NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063496

Metagenome / Metatranscriptome Family F063496

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063496
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 41 residues
Representative Sequence MSALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPIT
Number of Associated Samples 84
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 96.90 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 82.95 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (60.465 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(37.209 % of family members)
Environment Ontology (ENVO) Unclassified
(53.488 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(55.039 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 3.08%    Coil/Unstructured: 96.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF13884Peptidase_S74 1.55
PF07460NUMOD3 1.55
PF13392HNH_3 1.55



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.82 %
UnclassifiedrootN/A13.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000231|TB_LI09_4DRAFT_10155525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300003277|JGI25908J49247_10066772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage907Open in IMG/M
3300003277|JGI25908J49247_10170514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300003394|JGI25907J50239_1024356All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1325Open in IMG/M
3300003394|JGI25907J50239_1070908Not Available690Open in IMG/M
3300005527|Ga0068876_10472875All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage691Open in IMG/M
3300006802|Ga0070749_10018802All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon4394Open in IMG/M
3300006802|Ga0070749_10341616Not Available833Open in IMG/M
3300006802|Ga0070749_10421220All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales735Open in IMG/M
3300006802|Ga0070749_10523561All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales644Open in IMG/M
3300006875|Ga0075473_10013473All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales3163Open in IMG/M
3300006875|Ga0075473_10295563All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300007344|Ga0070745_1227151All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300007538|Ga0099851_1293013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300007541|Ga0099848_1313904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300007708|Ga0102859_1136173All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage717Open in IMG/M
3300008450|Ga0114880_1029177All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2479Open in IMG/M
3300008450|Ga0114880_1097181All Organisms → cellular organisms → Bacteria → Proteobacteria1145Open in IMG/M
3300009075|Ga0105090_11040959Not Available500Open in IMG/M
3300009081|Ga0105098_10010695All Organisms → cellular organisms → Bacteria3375Open in IMG/M
3300009165|Ga0105102_10197795All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans1003Open in IMG/M
3300009165|Ga0105102_10261981Not Available884Open in IMG/M
3300009165|Ga0105102_10865431All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter xylosoxidans519Open in IMG/M
3300009169|Ga0105097_10052075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2205Open in IMG/M
3300009169|Ga0105097_10366138All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
3300009423|Ga0115548_1271113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300010156|Ga0068873_1000314All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5657Open in IMG/M
3300010368|Ga0129324_10006656All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae6418Open in IMG/M
3300011009|Ga0129318_10265210Not Available572Open in IMG/M
3300011009|Ga0129318_10345286All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300012666|Ga0157498_1068277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300013372|Ga0177922_10263317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300013372|Ga0177922_10511797All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage589Open in IMG/M
3300013372|Ga0177922_10722781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300017701|Ga0181364_1008035All Organisms → cellular organisms → Bacteria → Proteobacteria1801Open in IMG/M
3300017716|Ga0181350_1007755All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3080Open in IMG/M
