGTQFDPKVVDVFSTIPEGHWVELREHLGSPFRLAHLKNL*
Ga0062386_10032155223300004152Bog Forest SoilMAIGAFAEVFLSIPENHWIELRENIGSPFHLTHLRNMGFVPH*
Ga0062386_10096645823300004152Bog Forest SoilQFDPKIVEVFLSIPESHWIELRENIGSPFRLTHLKNMGLVPQ*
Ga0062595_10200155313300004479SoilTQFDPKVVEVFLSIPEQHWKELRETLGSPFRLAHLKNLDN*
Ga0062388_10206733313300004635Bog Forest SoilGTQFDPKVVEVFSTIPEEHWIDLREHLGSPFRLAHLKNL*
Ga0066388_10216956213300005332Tropical Forest SoilAGTQFDPKIVRVFLSIPEQHWHELRENMGSPFRLAHLKNLNN*
Ga0066388_10831060323300005332Tropical Forest SoilTQFDPKVVNVFLSIPEQHWIDLRENLGSPFRLAHLKSLQTTQ*
Ga0066687_1072027923300005454SoilQFDPKVVEVFLSIPDEHWKELRANLGSPFRLAHLRNLPA*
Ga0070695_10140665923300005545Corn, Switchgrass And Miscanthus RhizosphereSGTQFDPKVVEVFSTIPEQHWVDLREHLGSPFRLAHLKNL*
Ga0066707_1038087113300005556SoilDPKVVEVFLSIPEEHWKELRENLGSPFRLAHLRNLQP*
Ga0066703_1001106263300005568SoilCSGSQFDPAVVKVFLSIPEQHWIELRENLGSPFRLAHLKNL*
Ga0066705_1076980513300005569SoilIKRCSASQFDPAVVDVFMTIPEQHWLDLREHLGSPFRLAHLKNL*
Ga0066702_1035441033300005575SoilSQFDPAVVKVFLSIPEQHWIELRENLGSPFRLAHLKNL*
Ga0075030_10000828513300006162WatershedsGSQFDPKVVDVFMTIPEQHWLDLREHLGSPFRLAHLKNL*
Ga0070765_10073200423300006176SoilQFDPKVVEVFLSIPEEHWIELRENLGSPFRLAHLRNL*
Ga0070765_10128741013300006176SoilGTQFDPQVVEVFLSIPEEHWLDLRQNLGSPFRLAHLRNL*
Ga0066665_1001645143300006796SoilQFDPRVVEVFLSIPDQHWMTLRENVESPFRQAHFQNF*
Ga0075425_10147896813300006854Populus RhizosphereKVVEVFLSIPEQHWTELRETLGSPFRLAHLKNLDN*
Ga0075434_10169681323300006871Populus RhizosphereDPKVVEVFLSIPDDHWRELRENLGSPFRLAHLRNLHN*
Ga0075435_10078037213300007076Populus RhizosphereFDPKVVKVFLSIPELHWKELRETLGSPFRLAHLKNLEG*
Ga0099794_1028310613300007265Vadose Zone SoilGSQFDPQVVDVFMSIPEQHWLELRENLGSPFRLAHLKSLQV*
Ga0099828_1088253533300009089Vadose Zone SoilDPAVVDVFMTIPEQHWLDLREHLGSPFRLAHLKNL*
Ga0066709_10046530913300009137Grasslands SoilPKVVDVFLSIPEQHWMDLRENLGSPFRLAHLKSLQTN*
Ga0099792_1106522213300009143Vadose Zone SoilTQFDPKIAEVFLSIPEEHWAELRANLGSPFRLAHLRNLQS*
Ga0075423_1017067243300009162Populus RhizosphereDPKVVKVFLSIPELHWKELRETLGSPFRLAHLKNLEG*
Ga0126380_1101740913300010043Tropical Forest SoilDPKAVDVFLSIPEQHWIDLRESLGSPFRLAHLKSLQTN*
Ga0126373_1005607143300010048Tropical Forest SoilFDPEVVRVFMSIPERHWVELRENLGSPFRLAHLKNL*
Ga0126373_1024238713300010048Tropical Forest SoilTQFDPKVAEVFLSIPEERWKELRENLGSPFRLAHLRNLHS*
Ga0074044_1113642513300010343Bog Forest SoilQFDPKVVDVFSTIPEGHWVELREHLGSPFRLAHLKNL*
Ga0126378_1292424523300010361Tropical Forest SoilKVAEVFLSIPENHWKELRESLGSPFRLAHLKNLES*
Ga0126377_1156328613300010362Tropical Forest SoilTQFDPKVVEVFLSIPEQHWIDLRENLGSPFRLAHLKSLQATQ*
