Basic Information | |
---|---|
Family ID | F063496 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 41 residues |
Representative Sequence | MSALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPIT |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 96.90 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 82.95 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (60.465 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (37.209 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.488 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.039 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 3.08% Coil/Unstructured: 96.92% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF13884 | Peptidase_S74 | 1.55 |
PF07460 | NUMOD3 | 1.55 |
PF13392 | HNH_3 | 1.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.82 % |
Unclassified | root | N/A | 13.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000231|TB_LI09_4DRAFT_10155525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300003277|JGI25908J49247_10066772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
3300003277|JGI25908J49247_10170514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300003394|JGI25907J50239_1024356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
3300003394|JGI25907J50239_1070908 | Not Available | 690 | Open in IMG/M |
3300005527|Ga0068876_10472875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300006802|Ga0070749_10018802 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4394 | Open in IMG/M |
3300006802|Ga0070749_10341616 | Not Available | 833 | Open in IMG/M |
3300006802|Ga0070749_10421220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 735 | Open in IMG/M |
3300006802|Ga0070749_10523561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 644 | Open in IMG/M |
3300006875|Ga0075473_10013473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales | 3163 | Open in IMG/M |
3300006875|Ga0075473_10295563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300007344|Ga0070745_1227151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300007538|Ga0099851_1293013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300007541|Ga0099848_1313904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300007708|Ga0102859_1136173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300008450|Ga0114880_1029177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2479 | Open in IMG/M |
3300008450|Ga0114880_1097181 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1145 | Open in IMG/M |
3300009075|Ga0105090_11040959 | Not Available | 500 | Open in IMG/M |
3300009081|Ga0105098_10010695 | All Organisms → cellular organisms → Bacteria | 3375 | Open in IMG/M |
3300009165|Ga0105102_10197795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans | 1003 | Open in IMG/M |
3300009165|Ga0105102_10261981 | Not Available | 884 | Open in IMG/M |
3300009165|Ga0105102_10865431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans | 519 | Open in IMG/M |
3300009169|Ga0105097_10052075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2205 | Open in IMG/M |
3300009169|Ga0105097_10366138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300009423|Ga0115548_1271113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300010156|Ga0068873_1000314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5657 | Open in IMG/M |
3300010368|Ga0129324_10006656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 6418 | Open in IMG/M |
3300011009|Ga0129318_10265210 | Not Available | 572 | Open in IMG/M |
