Basic Information | |
---|---|
Family ID | F063687 |
Family Type | Metagenome |
Number of Sequences | 129 |
Average Sequence Length | 41 residues |
Representative Sequence | MTQSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDI |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 76.74 % |
% of genes near scaffold ends (potentially truncated) | 98.45 % |
% of genes from short scaffolds (< 2000 bps) | 96.12 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (75.969 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (24.806 % of family members) |
Environment Ontology (ENVO) | Unclassified (65.116 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.465 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF03592 | Terminase_2 | 0.78 |
PF04480 | DUF559 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 75.97 % |
All Organisms | root | All Organisms | 24.03 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000736|JGI12547J11936_1086199 | Not Available | 579 | Open in IMG/M |
3300002092|JGI24218J26658_1033855 | Not Available | 612 | Open in IMG/M |
3300002374|B570J29620_1010657 | Not Available | 597 | Open in IMG/M |
3300002835|B570J40625_100083756 | All Organisms → cellular organisms → Bacteria | 4092 | Open in IMG/M |
3300003277|JGI25908J49247_10098925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 704 | Open in IMG/M |
3300003393|JGI25909J50240_1022928 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
3300003395|JGI25917J50250_1045567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 942 | Open in IMG/M |
3300005582|Ga0049080_10119901 | Not Available | 889 | Open in IMG/M |
3300005662|Ga0078894_11219036 | Not Available | 637 | Open in IMG/M |
3300005805|Ga0079957_1102786 | Not Available | 1553 | Open in IMG/M |
3300006030|Ga0075470_10242956 | Not Available | 508 | Open in IMG/M |
3300006484|Ga0070744_10138916 | Not Available | 698 | Open in IMG/M |
3300006802|Ga0070749_10491880 | Not Available | 669 | Open in IMG/M |
3300006805|Ga0075464_10083891 | Not Available | 1812 | Open in IMG/M |
3300006805|Ga0075464_10788398 | Not Available | 590 | Open in IMG/M |
3300006805|Ga0075464_10935747 | Not Available | 542 | Open in IMG/M |
3300006875|Ga0075473_10402052 | Not Available | 553 | Open in IMG/M |
3300006920|Ga0070748_1075513 | Not Available | 1307 | Open in IMG/M |
3300007973|Ga0105746_1223158 | Not Available | 646 | Open in IMG/M |
3300008258|Ga0114840_1036611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 793 | Open in IMG/M |
3300008266|Ga0114363_1188913 | Not Available | 645 | Open in IMG/M |
3300008450|Ga0114880_1214863 | Not Available | 631 | Open in IMG/M |
3300008450|Ga0114880_1246075 | Not Available | 561 | Open in IMG/M |
3300009151|Ga0114962_10680207 | Not Available | 528 | Open in IMG/M |
3300009152|Ga0114980_10694005 | Not Available | 571 | Open in IMG/M |
3300009159|Ga0114978_10807716 | Not Available | 528 | Open in IMG/M |
3300009160|Ga0114981_10773002 | Not Available | 507 | Open in IMG/M |
3300009163|Ga0114970_10662049 | Not Available | 557 | Open in IMG/M |
3300009165|Ga0105102_10633620 | Not Available | 594 | Open in IMG/M |
3300009168|Ga0105104_10490603 | Not Available | 690 | Open in IMG/M |
3300009180|Ga0114979_10049432 | Not Available | 2638 | Open in IMG/M |
3300009181|Ga0114969_10227054 | Not Available | 1133 | Open in IMG/M |
3300009187|Ga0114972_10659565 | Not Available | 580 | Open in IMG/M |
3300009435|Ga0115546_1206047 | Not Available | 680 | Open in IMG/M |
3300010354|Ga0129333_11287799 | Not Available | 604 | Open in IMG/M |
3300010370|Ga0129336_10747741 | Not Available | 516 | Open in IMG/M |
3300010885|Ga0133913_12276104 | Not Available | 1332 | Open in IMG/M |