3300017716|Ga0181350_1027411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1577Open in IMG/M
3300017716|Ga0181350_1037503All Organisms → Viruses → Predicted Viral1319Open in IMG/M
3300017722|Ga0181347_1006073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3998Open in IMG/M
3300017722|Ga0181347_1011014All Organisms → cellular organisms → Bacteria → Proteobacteria2929Open in IMG/M
3300017722|Ga0181347_1027947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1763Open in IMG/M
3300017722|Ga0181347_1081334All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage944Open in IMG/M
3300017722|Ga0181347_1147377All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300017723|Ga0181362_1019247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1466Open in IMG/M
3300017723|Ga0181362_1096648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage589Open in IMG/M
3300017723|Ga0181362_1120411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300017736|Ga0181365_1018528All Organisms → cellular organisms → Bacteria → Proteobacteria1753Open in IMG/M
3300017736|Ga0181365_1065678All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage897Open in IMG/M
3300017736|Ga0181365_1109603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage666Open in IMG/M
3300017761|Ga0181356_1031711All Organisms → cellular organisms → Bacteria → Proteobacteria1891Open in IMG/M
3300017766|Ga0181343_1034577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1519Open in IMG/M
3300017774|Ga0181358_1012254All Organisms → cellular organisms → Bacteria → Proteobacteria3508Open in IMG/M
3300017774|Ga0181358_1279172All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300017778|Ga0181349_1101571Not Available1076Open in IMG/M
3300017778|Ga0181349_1168405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage776Open in IMG/M
3300017778|Ga0181349_1181319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300017778|Ga0181349_1199284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage692Open in IMG/M
3300017778|Ga0181349_1220293All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300017778|Ga0181349_1240174All Organisms → cellular organisms → Bacteria → Proteobacteria609Open in IMG/M
3300017778|Ga0181349_1278049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300017778|Ga0181349_1287248All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300017778|Ga0181349_1291154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300017780|Ga0181346_1044824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1802Open in IMG/M
3300017780|Ga0181346_1067298Not Available1428Open in IMG/M
3300017780|Ga0181346_1095909All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1155Open in IMG/M
3300017780|Ga0181346_1167648Not Available811Open in IMG/M
3300017784|Ga0181348_1268852All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300017785|Ga0181355_1208338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300017785|Ga0181355_1241243Not Available696Open in IMG/M
3300017785|Ga0181355_1241376All Organisms → cellular organisms → Bacteria → Proteobacteria695Open in IMG/M
3300018416|Ga0181553_10569777Not Available600Open in IMG/M
3300018420|Ga0181563_10467499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300019784|Ga0181359_1169251All Organisms → cellular organisms → Bacteria → Proteobacteria732Open in IMG/M
3300020172|Ga0211729_11084291Not Available614Open in IMG/M
3300020172|Ga0211729_11451545All Organisms → cellular organisms → Bacteria → Proteobacteria4080Open in IMG/M
3300020183|Ga0194115_10374193All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300020190|Ga0194118_10092855Not Available1868Open in IMG/M
3300020220|Ga0194119_10660731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300022190|Ga0181354_1215759All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300022190|Ga0181354_1233480All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300022198|Ga0196905_1187749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300022407|Ga0181351_1030893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2278Open in IMG/M
3300022407|Ga0181351_1230707All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300024348|Ga0244776_10449002Not Available844Open in IMG/M
3300024352|Ga0255142_1000094Not Available34776Open in IMG/M