Ga0126379_1000108413300010366Tropical Forest SoilIVEVFLSIPEDHWIELRENLGSPFRLTHLKNIGLVPQ*
Ga0134125_1101004923300010371Terrestrial SoilPKVVEVFMSIPEEHWVELRENLGSPFRLAHLRNL*
Ga0134128_1005442733300010373Terrestrial SoilCSGTQFDPKVVEVFSTIPEQHWVDLREHLGSPFRLAHLKNL*
Ga0126381_10172324323300010376Tropical Forest SoilCAGTQFDPKIVRVFLSIPEQHWHELRENMGSPFRLAHLKNLNN*
Ga0150983_1359982713300011120Forest SoilRCSGTQFDPKVVEVFSTIPEQHWIDLREHLGSPFRLAHLKNL*
Ga0150983_1613932823300011120Forest SoilGTQFDPKVVDVFSTIPEGHWVELREHLGSPFRLAHLKNL*
Ga0137392_1019812913300011269Vadose Zone SoilKIAEVFLSIPEEHWAELRANLGSPFRLAHLRNLQS*
Ga0137383_1083377313300012199Vadose Zone SoilQFDPAVVDVFMTIPEEHWLDLREHLGSPFCLAQLKNL*
Ga0137363_1105555933300012202Vadose Zone SoilDPQVVDVFMSIPEQRWLELRENLGSPFRLAHLKNLQV*
Ga0137399_1083334213300012203Vadose Zone SoilSGSQFDPQVVDVFMSIPEEHWLELRESLGSPFRLAHLKNLQV*
Ga0137399_1156362813300012203Vadose Zone SoilQVVDVFMSIPEEHWLELRESLGSPFRLAHLKNLQV*
Ga0137377_1020420713300012211Vadose Zone SoilGTQFDPKVAEVFLSIPEDHWRELRESLGSPFRLTHLSNLHS*
Ga0137387_1028724433300012349Vadose Zone SoilCSASQFDPAVVDVFMTIPEQHWVELREHLGSPFRLAHLKNL*
Ga0137386_1042898513300012351Vadose Zone SoilSGSQFDPAVVDVFMTIPEQHWLDLREHLGSPFRLAHLKNL*
Ga0137390_1086464633300012363Vadose Zone SoilSGTQFDPKVVEVFMSIPEEHWLELRENLGSPFRLAHLKNL*
Ga0137390_1154803713300012363Vadose Zone SoilCSGSQFDPEVVKVFFSIPQQHWLDLRENLGSPFRLAHLKNL*
Ga0137359_1014120013300012923Vadose Zone SoilPKVAEVFLSIPEDHWRELRESLGSPFRLTHLSNLHS*
Ga0137359_1030498023300012923Vadose Zone SoilSQFDPAVVDVFMTIPEQHWLDLREHLGSPFRLAHLKNL*
Ga0137413_1104789823300012924Vadose Zone SoilFDPQVVEVFLSIPEEHWLELRENLGSPFRLAHLRNL*
Ga0137419_1002143613300012925Vadose Zone SoilGSQFDPAVVDVFMTIPEQHWVDLREHLGSPFRLAHLKNL*
Ga0137419_1012218133300012925Vadose Zone SoilCSGSQFDPAVVDVFMTIPEQHWVDLREHLGSPFRLAHLKNL*
Ga0137419_1184375113300012925Vadose Zone SoilFDPKVVEVFMSIPEEHWLELRENLGSPFRLAHLKNL*
Ga0137407_1009480943300012930Vadose Zone SoilKRCAGTQFDPKIAEVFLSIPEEHWAELRANLGSPFRLAHLRNLQS*
Ga0137410_1029393533300012944Vadose Zone SoilGSQFDPQVVDVFMSIPEEHWLELRENLGSPFRLAHLKNLQV*
Ga0164301_1114890713300012960SoilQFDPKVVEVFATIPEQHWVDLREHLGSPFRLAHLRNL*
Ga0137405_123742613300015053Vadose Zone SoilQFDPKFDPKVVDVFMTIPEQHWLDLREHLGSPFRLAHLKNL*
Ga0137420_120876813300015054Vadose Zone SoilFDPAVVDVFMTIPEQHWVDLREHLGSPFRLAHLKNL*
Ga0137418_1008549333300015241Vadose Zone SoilQFDPAVVDVFMTIPEQHWVDLREHLGSPFRLAHLKNL*
Ga0137409_1016974313300015245Vadose Zone SoilVDVFLSIPEQHWLDLRESLGSPFRLAHLKSLQTT*
Ga0137409_1030205413300015245Vadose Zone SoilPKVVEVFLSIPEQHWVELRQNLGSPFRLAHLKNLNN*
