NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F063687

Metagenome Family F063687

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063687
Family Type Metagenome
Number of Sequences 129
Average Sequence Length 41 residues
Representative Sequence MTQSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDI
Number of Associated Samples 110
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 76.74 %
% of genes near scaffold ends (potentially truncated) 98.45 %
% of genes from short scaffolds (< 2000 bps) 96.12 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (75.969 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(24.806 % of family members)
Environment Ontology (ENVO) Unclassified
(65.116 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(60.465 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.43%    β-sheet: 0.00%    Coil/Unstructured: 48.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF03592Terminase_2 0.78
PF04480DUF559 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG3728Phage terminase, small subunitMobilome: prophages, transposons [X] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A75.97 %
All OrganismsrootAll Organisms24.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000736|JGI12547J11936_1086199Not Available579Open in IMG/M
3300002092|JGI24218J26658_1033855Not Available612Open in IMG/M
3300002374|B570J29620_1010657Not Available597Open in IMG/M
3300002835|B570J40625_100083756All Organisms → cellular organisms → Bacteria4092Open in IMG/M
3300003277|JGI25908J49247_10098925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium704Open in IMG/M
3300003393|JGI25909J50240_1022928All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300003395|JGI25917J50250_1045567All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium942Open in IMG/M
3300005582|Ga0049080_10119901Not Available889Open in IMG/M
3300005662|Ga0078894_11219036Not Available637Open in IMG/M
3300005805|Ga0079957_1102786Not Available1553Open in IMG/M
3300006030|Ga0075470_10242956Not Available508Open in IMG/M
3300006484|Ga0070744_10138916Not Available698Open in IMG/M
3300006802|Ga0070749_10491880Not Available669Open in IMG/M
3300006805|Ga0075464_10083891Not Available1812Open in IMG/M
3300006805|Ga0075464_10788398Not Available590Open in IMG/M
3300006805|Ga0075464_10935747Not Available542Open in IMG/M
3300006875|Ga0075473_10402052Not Available553Open in IMG/M
3300006920|Ga0070748_1075513Not Available1307Open in IMG/M
3300007973|Ga0105746_1223158Not Available646Open in IMG/M
3300008258|Ga0114840_1036611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium793Open in IMG/M
3300008266|Ga0114363_1188913Not Available645Open in IMG/M
3300008450|Ga0114880_1214863Not Available631Open in IMG/M
3300008450|Ga0114880_1246075Not Available561Open in IMG/M
3300009151|Ga0114962_10680207Not Available528Open in IMG/M
3300009152|Ga0114980_10694005Not Available571Open in IMG/M
3300009159|Ga0114978_10807716Not Available528Open in IMG/M
3300009160|Ga0114981_10773002Not Available507Open in IMG/M
3300009163|Ga0114970_10662049Not Available557Open in IMG/M
3300009165|Ga0105102_10633620Not Available594Open in IMG/M
3300009168|Ga0105104_10490603Not Available690Open in IMG/M
3300009180|Ga0114979_10049432Not Available2638Open in IMG/M
3300009181|Ga0114969_10227054Not Available1133Open in IMG/M
3300009187|Ga0114972_10659565Not Available580Open in IMG/M
3300009435|Ga0115546_1206047Not Available680Open in IMG/M
3300010354|Ga0129333_11287799Not Available604Open in IMG/M
3300010370|Ga0129336_10747741Not Available516Open in IMG/M
3300010885|Ga0133913_12276104Not Available1332Open in IMG/M
3300011995|Ga0153800_1027568Not Available593Open in IMG/M
3300012012|Ga0153799_1098788Not Available519Open in IMG/M
3300012663|Ga0157203_1058317Not Available519Open in IMG/M
3300012665|Ga0157210_1044212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium685Open in IMG/M
3300012666|Ga0157498_1071407Not Available534Open in IMG/M
3300013004|Ga0164293_10453315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium854Open in IMG/M
(restricted) 3300013132|Ga0172372_10540456Not Available763Open in IMG/M