3300011009|Ga0129318_10345286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300012666|Ga0157498_1068277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300013372|Ga0177922_10263317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300013372|Ga0177922_10511797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300013372|Ga0177922_10722781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300017701|Ga0181364_1008035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1801 | Open in IMG/M |
3300017716|Ga0181350_1007755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3080 | Open in IMG/M |
3300017716|Ga0181350_1027411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
3300017716|Ga0181350_1037503 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
3300017722|Ga0181347_1006073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3998 | Open in IMG/M |
3300017722|Ga0181347_1011014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2929 | Open in IMG/M |
3300017722|Ga0181347_1027947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1763 | Open in IMG/M |
3300017722|Ga0181347_1081334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
3300017722|Ga0181347_1147377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300017723|Ga0181362_1019247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
3300017723|Ga0181362_1096648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300017723|Ga0181362_1120411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300017736|Ga0181365_1018528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1753 | Open in IMG/M |
3300017736|Ga0181365_1065678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
3300017736|Ga0181365_1109603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300017761|Ga0181356_1031711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1891 | Open in IMG/M |
3300017766|Ga0181343_1034577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
3300017774|Ga0181358_1012254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3508 | Open in IMG/M |
3300017774|Ga0181358_1279172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300017778|Ga0181349_1101571 | Not Available | 1076 | Open in IMG/M |
3300017778|Ga0181349_1168405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300017778|Ga0181349_1181319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300017778|Ga0181349_1199284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300017778|Ga0181349_1220293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
3300017778|Ga0181349_1240174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300017778|Ga0181349_1278049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300017778|Ga0181349_1287248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300017778|Ga0181349_1291154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300017780|Ga0181346_1044824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1802 | Open in IMG/M |
3300017780|Ga0181346_1067298 | Not Available | 1428 | Open in IMG/M |
3300017780|Ga0181346_1095909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
3300017780|Ga0181346_1167648 | Not Available | 811 | Open in IMG/M |
3300017784|Ga0181348_1268852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300017785|Ga0181355_1208338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300017785|Ga0181355_1241243 | Not Available | 696 | Open in IMG/M |
3300017785|Ga0181355_1241376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
3300018416|Ga0181553_10569777 | Not Available | 600 | Open in IMG/M |
3300018420|Ga0181563_10467499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300019784|Ga0181359_1169251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
3300020172|Ga0211729_11084291 | Not Available | 614 | Open in IMG/M |
3300020172|Ga0211729_11451545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4080 | Open in IMG/M |