3300011995|Ga0153800_1027568 | Not Available | 593 | Open in IMG/M |
3300012012|Ga0153799_1098788 | Not Available | 519 | Open in IMG/M |
3300012663|Ga0157203_1058317 | Not Available | 519 | Open in IMG/M |
3300012665|Ga0157210_1044212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 685 | Open in IMG/M |
3300012666|Ga0157498_1071407 | Not Available | 534 | Open in IMG/M |
3300013004|Ga0164293_10453315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 854 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10540456 | Not Available | 763 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10822381 | Not Available | 570 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10459360 | Not Available | 720 | Open in IMG/M |
3300014811|Ga0119960_1072913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 605 | Open in IMG/M |
3300017701|Ga0181364_1036553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 789 | Open in IMG/M |
3300017707|Ga0181363_1037399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 899 | Open in IMG/M |
3300017761|Ga0181356_1211813 | Not Available | 568 | Open in IMG/M |
3300017777|Ga0181357_1308446 | Not Available | 535 | Open in IMG/M |
3300017778|Ga0181349_1047184 | Not Available | 1696 | Open in IMG/M |
3300017785|Ga0181355_1311784 | Not Available | 588 | Open in IMG/M |
3300017788|Ga0169931_10612237 | Not Available | 737 | Open in IMG/M |
3300017788|Ga0169931_10729085 | Not Available | 648 | Open in IMG/M |
3300019093|Ga0187843_10355625 | Not Available | 594 | Open in IMG/M |
3300019783|Ga0181361_120782 | Not Available | 520 | Open in IMG/M |
3300019784|Ga0181359_1044823 | Not Available | 1710 | Open in IMG/M |
3300020141|Ga0211732_1128908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 635 | Open in IMG/M |
3300020161|Ga0211726_10841187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 657 | Open in IMG/M |
3300020176|Ga0181556_1216562 | Not Available | 716 | Open in IMG/M |
3300020506|Ga0208091_1013600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 984 | Open in IMG/M |
3300020506|Ga0208091_1017788 | Not Available | 838 | Open in IMG/M |
3300020530|Ga0208235_1017024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 901 | Open in IMG/M |
3300020554|Ga0208599_1001735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4176 | Open in IMG/M |
3300021962|Ga0222713_10854703 | Not Available | 503 | Open in IMG/M |
3300021963|Ga0222712_10347754 | Not Available | 915 | Open in IMG/M |
3300021963|Ga0222712_10476215 | Not Available | 743 | Open in IMG/M |
3300022041|Ga0196881_10309 | Not Available | 529 | Open in IMG/M |
3300022179|Ga0181353_1113385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 655 | Open in IMG/M |
3300022179|Ga0181353_1153102 | Not Available | 529 | Open in IMG/M |
3300022190|Ga0181354_1161723 | Not Available | 693 | Open in IMG/M |
3300022190|Ga0181354_1237424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300022407|Ga0181351_1265069 | Not Available | 525 | Open in IMG/M |
3300022747|Ga0228703_1032777 | Not Available | 1531 | Open in IMG/M |
3300022752|Ga0214917_10117090 | Not Available | 1498 | Open in IMG/M |
3300022752|Ga0214917_10120091 | Not Available | 1469 | Open in IMG/M |
3300024510|Ga0255187_1039487 | Not Available | 644 | Open in IMG/M |
3300025889|Ga0208644_1352914 | Not Available | 560 | Open in IMG/M |
3300027147|Ga0255113_1071648 | Not Available | 635 | Open in IMG/M |
3300027157|Ga0255204_1047913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 790 | Open in IMG/M |
3300027291|Ga0255139_1088291 | Not Available | 505 | Open in IMG/M |
3300027335|Ga0255130_1072711 | Not Available | 562 | Open in IMG/M |
3300027375|Ga0255137_1063773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 662 | Open in IMG/M |