(restricted) 3300013137|Ga0172375_10822381Not Available570Open in IMG/M
(restricted) 3300014720|Ga0172376_10459360Not Available720Open in IMG/M
3300014811|Ga0119960_1072913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium605Open in IMG/M
3300017701|Ga0181364_1036553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium789Open in IMG/M
3300017707|Ga0181363_1037399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium899Open in IMG/M
3300017761|Ga0181356_1211813Not Available568Open in IMG/M
3300017777|Ga0181357_1308446Not Available535Open in IMG/M
3300017778|Ga0181349_1047184Not Available1696Open in IMG/M
3300017785|Ga0181355_1311784Not Available588Open in IMG/M
3300017788|Ga0169931_10612237Not Available737Open in IMG/M
3300017788|Ga0169931_10729085Not Available648Open in IMG/M
3300019093|Ga0187843_10355625Not Available594Open in IMG/M
3300019783|Ga0181361_120782Not Available520Open in IMG/M
3300019784|Ga0181359_1044823Not Available1710Open in IMG/M
3300020141|Ga0211732_1128908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium635Open in IMG/M
3300020161|Ga0211726_10841187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium657Open in IMG/M
3300020176|Ga0181556_1216562Not Available716Open in IMG/M
3300020506|Ga0208091_1013600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium984Open in IMG/M
3300020506|Ga0208091_1017788Not Available838Open in IMG/M
3300020530|Ga0208235_1017024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium901Open in IMG/M
3300020554|Ga0208599_1001735All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4176Open in IMG/M
3300021962|Ga0222713_10854703Not Available503Open in IMG/M
3300021963|Ga0222712_10347754Not Available915Open in IMG/M
3300021963|Ga0222712_10476215Not Available743Open in IMG/M
3300022041|Ga0196881_10309Not Available529Open in IMG/M
3300022179|Ga0181353_1113385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium655Open in IMG/M
3300022179|Ga0181353_1153102Not Available529Open in IMG/M
3300022190|Ga0181354_1161723Not Available693Open in IMG/M
3300022190|Ga0181354_1237424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300022407|Ga0181351_1265069Not Available525Open in IMG/M
3300022747|Ga0228703_1032777Not Available1531Open in IMG/M
3300022752|Ga0214917_10117090Not Available1498Open in IMG/M
3300022752|Ga0214917_10120091Not Available1469Open in IMG/M
3300024510|Ga0255187_1039487Not Available644Open in IMG/M
3300025889|Ga0208644_1352914Not Available560Open in IMG/M
3300027147|Ga0255113_1071648Not Available635Open in IMG/M
3300027157|Ga0255204_1047913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium790Open in IMG/M
3300027291|Ga0255139_1088291Not Available505Open in IMG/M
3300027335|Ga0255130_1072711Not Available562Open in IMG/M
3300027375|Ga0255137_1063773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium662Open in IMG/M
3300027468|Ga0209247_1055795Not Available575Open in IMG/M
3300027586|Ga0208966_1057552Not Available1102Open in IMG/M
3300027656|Ga0209357_1145617Not Available634Open in IMG/M
3300027679|Ga0209769_1233230Not Available563Open in IMG/M
(restricted) 3300027730|Ga0247833_1134643All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1018Open in IMG/M
3300027733|Ga0209297_1033007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2404Open in IMG/M
3300027749|Ga0209084_1338773Not Available555Open in IMG/M
3300027754|Ga0209596_1149622Not Available1041Open in IMG/M
3300027798|Ga0209353_10299161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium682Open in IMG/M
3300027900|Ga0209253_10688914Not Available739Open in IMG/M
3300027900|Ga0209253_11022025Not Available569Open in IMG/M
(restricted) 3300027970|Ga0247837_1194688Not Available848Open in IMG/M
3300027973|Ga0209298_10324782Not Available595Open in IMG/M
(restricted) 3300027995|Ga0233418_10222200Not Available631Open in IMG/M
(restricted) 3300029286|Ga0247841_10747754Not Available585Open in IMG/M
3300031707|Ga0315291_10907971Not Available752Open in IMG/M
3300031707|Ga0315291_10965910Not Available721Open in IMG/M
3300031885|Ga0315285_10631408Not Available703Open in IMG/M