3300020183|Ga0194115_10374193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300020190|Ga0194118_10092855 | Not Available | 1868 | Open in IMG/M |
3300020220|Ga0194119_10660731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300022190|Ga0181354_1215759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300022190|Ga0181354_1233480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300022198|Ga0196905_1187749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300022407|Ga0181351_1030893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2278 | Open in IMG/M |
3300022407|Ga0181351_1230707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300024348|Ga0244776_10449002 | Not Available | 844 | Open in IMG/M |
3300024352|Ga0255142_1000094 | Not Available | 34776 | Open in IMG/M |
3300025732|Ga0208784_1031346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1689 | Open in IMG/M |
3300025889|Ga0208644_1018053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4532 | Open in IMG/M |
3300025889|Ga0208644_1271208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300026572|Ga0255270_1072682 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 870 | Open in IMG/M |
3300027693|Ga0209704_1040667 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
3300027721|Ga0209492_1052771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1434 | Open in IMG/M |
3300027721|Ga0209492_1261290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 584 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1239277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1195040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300027743|Ga0209593_10144806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300027743|Ga0209593_10242122 | Not Available | 628 | Open in IMG/M |
3300027805|Ga0209229_10360582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300027808|Ga0209354_10298820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300027899|Ga0209668_10251244 | Not Available | 1120 | Open in IMG/M |
3300027900|Ga0209253_10034265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4247 | Open in IMG/M |
3300027956|Ga0209820_1012740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2090 | Open in IMG/M |
3300027956|Ga0209820_1012905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2079 | Open in IMG/M |
3300027972|Ga0209079_10027368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1902 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1164481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300028025|Ga0247723_1093725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pseudorhodoferax → unclassified Pseudorhodoferax → Pseudorhodoferax sp. Leaf274 | 768 | Open in IMG/M |
(restricted) 3300028044|Ga0247838_1091314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1310 | Open in IMG/M |
(restricted) 3300028114|Ga0247835_1027963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2841 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1104232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
(restricted) 3300028557|Ga0247832_1288550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1018527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5186 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1098102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1344 | Open in IMG/M |
3300031566|Ga0307378_10226275 | Not Available | 1818 | Open in IMG/M |
3300031746|Ga0315293_10637820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300031772|Ga0315288_10493601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
3300031857|Ga0315909_10304780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1189 | Open in IMG/M |
3300031951|Ga0315904_10392575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1260 | Open in IMG/M |