3300027468|Ga0209247_1055795 | Not Available | 575 | Open in IMG/M |
3300027586|Ga0208966_1057552 | Not Available | 1102 | Open in IMG/M |
3300027656|Ga0209357_1145617 | Not Available | 634 | Open in IMG/M |
3300027679|Ga0209769_1233230 | Not Available | 563 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1134643 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1018 | Open in IMG/M |
3300027733|Ga0209297_1033007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2404 | Open in IMG/M |
3300027749|Ga0209084_1338773 | Not Available | 555 | Open in IMG/M |
3300027754|Ga0209596_1149622 | Not Available | 1041 | Open in IMG/M |
3300027798|Ga0209353_10299161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 682 | Open in IMG/M |
3300027900|Ga0209253_10688914 | Not Available | 739 | Open in IMG/M |
3300027900|Ga0209253_11022025 | Not Available | 569 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1194688 | Not Available | 848 | Open in IMG/M |
3300027973|Ga0209298_10324782 | Not Available | 595 | Open in IMG/M |
(restricted) 3300027995|Ga0233418_10222200 | Not Available | 631 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10747754 | Not Available | 585 | Open in IMG/M |
3300031707|Ga0315291_10907971 | Not Available | 752 | Open in IMG/M |
3300031707|Ga0315291_10965910 | Not Available | 721 | Open in IMG/M |
3300031885|Ga0315285_10631408 | Not Available | 703 | Open in IMG/M |
3300032053|Ga0315284_11077195 | Not Available | 896 | Open in IMG/M |
3300032093|Ga0315902_11035290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 612 | Open in IMG/M |
3300032143|Ga0315292_10567181 | Not Available | 956 | Open in IMG/M |
3300032143|Ga0315292_10829014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 774 | Open in IMG/M |
3300032143|Ga0315292_11055551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 673 | Open in IMG/M |
3300032275|Ga0315270_10824795 | Not Available | 611 | Open in IMG/M |
3300033981|Ga0334982_0497340 | Not Available | 539 | Open in IMG/M |
3300033993|Ga0334994_0205952 | Not Available | 1060 | Open in IMG/M |
3300033993|Ga0334994_0312928 | Not Available | 792 | Open in IMG/M |
3300033996|Ga0334979_0483647 | Not Available | 672 | Open in IMG/M |
3300034012|Ga0334986_0123158 | Not Available | 1526 | Open in IMG/M |
3300034020|Ga0335002_0481897 | Not Available | 667 | Open in IMG/M |
3300034061|Ga0334987_0074576 | Not Available | 2698 | Open in IMG/M |
3300034061|Ga0334987_0157273 | Not Available | 1655 | Open in IMG/M |
3300034066|Ga0335019_0272451 | Not Available | 1071 | Open in IMG/M |
3300034071|Ga0335028_0405346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 778 | Open in IMG/M |
3300034092|Ga0335010_0221972 | Not Available | 1135 | Open in IMG/M |
3300034092|Ga0335010_0225174 | Not Available | 1124 | Open in IMG/M |
3300034096|Ga0335025_0379769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 735 | Open in IMG/M |
3300034102|Ga0335029_0453299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 758 | Open in IMG/M |
3300034102|Ga0335029_0635312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 591 | Open in IMG/M |
3300034104|Ga0335031_0474266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 767 | Open in IMG/M |
3300034106|Ga0335036_0124903 | Not Available | 1860 | Open in IMG/M |
3300034106|Ga0335036_0296673 | Not Available | 1075 | Open in IMG/M |
3300034112|Ga0335066_0209144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1151 | Open in IMG/M |
3300034112|Ga0335066_0549137 | Not Available | 605 | Open in IMG/M |