3300025732|Ga0208784_1031346All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1689Open in IMG/M
3300025889|Ga0208644_1018053All Organisms → cellular organisms → Bacteria → Proteobacteria4532Open in IMG/M
3300025889|Ga0208644_1271208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage690Open in IMG/M
3300026572|Ga0255270_1072682All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon870Open in IMG/M
3300027693|Ga0209704_1040667All Organisms → Viruses → Predicted Viral1255Open in IMG/M
3300027721|Ga0209492_1052771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1434Open in IMG/M
3300027721|Ga0209492_1261290All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales584Open in IMG/M
(restricted) 3300027728|Ga0247836_1239277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
(restricted) 3300027730|Ga0247833_1195040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300027743|Ga0209593_10144806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300027743|Ga0209593_10242122Not Available628Open in IMG/M
3300027805|Ga0209229_10360582All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300027808|Ga0209354_10298820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300027899|Ga0209668_10251244Not Available1120Open in IMG/M
3300027900|Ga0209253_10034265All Organisms → cellular organisms → Bacteria → Proteobacteria4247Open in IMG/M
3300027956|Ga0209820_1012740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2090Open in IMG/M
3300027956|Ga0209820_1012905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2079Open in IMG/M
3300027972|Ga0209079_10027368All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1902Open in IMG/M
(restricted) 3300027977|Ga0247834_1164481All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300028025|Ga0247723_1093725All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pseudorhodoferax → unclassified Pseudorhodoferax → Pseudorhodoferax sp. Leaf274768Open in IMG/M
(restricted) 3300028044|Ga0247838_1091314All Organisms → cellular organisms → Bacteria → Proteobacteria1310Open in IMG/M
(restricted) 3300028114|Ga0247835_1027963All Organisms → cellular organisms → Bacteria → Proteobacteria2841Open in IMG/M
(restricted) 3300028553|Ga0247839_1104232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1341Open in IMG/M
(restricted) 3300028557|Ga0247832_1288550All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
(restricted) 3300028559|Ga0247831_1018527All Organisms → cellular organisms → Bacteria → Proteobacteria5186Open in IMG/M
(restricted) 3300028569|Ga0247843_1098102All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1344Open in IMG/M
3300031566|Ga0307378_10226275Not Available1818Open in IMG/M
3300031746|Ga0315293_10637820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage801Open in IMG/M
3300031772|Ga0315288_10493601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1210Open in IMG/M
3300031857|Ga0315909_10304780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1189Open in IMG/M
3300031951|Ga0315904_10392575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1260Open in IMG/M
3300031952|Ga0315294_10272184All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1642Open in IMG/M
3300031997|Ga0315278_10277806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1730Open in IMG/M
3300032092|Ga0315905_10292517All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1566Open in IMG/M
3300032092|Ga0315905_11476455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage535Open in IMG/M
3300032116|Ga0315903_10321362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1296Open in IMG/M
3300032118|Ga0315277_10336557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1574Open in IMG/M
3300032177|Ga0315276_10280769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1767Open in IMG/M
3300033418|Ga0316625_100722392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage840Open in IMG/M
3300033995|Ga0335003_0021095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3503Open in IMG/M
3300034013|Ga0334991_0131905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1159Open in IMG/M
3300034073|Ga0310130_0080126All Organisms → cellular organisms → Bacteria → Proteobacteria974Open in IMG/M
3300034105|Ga0335035_0294462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage960Open in IMG/M