3300032053|Ga0315284_11077195Not Available896Open in IMG/M
3300032093|Ga0315902_11035290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium612Open in IMG/M
3300032143|Ga0315292_10567181Not Available956Open in IMG/M
3300032143|Ga0315292_10829014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium774Open in IMG/M
3300032143|Ga0315292_11055551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium673Open in IMG/M
3300032275|Ga0315270_10824795Not Available611Open in IMG/M
3300033981|Ga0334982_0497340Not Available539Open in IMG/M
3300033993|Ga0334994_0205952Not Available1060Open in IMG/M
3300033993|Ga0334994_0312928Not Available792Open in IMG/M
3300033996|Ga0334979_0483647Not Available672Open in IMG/M
3300034012|Ga0334986_0123158Not Available1526Open in IMG/M
3300034020|Ga0335002_0481897Not Available667Open in IMG/M
3300034061|Ga0334987_0074576Not Available2698Open in IMG/M
3300034061|Ga0334987_0157273Not Available1655Open in IMG/M
3300034066|Ga0335019_0272451Not Available1071Open in IMG/M
3300034071|Ga0335028_0405346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium778Open in IMG/M
3300034092|Ga0335010_0221972Not Available1135Open in IMG/M
3300034092|Ga0335010_0225174Not Available1124Open in IMG/M
3300034096|Ga0335025_0379769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium735Open in IMG/M
3300034102|Ga0335029_0453299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium758Open in IMG/M
3300034102|Ga0335029_0635312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium591Open in IMG/M
3300034104|Ga0335031_0474266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium767Open in IMG/M
3300034106|Ga0335036_0124903Not Available1860Open in IMG/M
3300034106|Ga0335036_0296673Not Available1075Open in IMG/M
3300034112|Ga0335066_0209144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium1151Open in IMG/M
3300034112|Ga0335066_0549137Not Available605Open in IMG/M
3300034120|Ga0335056_0357418Not Available796Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater24.81%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake17.05%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake10.08%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment6.98%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.20%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater4.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.88%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.55%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.55%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.55%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.55%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.55%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.55%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.78%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic0.78%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.78%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.78%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.78%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.78%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.78%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.78%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300002374Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003395Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008258Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011995Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300019093Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43EnvironmentalOpen in IMG/M
3300019783Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020554Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022041Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022747Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MGEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024510Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027147Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027157Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8hEnvironmentalOpen in IMG/M