3300034120|Ga0335056_0357418 | Not Available | 796 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 24.81% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.05% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.08% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.98% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.20% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.65% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.88% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.33% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.55% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.55% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.55% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.55% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.55% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.55% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.78% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.78% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.78% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.78% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.78% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.78% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.78% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.78% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002374 | Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022041 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024510 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027157 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027291 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8d | Environmental | Open in IMG/M |
3300027335 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300027375 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12547J11936_10861991 | 3300000736 | Freshwater And Sediment | MTTNKTRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITT |
JGI24218J26658_10338552 | 3300002092 | Lentic | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENFVSAKEDITV |
B570J29620_10106571 | 3300002374 | Freshwater | MTTSKLRLNADIRKKIGGLILSHFENEKTTQFENFVSAKGLI* |
B570J40625_1000837561 | 3300002835 | Freshwater | MTQNKTRLNTDIRKKIGSLILSHFENEKTPELENFISAKEDITT |
JGI25908J49247_100989251 | 3300003277 | Freshwater Lake | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDI |
JGI25909J50240_10229281 | 3300003393 | Freshwater Lake | MQTSKTRLNADIRKKIGGLIQSHFENEKTTELENFISAKEDINVA |
JGI25917J50250_10455674 | 3300003395 | Freshwater Lake | MTTSKLRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITT |
Ga0049080_101199014 | 3300005582 | Freshwater Lentic | MTKTKTRLNADIRKKIGGMILSHFENEKTTELENFKSAKED |
Ga0078894_112190361 | 3300005662 | Freshwater Lake | MTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFKSAKEDITT |
Ga0079957_11027864 | 3300005805 | Lake | MTTSKLRLNADIRKKIGGLILSHFENEQTTELENFKSAK |
Ga0075470_102429561 | 3300006030 | Aqueous | MTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFK |
Ga0070744_101389162 | 3300006484 | Estuarine | MTTSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDITTA |
Ga0070749_104918803 | 3300006802 | Aqueous | MTQTKARLNTDTRKKIGGLILSHFENEKTTELENFV |
Ga0075464_100838911 | 3300006805 | Aqueous | MTQTSKLRLNTDLRKKISSLILSHFENEKTTELENFKSAK |
Ga0075464_107883983 | 3300006805 | Aqueous | MTQSKLRLNTDIRKKIGGIILSHFENEKRIELENYTTAKEDI |
Ga0075464_109357471 | 3300006805 | Aqueous | MTTSKARLNTDIRKKIGGLILSHFENEKTTELENYTTAKE |
Ga0075473_104020521 | 3300006875 | Aqueous | MTTSKLRLNTDIRKKIGGLILSHFENEKTTEFENFV |
Ga0070748_10755131 | 3300006920 | Aqueous | MTQTNKTRLNADIRKKIGGMILSHFENEKTTELENF |
Ga0105746_12231581 | 3300007973 | Estuary Water | MTTSKTRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITTA |
Ga0114840_10366113 | 3300008258 | Freshwater, Plankton | MTTSKLRLNTDIRKKIGGLILSHFENEKTTERENFISA |