3300034283|Ga0335007_0030165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4262Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake37.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment11.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.08%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.08%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.88%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.33%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.55%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.55%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.55%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.55%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.78%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.78%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater0.78%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.78%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.78%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000231Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300010156Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026572Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028044 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15mEnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TB_LI09_4DRAFT_1015552523300000231GroundwaterMSALSVSPPFPIFTDKDGLPLESGYIWIGTVNLDP
JGI25908J49247_1006677213300003277Freshwater LakeMSAISVEPPYPAFADADGQPLEDGYIWIGSANLYPITNPIAAF
JGI25908J49247_1017051423300003277Freshwater LakeMSAPSIKPPYPAFAGADGQPLENGYIWIGTVNLNPQVNPIS
JGI25907J50239_102435623300003394Freshwater LakeMSAISVEPPYPAFADADGQPLEDGYIWIGSANLYPITNPIAAFFNAAMTTAAVQ
JGI25907J50239_107090823300003394Freshwater LakeMAATSVEPPFAAFADLDGQALEDGYINVGVANLNPITNPI
Ga0068876_1047287523300005527Freshwater LakeMSSLSVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIVVYFNPA
Ga0070749_1001880213300006802AqueousMSALSVQPTFPIFTDVDGQPLEDGYIWIGTVNLPAQ
Ga0070749_1034161613300006802AqueousMTTLSIQPPFPLLTDIDGQPLEDGYIWIGVANLPPI
Ga0070749_1042122023300006802AqueousMTALSIQPPYPLLTDIDGQPLEDGYIWIGVANLPPIG
Ga0070749_1052356123300006802AqueousMSALSVQPTFPIFTDVDGQPLEDGYIWIGTVNLPAQTNPI
Ga0075473_1001347333300006875AqueousMPALSINVPFPVFQDRDGQPLDNGYVYIGTPYLDPQTN
Ga0075473_1029556323300006875AqueousMSSLSINSPFFIFSDRDGKPLDNGYIWIGTANLDPQT
Ga0070745_122715123300007344AqueousMSALSVQPTFPIFTDVDGQPLEDGYIWIGTANLDPQTNP
Ga0099851_129301313300007538AqueousMSELSIQPTYPIFTETDGQPLEDGYIWIGQVNLDPQVNQINVYF
Ga0099848_131390423300007541AqueousMPALSINVPFPVFQDRDGQPLDNGYVYIGTPYLDPQT
Ga0102859_113617323300007708EstuarineMAALSIQVPYPVFYDRDGQPLDNGNIYIGVANLDP
Ga0114880_102917733300008450Freshwater LakeMSSLSVEPPYPAFADADGQPLEDGYIWIGAANLNPITNPIVVYFN
Ga0114880_109718113300008450Freshwater LakeMSSLSVESPYPAFADADGQPLEDGYIWIGAANLNPITNPIVVYFN
Ga0105090_1104095923300009075Freshwater SedimentMSTIEVQPPYPAFAGTDGLPLENGYIWIGVVNLSPQVNPIAV
Ga0105098_1001069513300009081Freshwater SedimentMSTVSVPAPYPAFAGADGQPLEDGYIWIGTAGLPPIGNAINVYWDAAQ
Ga0105102_1019779533300009165Freshwater SedimentMSALSISAPFPIFTDIDGQPLEDGYVFIGTANLNPI
Ga0105102_1026198113300009165Freshwater SedimentMTALSIQPPYPLLTDIDGQPLEDGYIWIGVANLPPIGNPIAV
Ga0105102_1086543123300009165Freshwater SedimentMTALSVQSPFPTITDIDGQPLEDGYIWIGVANLPPIG
Ga0105097_1005207523300009169Freshwater SedimentMTALSIQPPFPIITDIDGQPLEDGYIWIGVANLPPIG
Ga0105097_1036613813300009169Freshwater SedimentMTALSIQPPYPTITDIDGQPLEDGYIWIGVANLPP
Ga0115548_127111323300009423Pelagic MarineMSALSIQVPFPVFQDRDGQPLDNGYVWLGTSSLNPQTNPVVA
Ga0068873_100031483300010156Freshwater LakeMSALSIQPTYPIFSETDGQPLEDGYIWIGTVNLDPQ
Ga0129324_1000665683300010368Freshwater To Marine Saline GradientMSALSIQPTFPIFTDMDGLPLENGYIWIGITNLDP
Ga0129318_1026521013300011009Freshwater To Marine Saline GradientMAALSIQLPFPVFTDADGQPVDGGYIWIGQANKDPR
Ga0129318_1034528623300011009Freshwater To Marine Saline GradientMSALSIRPPYSAFAGADGQPLDDGYIWIGTANLSP
Ga0157498_106827723300012666Freshwater, Surface IceMSALSIQPPYPAFAGADGQPLENGYIWIGTANLDPQTN
Ga0177922_1026331713300013372FreshwaterMSALSVEPPFPAFADAAGQPLDDGYIWIGTVNLNPITN
Ga0177922_1051179713300013372FreshwaterMSALSINPPYPAFAGADGLPLENGYIWIGVVNLNP
Ga0177922_1072278113300013372FreshwaterMSALSVEPPFPAFADADGQPLDDGYIWIGTVNLNPITNPIVAYW