3300031952|Ga0315294_10272184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1642 | Open in IMG/M |
3300031997|Ga0315278_10277806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1730 | Open in IMG/M |
3300032092|Ga0315905_10292517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
3300032092|Ga0315905_11476455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300032116|Ga0315903_10321362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1296 | Open in IMG/M |
3300032118|Ga0315277_10336557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1574 | Open in IMG/M |
3300032177|Ga0315276_10280769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1767 | Open in IMG/M |
3300033418|Ga0316625_100722392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
3300033995|Ga0335003_0021095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3503 | Open in IMG/M |
3300034013|Ga0334991_0131905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
3300034073|Ga0310130_0080126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
3300034105|Ga0335035_0294462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300034283|Ga0335007_0030165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4262 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 37.21% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 11.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.08% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.08% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.88% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.88% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.33% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.55% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.55% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.55% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.55% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.78% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.78% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.78% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.78% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.78% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
3300010156 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB_LI09_4DRAFT_101555252 | 3300000231 | Groundwater | MSALSVSPPFPIFTDKDGLPLESGYIWIGTVNLDP |
JGI25908J49247_100667721 | 3300003277 | Freshwater Lake | MSAISVEPPYPAFADADGQPLEDGYIWIGSANLYPITNPIAAF |
JGI25908J49247_101705142 | 3300003277 | Freshwater Lake | MSAPSIKPPYPAFAGADGQPLENGYIWIGTVNLNPQVNPIS |
JGI25907J50239_10243562 | 3300003394 | Freshwater Lake | MSAISVEPPYPAFADADGQPLEDGYIWIGSANLYPITNPIAAFFNAAMTTAAVQ |
JGI25907J50239_10709082 | 3300003394 | Freshwater Lake | MAATSVEPPFAAFADLDGQALEDGYINVGVANLNPITNPI |
Ga0068876_104728752 | 3300005527 | Freshwater Lake | MSSLSVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIVVYFNPA |
Ga0070749_100188021 | 3300006802 | Aqueous | MSALSVQPTFPIFTDVDGQPLEDGYIWIGTVNLPAQ |
Ga0070749_103416161 | 3300006802 | Aqueous | MTTLSIQPPFPLLTDIDGQPLEDGYIWIGVANLPPI |
Ga0070749_104212202 | 3300006802 | Aqueous | MTALSIQPPYPLLTDIDGQPLEDGYIWIGVANLPPIG |
Ga0070749_105235612 | 3300006802 | Aqueous | MSALSVQPTFPIFTDVDGQPLEDGYIWIGTVNLPAQTNPI |
Ga0075473_100134733 | 3300006875 | Aqueous | MPALSINVPFPVFQDRDGQPLDNGYVYIGTPYLDPQTN |
Ga0075473_102955632 | 3300006875 | Aqueous | MSSLSINSPFFIFSDRDGKPLDNGYIWIGTANLDPQT |
Ga0070745_12271512 | 3300007344 | Aqueous | MSALSVQPTFPIFTDVDGQPLEDGYIWIGTANLDPQTNP |
Ga0099851_12930131 | 3300007538 | Aqueous | MSELSIQPTYPIFTETDGQPLEDGYIWIGQVNLDPQVNQINVYF |
Ga0099848_13139042 | 3300007541 | Aqueous | MPALSINVPFPVFQDRDGQPLDNGYVYIGTPYLDPQT |
Ga0102859_11361732 | 3300007708 | Estuarine | MAALSIQVPYPVFYDRDGQPLDNGNIYIGVANLDP |