Ga0114363_11889132 | 3300008266 | Freshwater, Plankton | MTQTSKLRLNTDIRKKIGSLILSHFENEKTTELENFKSAK |
Ga0114880_12148632 | 3300008450 | Freshwater Lake | MTQNKTRLNTDIRKKIGGLILSHFENEKTTELENFKSAKEDI |
Ga0114880_12460752 | 3300008450 | Freshwater Lake | MTQTKTRLNTDIRKKIGGLILSHFENEKTTELENFKS |
Ga0114962_106802071 | 3300009151 | Freshwater Lake | MTQVSKPRLNTEIRKKIGGIILSHFENEQTPELEAYKS |
Ga0114980_106940051 | 3300009152 | Freshwater Lake | MTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYTTAKE |
Ga0114978_108077161 | 3300009159 | Freshwater Lake | MTQNKTRLNTDIRKKIGGIILSHFENEKTPELENFISAKED |
Ga0114981_107730021 | 3300009160 | Freshwater Lake | MTQSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDI |
Ga0114970_106620491 | 3300009163 | Freshwater Lake | MTTSKLRLNTDIRKKIGSLILSHFENEKTTERENFISAKEDITT |
Ga0105102_106336201 | 3300009165 | Freshwater Sediment | MTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYKTAKEDIT |
Ga0105104_104906032 | 3300009168 | Freshwater Sediment | MTQNKTRLNTDIRKKIGGLILSHFENEKTTELENFKSA |
Ga0114979_100494324 | 3300009180 | Freshwater Lake | MQTSKTRLNADIRKKIGGLIQSHFENEKTTELEHFI* |
Ga0114969_102270541 | 3300009181 | Freshwater Lake | MTQSKLRLNTDIRKKIGSLIQSHFENEKTTELENYTTA |
Ga0114972_106595651 | 3300009187 | Freshwater Lake | MTTSKLRLNTDIRKKIGSLILSHFENEKTTELENYT |
Ga0115546_12060471 | 3300009435 | Pelagic Marine | MTQSKLRLNTDIRKKIGGLILSHFENEKTTELENFVSAKE |
Ga0129333_112877991 | 3300010354 | Freshwater To Marine Saline Gradient | MTQSKLRLNTDIRKKIGSLILSHFENEKTTELENFKS |
Ga0129336_107477411 | 3300010370 | Freshwater To Marine Saline Gradient | MTQTTKTRLNTDIRKIIDGLILSHFEKEKTTEVENVVLADGD |
Ga0133913_122761041 | 3300010885 | Freshwater Lake | MTKTKTRLNTDLRKKIGGLILSHFENEKTTEYENFKSAKEDI |
Ga0153800_10275682 | 3300011995 | Freshwater | MTQSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTA |
Ga0153799_10987881 | 3300012012 | Freshwater | MTQNKTRLNTDIRKKIGGLILSHFENEKTPELENFISAK |
Ga0157203_10583171 | 3300012663 | Freshwater | MTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFKSAKEDITTAYNT |
Ga0157210_10442123 | 3300012665 | Freshwater | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYKTAKEDITTAYNT |
Ga0157498_10714071 | 3300012666 | Freshwater, Surface Ice | MTQSKLRLNTDIRKKIGGIILSHFENEKRIELENYTTAKEDITTAYNT |
Ga0164293_104533151 | 3300013004 | Freshwater | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAYNT |
(restricted) Ga0172372_105404561 | 3300013132 | Freshwater | MTQTKTRLNSDLRKKMGGLIQSFFETQKTLELENFKSAK |
(restricted) Ga0172375_108223812 | 3300013137 | Freshwater | MQTSKTRLNTDIRKKIGGLILSHFENEKTTELENFISAK |
(restricted) Ga0172376_104593601 | 3300014720 | Freshwater | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENF |
Ga0119960_10729132 | 3300014811 | Aquatic | MTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDITT |
Ga0181364_10365531 | 3300017701 | Freshwater Lake | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTA |
Ga0181363_10373991 | 3300017707 | Freshwater Lake | MTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFKSA |
Ga0181356_12118131 | 3300017761 | Freshwater Lake | MTQTKTRLNTDIRKKIGVLILSHFENEKTTELENYTTAKEDITTAY |
Ga0181357_13084461 | 3300017777 | Freshwater Lake | MTTNKTRLNTDIRKKIGSLILSHFENEKTTERENFISAKEDITTAYDS |
Ga0181349_10471844 | 3300017778 | Freshwater Lake | MSVNKTRLNADIRKKIGGIILSHFENEKTTELENYK |
Ga0181355_13117842 | 3300017785 | Freshwater Lake | MTTNKTRLNTDIRKKIGGLILSHFENENRIEKENFISAKE |
Ga0169931_106122372 | 3300017788 | Freshwater | MQTSKTRLNTDIRKKIGGLILSHFENEKTTELENFISA |
Ga0169931_107290851 | 3300017788 | Freshwater | MTKARLNTDIRKKIGGLILSHFENEKTTELENFISAKE |
Ga0187843_103556251 | 3300019093 | Freshwater | MTQNKTRLNADIRKKIGGIILSHFENEKTTELENYTTAKEDITT |