Ga0182036_1043794623300016270SoilCAGTQFDPKIVEVFMTIPEQHWMELRENLGSPFRLAHLKNLQAQ
Ga0182041_1090982913300016294SoilPRIVEVFLSIPESHLIDLRENLGSPFRLTHLKNTGLVG
Ga0182035_1001694053300016341SoilRRCAGTQFDPKIVSVFLSIPDKHWQELRQNLGSPFRLAHLKNLNN
Ga0182035_1059631633300016341SoilEVFLSIPESHLIDLRENLGSPFRLTHLKSMGLVPQ
Ga0182035_1203119823300016341SoilCSGSQFDPEVVKVFMSIPEQHWVDLRENLGSPFRLAHIKNL
Ga0182039_1002180013300016422SoilKIVEVFLSIPERHWIDLRENLGSPFRLAQLKNLKS
Ga0187802_1042087213300017822Freshwater SedimentQFDPKIVEVFLSIPEQHWIDLRENLGSPFRLAHLKNLKA
Ga0187803_1029835013300017934Freshwater SedimentDPKIVEVFLSIPEQNWLDIRENLGSPFRLTELKNLKA
Ga0187808_1025771833300017942Freshwater SedimentCAGTQFDPKIVEVFMSIPEAHWIELRENLGSPFRLTQLKNLRA
Ga0187808_1056665323300017942Freshwater SedimentSGSQFDPAVVDVFMSIPEQHWIELRENLGSPFRLAHLKNL
Ga0187804_1021455313300018006Freshwater SedimentPKIVDVFQSIPESHWMELRENLGSPFRLAHLKNLKA
Ga0193713_113888523300019882SoilFDPKIAKVFLSIPEEHWAELRANLGSPFRLAHLRNLQS
Ga0179592_1016754923300020199Vadose Zone SoilPKVVDVFLSIPEQHWMDLRENLGSPFRLAHLKSLQTN
Ga0210399_1004217823300020581SoilGTQFDPKIVEVFLSIPEQHWVELRENLGSPFRLAHLKNLNN
Ga0210395_1016552113300020582SoilQFDPKVVDVFSTIPEGHWVELREHLGSPFRLAHLKNL
Ga0210401_1008927033300020583SoilGTQFDPKIVEVFLSIPENHWIQLRANLGSPFRLTHPRNMAH
Ga0210405_1027233823300021171SoilGTQFDPKVVEVFMSIPEEHWLELRENLGSPFRLAHLRNL
Ga0210408_1062714523300021178SoilSGTQFDPKVVEVFMSIPEEHWVELRENLGSPFRLAHLRNL
Ga0210396_1012750223300021180SoilSGTQFDPKVVDVFSTIPEGHWVELREHLGSPFRLAHLKNL
Ga0210393_1091868113300021401SoilDPKVVEVFSTIPEEHWIDLREHLGSPFRLAHLKNL
Ga0210393_1115878413300021401SoilPRVAEVFLSIPEEHWKELRENLGSPFRLAHLRNLQS
Ga0210397_1025252423300021403SoilTQFDPKVVEVFMSIPEEHWLELRENLGSPFRLAHLRNL
Ga0210383_1006598223300021407SoilQFDPKIVEVFLSIPEQHWVELRENLGSPFRLAHLKNLNN
Ga0210409_1052183513300021559SoilTQFDPQVVEVFMAMPEQHWLDLRKNLGSPFHLAHLRNL
Ga0242654_1013744313300022726SoilGSQFDPAVVDVFMTIPEQHWLDLREHLGSPFRLAHLKNL
Ga0247679_103301913300024251SoilCSGTQFDPKVVEVFSTIPEQHWVDLREHLGSPFRLAHLKNL
Ga0247690_100462713300024287SoilRCSGTQFDPKVVEVFSTIPEQHWVDLREHLGSPFRLAHLKNL
Ga0247667_104862223300024290SoilPKVVDVFLSIPEQHWIDLRENLGSPFRLAHLKSLQTN
Ga0257154_105053513300026467SoilDPKVVEVFSTIPEEHWLDLREHLGSPFRLAHLKNL
Ga0257155_109028013300026481SoilQFDPKIAEVFLSIPEEHWAELRANLGSPFRLAHLRNLQS
Ga0209806_130335713300026529SoilDPAVVKVFLSIPEQHWIELRENLGSPFRLAHLKNL
Ga0209156_1021249513300026547SoilDPQVVRVFSSIPEQHWIELRENLGSPFRLAHLKNL
Ga0209648_1002774943300026551Grasslands SoilQFDPKVVDVFMTIPERHWLDLRENLGSPFRLAHLKNL
Ga0209729_102692313300027061Forest SoilGTQFDPKIVSVFLGIADPHWQELRDNLGSPFRLAHLKNFGN