Ga0114880_10291773 | 3300008450 | Freshwater Lake | MSSLSVEPPYPAFADADGQPLEDGYIWIGAANLNPITNPIVVYFN |
Ga0114880_10971811 | 3300008450 | Freshwater Lake | MSSLSVESPYPAFADADGQPLEDGYIWIGAANLNPITNPIVVYFN |
Ga0105090_110409592 | 3300009075 | Freshwater Sediment | MSTIEVQPPYPAFAGTDGLPLENGYIWIGVVNLSPQVNPIAV |
Ga0105098_100106951 | 3300009081 | Freshwater Sediment | MSTVSVPAPYPAFAGADGQPLEDGYIWIGTAGLPPIGNAINVYWDAAQ |
Ga0105102_101977953 | 3300009165 | Freshwater Sediment | MSALSISAPFPIFTDIDGQPLEDGYVFIGTANLNPI |
Ga0105102_102619811 | 3300009165 | Freshwater Sediment | MTALSIQPPYPLLTDIDGQPLEDGYIWIGVANLPPIGNPIAV |
Ga0105102_108654312 | 3300009165 | Freshwater Sediment | MTALSVQSPFPTITDIDGQPLEDGYIWIGVANLPPIG |
Ga0105097_100520752 | 3300009169 | Freshwater Sediment | MTALSIQPPFPIITDIDGQPLEDGYIWIGVANLPPIG |
Ga0105097_103661381 | 3300009169 | Freshwater Sediment | MTALSIQPPYPTITDIDGQPLEDGYIWIGVANLPP |
Ga0115548_12711132 | 3300009423 | Pelagic Marine | MSALSIQVPFPVFQDRDGQPLDNGYVWLGTSSLNPQTNPVVA |
Ga0068873_10003148 | 3300010156 | Freshwater Lake | MSALSIQPTYPIFSETDGQPLEDGYIWIGTVNLDPQ |
Ga0129324_100066568 | 3300010368 | Freshwater To Marine Saline Gradient | MSALSIQPTFPIFTDMDGLPLENGYIWIGITNLDP |
Ga0129318_102652101 | 3300011009 | Freshwater To Marine Saline Gradient | MAALSIQLPFPVFTDADGQPVDGGYIWIGQANKDPR |
Ga0129318_103452862 | 3300011009 | Freshwater To Marine Saline Gradient | MSALSIRPPYSAFAGADGQPLDDGYIWIGTANLSP |
Ga0157498_10682772 | 3300012666 | Freshwater, Surface Ice | MSALSIQPPYPAFAGADGQPLENGYIWIGTANLDPQTN |
Ga0177922_102633171 | 3300013372 | Freshwater | MSALSVEPPFPAFADAAGQPLDDGYIWIGTVNLNPITN |
Ga0177922_105117971 | 3300013372 | Freshwater | MSALSINPPYPAFAGADGLPLENGYIWIGVVNLNP |
Ga0177922_107227811 | 3300013372 | Freshwater | MSALSVEPPFPAFADADGQPLDDGYIWIGTVNLNPITNPIVAYW |
Ga0181364_10080351 | 3300017701 | Freshwater Lake | MSAISVEPPYPAFADADGQPLEDGYIWIGTVNLNPIINPIAVFFNSALTIAAV |
Ga0181350_10077553 | 3300017716 | Freshwater Lake | MSALSINPPYPAFAGADGLPLENGYIWIGVVNLNPVVNPIEVYW |
Ga0181350_10274112 | 3300017716 | Freshwater Lake | MSALSVEPPYPAFADADGQPLDDGYILIGTVNLNP |
Ga0181350_10375032 | 3300017716 | Freshwater Lake | MSALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYWNSAQTITAV |
Ga0181347_10060731 | 3300017722 | Freshwater Lake | MSAISVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYWDSLLTITA |
Ga0181347_10110143 | 3300017722 | Freshwater Lake | MTALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYWDS |
Ga0181347_10279472 | 3300017722 | Freshwater Lake | MSALSVQPPYPAFADASGQPLDDGYIWIGTVNLNPITNPI |
Ga0181347_10813342 | 3300017722 | Freshwater Lake | MSSISVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPI |
Ga0181347_11473772 | 3300017722 | Freshwater Lake | MSALSVEPPYPAFADADGQPLDDGYILIGTVNLNPITNPIDVYFDSALTVA |
Ga0181362_10192472 | 3300017723 | Freshwater Lake | MSSLSIQIPFPIFTGADGMPLEDGFISIGVANLNPITNPIPVFFDADLTITAA |
Ga0181362_10966481 | 3300017723 | Freshwater Lake | MSALSVEAPYPAFAGTDGQPLEDGFINVGVANLNPITNPIAA |
Ga0181362_11204111 | 3300017723 | Freshwater Lake | MSALSIQPPYPAFAGIDGQPLQNGYIWVGTVNLNPQVNPITV |
Ga0181365_10185281 | 3300017736 | Freshwater Lake | MSALSVEPPYPAFAEADGQPLEDGYIWIGTVNLNPITNPIAAYWNSALTISA |
Ga0181365_10656781 | 3300017736 | Freshwater Lake | MSALSVQVPFPVFQDRDGQPLDNGYVWIGTANPSIPYLF |
Ga0181365_11096031 | 3300017736 | Freshwater Lake | MSQSVEAPYPAFADIDGQPLEDGYINIGAANLNPITNPIT |
Ga0181356_10317111 | 3300017761 | Freshwater Lake | MSALSVEPPYPAFAEADGQPLEDGYIWIGTVNLNPITNPIAAYWDSVLTI |
Ga0181343_10345772 | 3300017766 | Freshwater Lake | MSTIEVQPPYPAFAGADGQPLENGYIWIGAANLSPQ |
Ga0181358_10122541 | 3300017774 | Freshwater Lake | MSALSVEAPYPAFAGTDGQPLEDGFINVGVANLNPVTNPI |
Ga0181358_12791721 | 3300017774 | Freshwater Lake | MSALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPIT |
Ga0181349_11015711 | 3300017778 | Freshwater Lake | MSALSISPPYPAFAGADGLPLENGYILIGVVNLNP |
Ga0181349_11684051 | 3300017778 | Freshwater Lake | MSTISVEPPYPAFADADGQPLEDGYIWIGTINLNPI |
Ga0181349_11813192 | 3300017778 | Freshwater Lake | MSALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYW |
Ga0181349_11992841 | 3300017778 | Freshwater Lake | MSALSIQVPFPVFQDRDGQPLDNGYVWIGTANLNPQTNP |
Ga0181349_12202932 | 3300017778 | Freshwater Lake | MSALSVQPPYPAFAEADGQPLEDGYIWIGTVNLNPITNPIAAYW |
Ga0181349_12401741 | 3300017778 | Freshwater Lake | MSAISVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIATFFNAAMTTVAVQ |
Ga0181349_12780492 | 3300017778 | Freshwater Lake | MPALSVEPPFPAFADADGQPLEDGYILIGTVNLNPV |
Ga0181349_12872482 | 3300017778 | Freshwater Lake | MSALSVEPPYPAFADADGQPLDDGYIWIGTVNLNPITNPIVAYWDS |
Ga0181349_12911541 | 3300017778 | Freshwater Lake | MSSLSVDPPYPAFADADGQPLEDGYIWIGTANLNPITNPIVAYFNS |
Ga0181346_10448242 | 3300017780 | Freshwater Lake | MSALSVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIV |
Ga0181346_10672982 | 3300017780 | Freshwater Lake | MSAVTIKSPFPIFTDADGTPLENGYIYIGVANLNP |
Ga0181346_10959091 | 3300017780 | Freshwater Lake | MSALSINPPYPAFAGADGLPLENGYILIGVVNLNPVVNPIA |
Ga0181346_11676482 | 3300017780 | Freshwater Lake | MSALSIQVPFPVFQDRDGQPLDNGYVFLGVANLNPQTN |
Ga0181348_12688522 | 3300017784 | Freshwater Lake | MSALSIQVPFPVFQDRDGQPLDNGYVWIGTANLNPQ |
Ga0181355_12083381 | 3300017785 | Freshwater Lake | MSQSVESPYAAFADFDGQPLEDGYINIGVANLNPITN |
Ga0181355_12412431 | 3300017785 | Freshwater Lake | MTALSVQPTFPIFTDIDGHPLESGYIWIGTTILNPITNP |
Ga0181355_12413762 | 3300017785 | Freshwater Lake | MSAVTIEPPFPIFTDSDGAPLENGYIYIGVANLNPVTNPLAT |
Ga0181553_105697771 | 3300018416 | Salt Marsh | MSALSIQPTYPIFTDIDGQPLEDGFVWIGQINLDPQVN |
Ga0181563_104674992 | 3300018420 | Salt Marsh | MSSLSIQPTYPIFTDIDGQPLEDGYVWIGQANLDPQ |
Ga0181359_11692511 | 3300019784 | Freshwater Lake | MTALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYWDSV |
Ga0211729_110842912 | 3300020172 | Freshwater | MPTLSIQPPYPAFAGIDGLPLENGYIWIGTVNLNPQ |
Ga0211729_114515451 | 3300020172 | Freshwater | MSALSVEPPYPAFAEADGQPLEDGYIWIGTVNLNPITNPIAAYW |
Ga0194115_103741931 | 3300020183 | Freshwater Lake | MSALSIQPPFPVFTDLDGQPLEDGYIYIGLANLPAVT |
Ga0194118_100928551 | 3300020190 | Freshwater Lake | MSTQSIKPPFPLFCDRDGQPLEDGYIWIGVAGLPP |
Ga0194119_106607311 | 3300020220 | Freshwater Lake | MSALSVEVPFPVFYDRSGEPLENGYVWIGQANLNPQT |
Ga0181354_12157592 | 3300022190 | Freshwater Lake | MSALSVEPPYPAFADADGQPLDDGYIWIGTVNLNPITNPIV |
Ga0181354_12334801 | 3300022190 | Freshwater Lake | MSALSVQVPFPVFQDRDGQPLDNGYVWIGTANLNP |
Ga0196905_11877491 | 3300022198 | Aqueous | MSELSIQPTYPIFTETDGQPLEDGYIWIGQVNLDPQVNQINVYFD |
Ga0181351_10308933 | 3300022407 | Freshwater Lake | MSALSVEPPYPAFADADGQPLDDGYILIGTVNLNPITNPIDV |
Ga0181351_12307072 | 3300022407 | Freshwater Lake | MSALSVEPPFPAFADASGQPLEDGYIWIGTVNLNPITNPIVAYWDS |
Ga0244776_104490021 | 3300024348 | Estuarine | MTALSIQPTFPTFTDSDGTALENGFIWIGVAGSDP |
Ga0255142_100009461 | 3300024352 | Freshwater | MSALSIQPTYPIFTDIDGQPLEGGFVWIGQENLDPQVNPDKATLKRL |
Ga0208784_10313462 | 3300025732 | Aqueous | MPALSINVPFPVFQDRDGQPLDNGYVYIGTPYLDPQ |
Ga0208644_10180531 | 3300025889 | Aqueous | MTALSIQPPYPLLTDIDGQPLEDGYIWIGVANLPPIGN |
Ga0208644_12712081 | 3300025889 | Aqueous | MSALSVQPTFPIFTDVDGQPLEDGYIWIGTVNLPA |
Ga0255270_10726822 | 3300026572 | Freshwater | MSALSIQPTYPIFTDIDGQPLEGGFVWIGQENLDPQVNPI |
Ga0209704_10406671 | 3300027693 | Freshwater Sediment | MSALSIQPPYPAFAGADGLPLENGYIWIGTVNLNPQV |
Ga0209492_10527712 | 3300027721 | Freshwater Sediment | MTALSIQPPYPTITDIDGQPLEDGYIWIGVANLPPI |
Ga0209492_12612901 | 3300027721 | Freshwater Sediment | MSALSINPPYPLFPDIDGQPLENGFVWIGAVNLDPQSNPI |