Ga0181361_1207822 | 3300019783 | Freshwater Lake | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITT |
Ga0181359_10448231 | 3300019784 | Freshwater Lake | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDI |
Ga0211732_11289082 | 3300020141 | Freshwater | MTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYTTA |
Ga0211726_108411871 | 3300020161 | Freshwater | MTQNKTRLNTDIRKKIGGLILSHFENEKTPELENFISAKEDITTAYNTA |
Ga0181556_12165622 | 3300020176 | Salt Marsh | MTTSKARLNTDLRKKIGGLILSHFENEKTTELENFKSAKEDID |
Ga0208091_10136001 | 3300020506 | Freshwater | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKE |
Ga0208091_10177883 | 3300020506 | Freshwater | MTQTNKTRLNADIRKKIGGMILSHFENEKTTELENFKSAKGDVVVAYDRA |
Ga0208235_10170244 | 3300020530 | Freshwater | MTQTNKTRLNTDLRKKISSLILSHFENEKTTELENFKSA |
Ga0208599_10017359 | 3300020554 | Freshwater | MSVNKTRLNADIRKKIGGIILSHFENEKTTELENYKTAKEDITTAY |
Ga0222713_108547031 | 3300021962 | Estuarine Water | MTQSKLRLNTDIRKKIGSLILSHFENEKTPALENYTTAKEDITTAYNT |
Ga0222712_103477541 | 3300021963 | Estuarine Water | MTQSKLRLNTDIRKKIGSLILSHFENEKTPALENYTTAKEDI |
Ga0222712_104762151 | 3300021963 | Estuarine Water | MTTNKTRLNTDLRKKIGGLILSHFENEKTTELENFKSAKEDI |
Ga0196881_103091 | 3300022041 | Freshwater Lake | MTQSKLRLNTNIRKKIGGLILSHFENEKTTELENYT |
Ga0181353_11133851 | 3300022179 | Freshwater Lake | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDIT |
Ga0181353_11531021 | 3300022179 | Freshwater Lake | MTTNKTRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITTAYN |
Ga0181354_11617232 | 3300022190 | Freshwater Lake | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENY |
Ga0181354_12374242 | 3300022190 | Freshwater Lake | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAYD |
Ga0181351_12650691 | 3300022407 | Freshwater Lake | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTA |
Ga0228703_10327771 | 3300022747 | Freshwater | VSMTTSKLRLNTDIRKKIGGLILSHFENEKTTEYENFISAKED |
Ga0214917_101170901 | 3300022752 | Freshwater | MTTNKTRLNTDIRKKIGSLILSHFENEKTTERENFISAKE |
Ga0214917_101200911 | 3300022752 | Freshwater | MTTSKLRLNTDIRKKIGGLILSHFENEKTTEYENFISAKEDVDSAYA |
Ga0255187_10394871 | 3300024510 | Freshwater | MTTNKTRLNTDLRKKIGGLILSHFENEKTTELENFK |
Ga0208644_13529141 | 3300025889 | Aqueous | MTQTNKTRLNADIRKKIGGLILSHFENEQTTELENFKS |
Ga0255113_10716482 | 3300027147 | Freshwater | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAYN |
Ga0255204_10479133 | 3300027157 | Freshwater | MTTSKLRLNTDIRKKIGGLILSHFENEKTTERENFISAKED |
Ga0255139_10882911 | 3300027291 | Freshwater | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDITTAYN |
Ga0255130_10727111 | 3300027335 | Freshwater | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYK |
Ga0255137_10637732 | 3300027375 | Freshwater | MTQSKLRLNTDIRKKIGGIILSHFENEKRIELENYTTAKEDITTAYN |
Ga0209247_10557951 | 3300027468 | Freshwater Lake | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAYDS |
Ga0208966_10575521 | 3300027586 | Freshwater Lentic | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKEDITTAY |
Ga0209357_11456171 | 3300027656 | Freshwater Lake | MTQSKLRLNTDIRKKIGGLILSHFENEKTTELENYTT |
Ga0209769_12332301 | 3300027679 | Freshwater Lake | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKED |
(restricted) Ga0247833_11346431 | 3300027730 | Freshwater | MTTNKTRLNTDLRKKIGGLILSHFENEKTTELENFKSAKEDITV |
Ga0209297_10330071 | 3300027733 | Freshwater Lake | MTTSKLRLNTDIRKKIGGLILSHFENEKTTERENFISAKEDITNA |
Ga0209084_13387731 | 3300027749 | Freshwater Lake | MTQSKLRLNTDIRKKIGGLILSHFENEKTPALENYKTAKEDITTAY |
Ga0209596_11496223 | 3300027754 | Freshwater Lake | MTTSKTRLNTDIRKKIGSLILSHFENEKTTERENFISAKE |