Ga0208724_102771313300027064Forest SoilIVEVFLSIPENHWIDLRANLGSPFRLTHLRNMGLVPQ
Ga0209009_102349433300027667Forest SoilSGTQFDPKVVEVFMGIPEEHWVELRENLGSPFRLAHLKNLS
Ga0209274_1047091223300027853SoilRCSGTQFDPKVVEVFSTIPEQHWIDLREHLGSPFRLAHLKNL
Ga0209583_1006582833300027910WatershedsICRCSGTQFDPKVVEVFSTIPEGHWVDLREHLGSPFRLAHLKNL
Ga0209526_1087959923300028047Forest SoilQFDPKVVEVFMGIPEEHWIELRENLGSPFRLAHLKNLS
Ga0302304_1023842913300029993PalsaPKVVDVFLSIPDQHWIDLRQNLGSPFRLAHLKNAMRNAVNS
Ga0302183_1008872513300030509PalsaFLSIPDQHWIELRQNLGSPFRMAHLKNAMRNNVSS
Ga0310038_1027176333300030707Peatlands SoilFDPKIVEVFNTIPEQHWMELRESLASPFKLAHLRNL
Ga0170834_10741401113300031057Forest SoilNRGGFLSIPETPWIELRESLGSPFRLTHLKNMGLVPQ
Ga0170822_1359744313300031122Forest SoilRCARKQFDPKIVEVFLSIPENHWIELRGNLGSPFGLTHLRNLSMS
Ga0170824_12743052623300031231Forest SoilVGTQFDPKVAEVFLSIPEDHWRELRESLGSPFRLTQLRNLHS
Ga0318528_1003893013300031561SoilDPKIVRVFLSIPEQHWHELRENMGSPFRLAHLKNLNN
Ga0318573_1052711323300031564SoilCAGTQFDPKVVKVFLSIPQQHWTELRETLGSPFRLAHLKNLDN
Ga0310686_10665825323300031708SoilVQTCALPICTQFDPKIAEVFLSIPEQNWIQLRESLGSPFRLTQLKNLNA
Ga0306917_1144396913300031719SoilFDPEVVKVFSSIPEQHWIELREHLGSPFRLAHLRNL
Ga0307477_1106621513300031753Hardwood Forest SoilDPKIVEVFLSIPENHWIDLRENLGSPFRLTHLKNMGLVPQ
Ga0307475_1025845433300031754Hardwood Forest SoilQFDPKVVEVFLSIPERHWVELRENLGSPFRLAHLKNL
Ga0318546_1023841933300031771SoilIVEVFMTIPEQHWMELRENLGSPFRLAHLKNLQAQ
Ga0318546_1109292413300031771SoilTQFDPRVVQVFLAIREDHWKELRETLGSPFRLAHLKNLDA
Ga0307473_1016066543300031820Hardwood Forest SoilQFDPKVVSVFMSIPEEHWLELRENLGSPFRLAHLKNL
Ga0307479_1009464263300031962Hardwood Forest SoilFDPRVVNVFMSIPEEHWLELRENLGSPFKLAHLKNL
Ga0307479_1072034843300031962Hardwood Forest SoilTGTQFDPKVSEVFLSIPEQHWLELRENLGSPFRLAELKNL
Ga0307479_1152337613300031962Hardwood Forest SoilDPAVVDVFMTIPEQHWVELREHLGSPFRLAQLKNL
Ga0306922_1145100213300032001SoilPKIVSVFLSIPDKHWQELRQNLGSPFRLAHLKNLNN
Ga0318556_1022234123300032043SoilFDPKVVKVFLSIPQQHWTELRETLGSPFRLAHLKNLDN
Ga0311301_1035160513300032160Peatlands SoilCAGTQFDPQIVEVFNTIPEQHWLELRESLASPFKLAHLRNL
Ga0307471_10064934413300032180Hardwood Forest SoilPKVVEVFLSIPEEHWAELRANLGSPFRLAHLRNLQS
Ga0307471_10286197033300032180Hardwood Forest SoilMSIPEQHWLELRENLGSPFRLAHLKNLQDPSATPS
Ga0306920_10356181413300032261SoilQFDPRIVEVFLSIPESHLIDLRENLGSPFRLTHLKNTGLVG
Ga0335069_1001654413300032893SoilRRCSGAQFDPKVVEVFLSLPESLWVELCKNLRAPFRLG
Ga0371489_0011508_7903_80193300033755Peat SoilSQFDPKIVEVFQTIPEQHWLELRETLASPFKLAHLRNI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.