(restricted) Ga0247836_12392771 | 3300027728 | Freshwater | MSALSVEPPFPAFAGADGQPLDDGYIWIGTVNLNPIT |
(restricted) Ga0247833_11950402 | 3300027730 | Freshwater | MSALSVEPPFPAFADADGQPLEDGYIWIGTVNLNPITNPIVAFFDA |
Ga0209593_101448062 | 3300027743 | Freshwater Sediment | MTALSIQPPFPIITDIDGQPLEDGYIWIGVANLPP |
Ga0209593_102421221 | 3300027743 | Freshwater Sediment | MTALSIQPPFPTIPDIDGQPLEDGYIWIGVANLPPIGNPIA |
Ga0209229_103605821 | 3300027805 | Freshwater And Sediment | MSTVSVPAPYPAFAGADGQPLEDGYIWIGTAGLPPIGNSINVYWDAAQTLAA |
Ga0209354_102988201 | 3300027808 | Freshwater Lake | MSALSVEPPYPAFADADGQPLDDGYILIGTVNLNPITNPIDVYFDSALT |
Ga0209668_102512441 | 3300027899 | Freshwater Lake Sediment | MPATSIQSPFPIFTDIDGQPLEQGQVWLGTAGNNPISSP |
Ga0209253_100342654 | 3300027900 | Freshwater Lake Sediment | MTALSIQPPFPIITDIDGQPLEDGYIWIGTAGLNPIGNPISV |
Ga0209820_10127401 | 3300027956 | Freshwater Sediment | MSTVSVPAPYPAFAGADGQPLEDGYIWIGTAGLPPIGNAINVYW |
Ga0209820_10129051 | 3300027956 | Freshwater Sediment | MTALSIQPPFPTITDIDGQPLEDGYIWIGVANLPPIG |
Ga0209079_100273681 | 3300027972 | Freshwater Sediment | MTALSIQPPFPTIPDIDGQPLEDGYIWIGVANLPPIGNP |
(restricted) Ga0247834_11644812 | 3300027977 | Freshwater | MSALSIQVPFPVFQDRDGQPLDNGYVWIGTANLNPQT |
Ga0247723_10937251 | 3300028025 | Deep Subsurface Sediment | MSALSIQAPYPAFAGTDGQPLENGYIWIGTVNLNPQ |
(restricted) Ga0247838_10913142 | 3300028044 | Freshwater | MSALSVEPPYPAFADADGQPLENGYIWIGTVNLNPITNPIVAY |
(restricted) Ga0247835_10279631 | 3300028114 | Freshwater | MSALSVEPPYPAFADADGQPLENGYIWIGTVNLNPITNPIVAYFDS |
(restricted) Ga0247839_11042321 | 3300028553 | Freshwater | MSALSVEPPFPAFAGADGQPLDDGYIWIGTVNLNPITN |
(restricted) Ga0247832_12885502 | 3300028557 | Freshwater | MSALSVEPPFPAFAGADGQPLEDGFINVGVVNLNPITNPIAAF |
(restricted) Ga0247831_10185271 | 3300028559 | Freshwater | MSALSVEPPYPAFAGADGQPLDDGYIWIGTVNLNPITNPIVAYFDSALTITAVQ |
(restricted) Ga0247843_10981021 | 3300028569 | Freshwater | MSALSIQPTFPIFTETDGQPLENGYIWIGVANLDP |
Ga0307378_102262751 | 3300031566 | Soil | MSATSISPPFPIFSDSDGQPLENGYIWIGTANLNPQV |
Ga0315293_106378202 | 3300031746 | Sediment | MSALSIRPPYPAFAGADGQPLDDGYIWIGTANLSPQVNQIGVYWDPS |
Ga0315288_104936011 | 3300031772 | Sediment | MSALSIRPPYPAFAGADGQPLDDGYIWIGTANLSPQV |
Ga0315909_103047801 | 3300031857 | Freshwater | MSALSIQPPYPAFAGADGLPLENGYIWVGTVNLNPQTN |
Ga0315904_103925751 | 3300031951 | Freshwater | MSALSIQPTYPIFSETDGQPLEDGYIWIGTVNLDPQV |
Ga0315294_102721841 | 3300031952 | Sediment | MSALSVEAPYPAFAGTDGQPLEDGFINVGVVNLNPIT |
Ga0315278_102778062 | 3300031997 | Sediment | MSALSIRPPYPAFAGDDGQPLDDGYIWIGTANLSPQVN |
Ga0315905_102925171 | 3300032092 | Freshwater | MSALSVEPPYPAFADADGQPLDDGYILIGTVNLNPITNPIDVYFDSPLTIA |
Ga0315905_114764551 | 3300032092 | Freshwater | MSSLSVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIVVYFNPALTITAV |
Ga0315903_103213621 | 3300032116 | Freshwater | MSSLSVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIVVYFNPALTI |
Ga0315277_103365571 | 3300032118 | Sediment | MSALSIQPPYPAFAGADGQPLDDGYIWIGTANLSPQVNQ |
Ga0315276_102807691 | 3300032177 | Sediment | MTALSIQPPFPVFSDSDGQPLDNGYIWIGTVNLAPQTNPIS |
Ga0316625_1007223921 | 3300033418 | Soil | MTALSIQPTFPIFTDIDGQPLEDGYVFIGTANLPPITNP |
Ga0335003_0021095_1_120 | 3300033995 | Freshwater | MAALSIQVPYPVFYDRDGQPLDNGNIYIGVANLDPVTNPL |
Ga0334991_0131905_3_131 | 3300034013 | Freshwater | MTVLLVQPPYPLFTDTAGQPLDNGYVWVGEANLAPQTNPIVVY |
Ga0310130_0080126_862_972 | 3300034073 | Fracking Water | MSALSIQPTFPIFTDIDGQPLEDGFIWIGQANLDPQV |
Ga0335035_0294462_1_168 | 3300034105 | Freshwater | MSTLSVQPPYPAFADADGQPLEDGYIWIGAVNLNPITNPIVAYWDAALTITAVQPI |
Ga0335007_0030165_4151_4261 | 3300034283 | Freshwater | MSAIQIETPFPIFNDIDGQPLENGYIFVGVVNLNPIT |
⦗Top⦘ |