Ga0209353_102991611 | 3300027798 | Freshwater Lake | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAK |
Ga0209253_106889142 | 3300027900 | Freshwater Lake Sediment | MTTSKLRLNTDIRKKIGSLILSHFENEKTTELENFVSA |
Ga0209253_110220251 | 3300027900 | Freshwater Lake Sediment | MTTSKARLNTDIRKKIGSLILSHFENEKTTELENFVSA |
(restricted) Ga0247837_11946883 | 3300027970 | Freshwater | MTQTKTRLNSDLRKKMGGLIQSFFETQKTPELENFKSA |
Ga0209298_103247821 | 3300027973 | Freshwater Lake | MTQSKLRLNTDIRKKIGSLIQSHFENEKTTELENY |
(restricted) Ga0233418_102222002 | 3300027995 | Sediment | MTKARLNTDIRKKIGSLILSHFENEQTTEFENFKSAKEDID |
(restricted) Ga0247841_107477541 | 3300029286 | Freshwater | MTTSKARLNTDLRKKIGGLILSHFENEQTTELENFKSAKEDITVAY |
Ga0315291_109079712 | 3300031707 | Sediment | MTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISGKE |
Ga0315291_109659101 | 3300031707 | Sediment | MTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISAKEDITT |
Ga0315285_106314081 | 3300031885 | Sediment | MTQSKLRLNTDIRKKIGSLILSHFENEKTPELENFISAKEDITT |
Ga0315284_110771953 | 3300032053 | Sediment | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENY |
Ga0315902_110352902 | 3300032093 | Freshwater | MTTSKLRLNTDIRKKIGGLILSHFENEKTTELENYTTAKE |
Ga0315292_105671811 | 3300032143 | Sediment | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDITT |
Ga0315292_108290141 | 3300032143 | Sediment | MTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISAKEDITTAYNTA |
Ga0315292_110555511 | 3300032143 | Sediment | MTQSKLRLNTDIRKKIGGIILSHFENEKTTELENYTTAKEDIT |
Ga0315270_108247951 | 3300032275 | Sediment | MTTSKLRLNTDIRKKIGGLILSDFENEKTTELENYTTA |
Ga0334982_0497340_434_538 | 3300033981 | Freshwater | MTTSKLRLNTDIRKKIGGLILSHFENEKTTERENF |
Ga0334994_0205952_916_1059 | 3300033993 | Freshwater | MTQTNKTRLNTDLRKKISSLILSHFENEKTTELENFKSAKEDITNAYN |
Ga0334994_0312928_665_790 | 3300033993 | Freshwater | MTQNKTRLNTDIRKKIGSLILSHFENEKTPELENFISAKEDI |
Ga0334979_0483647_2_106 | 3300033996 | Freshwater | MTQNKTRLNTDIRKKIGGIILSHFENEKTTELENF |
Ga0334986_0123158_1419_1526 | 3300034012 | Freshwater | MTQTSKLRLNTDIRKKIGSLILSHFENEKTTELENY |
Ga0335002_0481897_1_117 | 3300034020 | Freshwater | MTQSKLRLNTDIRKKIGGIILSHFENEKRIELENYTTAK |
Ga0334987_0074576_2555_2698 | 3300034061 | Freshwater | MSVNKTRLNTDIRKKIGGLIQSHFENEKTIELEKFISEKEDITTAYNT |
Ga0334987_0157273_3_140 | 3300034061 | Freshwater | MTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYKTAKEDITTAY |
Ga0335019_0272451_1_123 | 3300034066 | Freshwater | MSVNKTRLNADIRKKIGGIILSHFENEKTTELENYKTAKED |
Ga0335028_0405346_1_120 | 3300034071 | Freshwater | MTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISAKE |
Ga0335010_0221972_1001_1135 | 3300034092 | Freshwater | MTTSKLRLNTDIRKKIGGLILSHFENEKTTQFENFVSAKGDVIVA |
Ga0335010_0225174_998_1123 | 3300034092 | Freshwater | MTQNKTRLNTDIRKKIGGIILSHFENEKTTELENYKTAKEDI |
Ga0335025_0379769_3_131 | 3300034096 | Freshwater | MTTSKLRLNADIRKKIGGLILSHFENENRIEKENFISAKEDIT |
Ga0335029_0453299_3_137 | 3300034102 | Freshwater | MTQNKTRLNADIRKKIGGLILSHFENEKTTELENYTTAKEDITTA |
Ga0335029_0635312_3_125 | 3300034102 | Freshwater | MTQSKLRLNTDIRKKIGGIILSHFENEKTPELENFISAKED |
Ga0335031_0474266_3_107 | 3300034104 | Freshwater | MTQSKLRLNTDIRKKIGGLILSHFENEKTTELENY |
Ga0335036_0124903_3_134 | 3300034106 | Freshwater | MTQNKTRLNTDLRKKISSLILSHFENEKTTELENFKSAKEDITT |
Ga0335036_0296673_3_125 | 3300034106 | Freshwater | MTQSKLRLNTDIRKKIGGLILSHFENEKTSELENFISAKED |
Ga0335066_0209144_1045_1149 | 3300034112 | Freshwater | MTTNKTRLNTDIRKKIGGLILSHFENEKTTERENF |
Ga0335066_0549137_2_136 | 3300034112 | Freshwater | MTQTSKLRLNTDIRKKIGSLILSHFENEKTTELENYKTAKEDITT |
Ga0335056_0357418_670_795 | 3300034120 | Freshwater | MTQTSKLRLNTDIRKKIGSLILSHFENEKTTELENFKSAKED |
⦗Top⦘ |