3300027291Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8dEnvironmentalOpen in IMG/M
3300027335Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8dEnvironmentalOpen in IMG/M
3300027375Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300027468Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027995 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MGEnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12547J11936_108619913300000736Freshwater And SedimentMTTNKTRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITT
JGI24218J26658_103385523300002092LenticMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENFVSAKEDITV
B570J29620_101065713300002374FreshwaterMTTSKLRLNADIRKKIGGLILSHFENEKTTQFENFVSAKGLI*
B570J40625_10008375613300002835FreshwaterMTQNKTRLNTDIRKKIGSLILSHFENEKTPELENFISAKEDITT
JGI25908J49247_1009892513300003277Freshwater LakeMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDI
JGI25909J50240_102292813300003393Freshwater LakeMQTSKTRLNADIRKKIGGLIQSHFENEKTTELENFISAKEDINVA
JGI25917J50250_104556743300003395Freshwater LakeMTTSKLRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITT
Ga0049080_1011990143300005582Freshwater LenticMTKTKTRLNADIRKKIGGMILSHFENEKTTELENFKSAKED
Ga0078894_1121903613300005662Freshwater LakeMTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFKSAKEDITT
Ga0079957_110278643300005805LakeMTTSKLRLNADIRKKIGGLILSHFENEQTTELENFKSAK
Ga0075470_1024295613300006030AqueousMTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFK
Ga0070744_1013891623300006484EstuarineMTTSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDITTA
Ga0070749_1049188033300006802AqueousMTQTKARLNTDTRKKIGGLILSHFENEKTTELENFV
Ga0075464_1008389113300006805AqueousMTQTSKLRLNTDLRKKISSLILSHFENEKTTELENFKSAK
Ga0075464_1078839833300006805AqueousMTQSKLRLNTDIRKKIGGIILSHFENEKRIELENYTTAKEDI
Ga0075464_1093574713300006805AqueousMTTSKARLNTDIRKKIGGLILSHFENEKTTELENYTTAKE
Ga0075473_1040205213300006875AqueousMTTSKLRLNTDIRKKIGGLILSHFENEKTTEFENFV
Ga0070748_107551313300006920AqueousMTQTNKTRLNADIRKKIGGMILSHFENEKTTELENF
Ga0105746_122315813300007973Estuary WaterMTTSKTRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITTA
Ga0114840_103661133300008258Freshwater, PlanktonMTTSKLRLNTDIRKKIGGLILSHFENEKTTERENFISA
Ga0114363_118891323300008266Freshwater, PlanktonMTQTSKLRLNTDIRKKIGSLILSHFENEKTTELENFKSAK
Ga0114880_121486323300008450Freshwater LakeMTQNKTRLNTDIRKKIGGLILSHFENEKTTELENFKSAKEDI
Ga0114880_124607523300008450Freshwater LakeMTQTKTRLNTDIRKKIGGLILSHFENEKTTELENFKS
Ga0114962_1068020713300009151Freshwater LakeMTQVSKPRLNTEIRKKIGGIILSHFENEQTPELEAYKS
Ga0114980_1069400513300009152Freshwater LakeMTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYTTAKE
Ga0114978_1080771613300009159Freshwater LakeMTQNKTRLNTDIRKKIGGIILSHFENEKTPELENFISAKED
Ga0114981_1077300213300009160Freshwater LakeMTQSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDI
Ga0114970_1066204913300009163Freshwater LakeMTTSKLRLNTDIRKKIGSLILSHFENEKTTERENFISAKEDITT
Ga0105102_1063362013300009165Freshwater SedimentMTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYKTAKEDIT
Ga0105104_1049060323300009168Freshwater SedimentMTQNKTRLNTDIRKKIGGLILSHFENEKTTELENFKSA
Ga0114979_1004943243300009180Freshwater LakeMQTSKTRLNADIRKKIGGLIQSHFENEKTTELEHFI*
Ga0114969_1022705413300009181Freshwater LakeMTQSKLRLNTDIRKKIGSLIQSHFENEKTTELENYTTA
Ga0114972_1065956513300009187Freshwater LakeMTTSKLRLNTDIRKKIGSLILSHFENEKTTELENYT
Ga0115546_120604713300009435Pelagic MarineMTQSKLRLNTDIRKKIGGLILSHFENEKTTELENFVSAKE
Ga0129333_1128779913300010354Freshwater To Marine Saline GradientMTQSKLRLNTDIRKKIGSLILSHFENEKTTELENFKS
Ga0129336_1074774113300010370Freshwater To Marine Saline GradientMTQTTKTRLNTDIRKIIDGLILSHFEKEKTTEVENVVLADGD
Ga0133913_1227610413300010885Freshwater LakeMTKTKTRLNTDLRKKIGGLILSHFENEKTTEYENFKSAKEDI
Ga0153800_102756823300011995FreshwaterMTQSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTA
Ga0153799_109878813300012012FreshwaterMTQNKTRLNTDIRKKIGGLILSHFENEKTPELENFISAK
Ga0157203_105831713300012663FreshwaterMTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFKSAKEDITTAYNT
Ga0157210_104421233300012665FreshwaterMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYKTAKEDITTAYNT
Ga0157498_107140713300012666Freshwater, Surface IceMTQSKLRLNTDIRKKIGGIILSHFENEKRIELENYTTAKEDITTAYNT
Ga0164293_1045331513300013004FreshwaterMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAYNT
(restricted) Ga0172372_1054045613300013132FreshwaterMTQTKTRLNSDLRKKMGGLIQSFFETQKTLELENFKSAK
(restricted) Ga0172375_1082238123300013137FreshwaterMQTSKTRLNTDIRKKIGGLILSHFENEKTTELENFISAK
(restricted) Ga0172376_1045936013300014720FreshwaterMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENF
Ga0119960_107291323300014811AquaticMTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDITT
Ga0181364_103655313300017701Freshwater LakeMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTA
Ga0181363_103739913300017707Freshwater LakeMTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFKSA
Ga0181356_121181313300017761Freshwater LakeMTQTKTRLNTDIRKKIGVLILSHFENEKTTELENYTTAKEDITTAY
Ga0181357_130844613300017777Freshwater LakeMTTNKTRLNTDIRKKIGSLILSHFENEKTTERENFISAKEDITTAYDS
Ga0181349_104718443300017778Freshwater LakeMSVNKTRLNADIRKKIGGIILSHFENEKTTELENYK
Ga0181355_131178423300017785Freshwater LakeMTTNKTRLNTDIRKKIGGLILSHFENENRIEKENFISAKE
Ga0169931_1061223723300017788FreshwaterMQTSKTRLNTDIRKKIGGLILSHFENEKTTELENFISA
Ga0169931_1072908513300017788FreshwaterMTKARLNTDIRKKIGGLILSHFENEKTTELENFISAKE
Ga0187843_1035562513300019093FreshwaterMTQNKTRLNADIRKKIGGIILSHFENEKTTELENYTTAKEDITT
Ga0181361_12078223300019783Freshwater LakeMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITT
Ga0181359_104482313300019784Freshwater LakeMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDI
Ga0211732_112890823300020141FreshwaterMTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYTTA
Ga0211726_1084118713300020161FreshwaterMTQNKTRLNTDIRKKIGGLILSHFENEKTPELENFISAKEDITTAYNTA
Ga0181556_121656223300020176Salt MarshMTTSKARLNTDLRKKIGGLILSHFENEKTTELENFKSAKEDID
Ga0208091_101360013300020506FreshwaterMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKE
Ga0208091_101778833300020506FreshwaterMTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFKSAKGDVVVAYDRA
Ga0208235_101702443300020530FreshwaterMTQTNKTRLNTDLRKKISSLILSHFENEKTTELENFKSA
Ga0208599_100173593300020554FreshwaterMSVNKTRLNADIRKKIGGIILSHFENEKTTELENYKTAKEDITTAY
Ga0222713_1085470313300021962Estuarine WaterMTQSKLRLNTDIRKKIGSLILSHFENEKTPALENYTTAKEDITTAYNT
Ga0222712_1034775413300021963Estuarine WaterMTQSKLRLNTDIRKKIGSLILSHFENEKTPALENYTTAKEDI
Ga0222712_1047621513300021963Estuarine WaterMTTNKTRLNTDLRKKIGGLILSHFENEKTTELENFKSAKEDI
Ga0196881_1030913300022041Freshwater LakeMTQSKLRLNTNIRKKIGGLILSHFENEKTTELENYT
Ga0181353_111338513300022179Freshwater LakeMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDIT
Ga0181353_115310213300022179Freshwater LakeMTTNKTRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITTAYN
Ga0181354_116172323300022190Freshwater LakeMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENY
Ga0181354_123742423300022190Freshwater LakeMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAYD
Ga0181351_126506913300022407Freshwater LakeMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTA
Ga0228703_103277713300022747FreshwaterVSMTTSKLRLNTDIRKKIGGLILSHFENEKTTEYENFISAKED
Ga0214917_1011709013300022752FreshwaterMTTNKTRLNTDIRKKIGSLILSHFENEKTTERENFISAKE
Ga0214917_1012009113300022752FreshwaterMTTSKLRLNTDIRKKIGGLILSHFENEKTTEYENFISAKEDVDSAYA
Ga0255187_103948713300024510FreshwaterMTTNKTRLNTDLRKKIGGLILSHFENEKTTELENFK
Ga0208644_135291413300025889AqueousMTQTNKTRLNADIRKKIGGLILSHFENEQTTELENFKS
Ga0255113_107164823300027147FreshwaterMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAYN
Ga0255204_104791333300027157FreshwaterMTTSKLRLNTDIRKKIGGLILSHFENEKTTERENFISAKED
Ga0255139_108829113300027291FreshwaterMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDITTAYN
Ga0255130_107271113300027335FreshwaterMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYK
Ga0255137_106377323300027375FreshwaterMTQSKLRLNTDIRKKIGGIILSHFENEKRIELENYTTAKEDITTAYN
Ga0209247_105579513300027468Freshwater LakeMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAYDS
Ga0208966_105755213300027586Freshwater LenticMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAY
Ga0209357_114561713300027656Freshwater LakeMTQSKLRLNTDIRKKIGGLILSHFENEKTTELENYTT
Ga0209769_123323013300027679Freshwater LakeMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKED
(restricted) Ga0247833_113464313300027730FreshwaterMTTNKTRLNTDLRKKIGGLILSHFENEKTTELENFKSAKEDITV
Ga0209297_103300713300027733Freshwater LakeMTTSKLRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITNA
Ga0209084_133877313300027749Freshwater LakeMTQSKLRLNTDIRKKIGGLILSHFENEKTPALENYKTAKEDITTAY
Ga0209596_114962233300027754Freshwater LakeMTTSKTRLNTDIRKKIGSLILSHFENEKTTERENFISAKE
Ga0209353_1029916113300027798Freshwater LakeMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAK
Ga0209253_1068891423300027900Freshwater Lake SedimentMTTSKLRLNTDIRKKIGSLILSHFENEKTTELENFVSA
Ga0209253_1102202513300027900Freshwater Lake SedimentMTTSKARLNTDIRKKIGSLILSHFENEKTTELENFVSA
(restricted) Ga0247837_119468833300027970FreshwaterMTQTKTRLNSDLRKKMGGLIQSFFETQKTPELENFKSA
Ga0209298_1032478213300027973Freshwater LakeMTQSKLRLNTDIRKKIGSLIQSHFENEKTTELENY
(restricted) Ga0233418_1022220023300027995SedimentMTKARLNTDIRKKIGSLILSHFENEQTTEFENFKSAKEDID
(restricted) Ga0247841_1074775413300029286FreshwaterMTTSKARLNTDLRKKIGGLILSHFENEQTTELENFKSAKEDITVAY
Ga0315291_1090797123300031707SedimentMTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISGKE
Ga0315291_1096591013300031707SedimentMTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISAKEDITT
Ga0315285_1063140813300031885SedimentMTQSKLRLNTDIRKKIGSLILSHFENEKTPELENFISAKEDITT
Ga0315284_1107719533300032053SedimentMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENY
Ga0315902_1103529023300032093FreshwaterMTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKE
Ga0315292_1056718113300032143SedimentMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDITT
Ga0315292_1082901413300032143SedimentMTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISAKEDITTAYNTA
Ga0315292_1105555113300032143SedimentMTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDIT
Ga0315270_1082479513300032275SedimentMTTSKLRLNTDIRKKIGGLILSDFENEKTTELENYTTA
Ga0334982_0497340_434_5383300033981FreshwaterMTTSKLRLNTDIRKKIGGLILSHFENEKTTERENF
Ga0334994_0205952_916_10593300033993FreshwaterMTQTNKTRLNTDLRKKISSLILSHFENEKTTELENFKSAKEDITNAYN
Ga0334994_0312928_665_7903300033993FreshwaterMTQNKTRLNTDIRKKIGSLILSHFENEKTPELENFISAKEDI
Ga0334979_0483647_2_1063300033996FreshwaterMTQNKTRLNTDIRKKIGGIILSHFENEKTTELENF
Ga0334986_0123158_1419_15263300034012FreshwaterMTQTSKLRLNTDIRKKIGSLILSHFENEKTTELENY
Ga0335002_0481897_1_1173300034020FreshwaterMTQSKLRLNTDIRKKIGGIILSHFENEKRIELENYTTAK
Ga0334987_0074576_2555_26983300034061FreshwaterMSVNKTRLNTDIRKKIGGLIQSHFENEKTIELEKFISEKEDITTAYNT
Ga0334987_0157273_3_1403300034061FreshwaterMTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYKTAKEDITTAY
Ga0335019_0272451_1_1233300034066FreshwaterMSVNKTRLNADIRKKIGGIILSHFENEKTTELENYKTAKED
Ga0335028_0405346_1_1203300034071FreshwaterMTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISAKE
Ga0335010_0221972_1001_11353300034092FreshwaterMTTSKLRLNTDIRKKIGGLILSHFENEKTTQFENFVSAKGDVIVA
Ga0335010_0225174_998_11233300034092FreshwaterMTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYKTAKEDI
Ga0335025_0379769_3_1313300034096FreshwaterMTTSKLRLNADIRKKIGGLILSHFENENRIEKENFISAKEDIT
Ga0335029_0453299_3_1373300034102FreshwaterMTQNKTRLNADIRKKIGGLILSHFENEKTTELENYTTAKEDITTA
Ga0335029_0635312_3_1253300034102FreshwaterMTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISAKED
Ga0335031_0474266_3_1073300034104FreshwaterMTQSKLRLNTDIRKKIGGLILSHFENEKTTELENY
Ga0335036_0124903_3_1343300034106FreshwaterMTQNKTRLNTDLRKKISSLILSHFENEKTTELENFKSAKEDITT
Ga0335036_0296673_3_1253300034106FreshwaterMTQSKLRLNTDIRKKIGGLILSHFENEKTSELENFISAKED
Ga0335066_0209144_1045_11493300034112FreshwaterMTTNKTRLNTDIRKKIGGLILSHFENEKTTERENF
Ga0335066_0549137_2_1363300034112FreshwaterMTQTSKLRLNTDIRKKIGSLILSHFENEKTTELENYKTAKEDITT
Ga0335056_0357418_670_7953300034120FreshwaterMTQTSKLRLNTDIRKKIGSLILSHFENEKTTELENFKSAKED


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.