Ga0181364_100803513300017701Freshwater LakeMSAISVEPPYPAFADADGQPLEDGYIWIGTVNLNPIINPIAVFFNSALTIAAV
Ga0181350_100775533300017716Freshwater LakeMSALSINPPYPAFAGADGLPLENGYIWIGVVNLNPVVNPIEVYW
Ga0181350_102741123300017716Freshwater LakeMSALSVEPPYPAFADADGQPLDDGYILIGTVNLNP
Ga0181350_103750323300017716Freshwater LakeMSALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYWNSAQTITAV
Ga0181347_100607313300017722Freshwater LakeMSAISVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYWDSLLTITA
Ga0181347_101101433300017722Freshwater LakeMTALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYWDS
Ga0181347_102794723300017722Freshwater LakeMSALSVQPPYPAFADASGQPLDDGYIWIGTVNLNPITNPI
Ga0181347_108133423300017722Freshwater LakeMSSISVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPI
Ga0181347_114737723300017722Freshwater LakeMSALSVEPPYPAFADADGQPLDDGYILIGTVNLNPITNPIDVYFDSALTVA
Ga0181362_101924723300017723Freshwater LakeMSSLSIQIPFPIFTGADGMPLEDGFISIGVANLNPITNPIPVFFDADLTITAA
Ga0181362_109664813300017723Freshwater LakeMSALSVEAPYPAFAGTDGQPLEDGFINVGVANLNPITNPIAA
Ga0181362_112041113300017723Freshwater LakeMSALSIQPPYPAFAGIDGQPLQNGYIWVGTVNLNPQVNPITV
Ga0181365_101852813300017736Freshwater LakeMSALSVEPPYPAFAEADGQPLEDGYIWIGTVNLNPITNPIAAYWNSALTISA
Ga0181365_106567813300017736Freshwater LakeMSALSVQVPFPVFQDRDGQPLDNGYVWIGTANPSIPYLF
Ga0181365_110960313300017736Freshwater LakeMSQSVEAPYPAFADIDGQPLEDGYINIGAANLNPITNPIT
Ga0181356_103171113300017761Freshwater LakeMSALSVEPPYPAFAEADGQPLEDGYIWIGTVNLNPITNPIAAYWDSVLTI
Ga0181343_103457723300017766Freshwater LakeMSTIEVQPPYPAFAGADGQPLENGYIWIGAANLSPQ
Ga0181358_101225413300017774Freshwater LakeMSALSVEAPYPAFAGTDGQPLEDGFINVGVANLNPVTNPI
Ga0181358_127917213300017774Freshwater LakeMSALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPIT
Ga0181349_110157113300017778Freshwater LakeMSALSISPPYPAFAGADGLPLENGYILIGVVNLNP
Ga0181349_116840513300017778Freshwater LakeMSTISVEPPYPAFADADGQPLEDGYIWIGTINLNPI
Ga0181349_118131923300017778Freshwater LakeMSALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYW
Ga0181349_119928413300017778Freshwater LakeMSALSIQVPFPVFQDRDGQPLDNGYVWIGTANLNPQTNP
Ga0181349_122029323300017778Freshwater LakeMSALSVQPPYPAFAEADGQPLEDGYIWIGTVNLNPITNPIAAYW
Ga0181349_124017413300017778Freshwater LakeMSAISVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIATFFNAAMTTVAVQ
Ga0181349_127804923300017778Freshwater LakeMPALSVEPPFPAFADADGQPLEDGYILIGTVNLNPV
Ga0181349_128724823300017778Freshwater LakeMSALSVEPPYPAFADADGQPLDDGYIWIGTVNLNPITNPIVAYWDS
Ga0181349_129115413300017778Freshwater LakeMSSLSVDPPYPAFADADGQPLEDGYIWIGTANLNPITNPIVAYFNS
Ga0181346_104482423300017780Freshwater LakeMSALSVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIV
Ga0181346_106729823300017780Freshwater LakeMSAVTIKSPFPIFTDADGTPLENGYIYIGVANLNP
Ga0181346_109590913300017780Freshwater LakeMSALSINPPYPAFAGADGLPLENGYILIGVVNLNPVVNPIA
Ga0181346_116764823300017780Freshwater LakeMSALSIQVPFPVFQDRDGQPLDNGYVFLGVANLNPQTN
Ga0181348_126885223300017784Freshwater LakeMSALSIQVPFPVFQDRDGQPLDNGYVWIGTANLNPQ
Ga0181355_120833813300017785Freshwater LakeMSQSVESPYAAFADFDGQPLEDGYINIGVANLNPITN
Ga0181355_124124313300017785Freshwater LakeMTALSVQPTFPIFTDIDGHPLESGYIWIGTTILNPITNP
Ga0181355_124137623300017785Freshwater LakeMSAVTIEPPFPIFTDSDGAPLENGYIYIGVANLNPVTNPLAT
Ga0181553_1056977713300018416Salt MarshMSALSIQPTYPIFTDIDGQPLEDGFVWIGQINLDPQVN
Ga0181563_1046749923300018420Salt MarshMSSLSIQPTYPIFTDIDGQPLEDGYVWIGQANLDPQ
Ga0181359_116925113300019784Freshwater LakeMTALSVEPPYPAFADADGQPLEDGYIWIGTVNLNPITNPIVAYWDSV
Ga0211729_1108429123300020172FreshwaterMPTLSIQPPYPAFAGIDGLPLENGYIWIGTVNLNPQ
Ga0211729_1145154513300020172FreshwaterMSALSVEPPYPAFAEADGQPLEDGYIWIGTVNLNPITNPIAAYW
Ga0194115_1037419313300020183Freshwater LakeMSALSIQPPFPVFTDLDGQPLEDGYIYIGLANLPAVT
Ga0194118_1009285513300020190Freshwater LakeMSTQSIKPPFPLFCDRDGQPLEDGYIWIGVAGLPP
Ga0194119_1066073113300020220Freshwater LakeMSALSVEVPFPVFYDRSGEPLENGYVWIGQANLNPQT
Ga0181354_121575923300022190Freshwater LakeMSALSVEPPYPAFADADGQPLDDGYIWIGTVNLNPITNPIV
Ga0181354_123348013300022190Freshwater LakeMSALSVQVPFPVFQDRDGQPLDNGYVWIGTANLNP
Ga0196905_118774913300022198AqueousMSELSIQPTYPIFTETDGQPLEDGYIWIGQVNLDPQVNQINVYFD
Ga0181351_103089333300022407Freshwater LakeMSALSVEPPYPAFADADGQPLDDGYILIGTVNLNPITNPIDV
Ga0181351_123070723300022407Freshwater LakeMSALSVEPPFPAFADASGQPLEDGYIWIGTVNLNPITNPIVAYWDS
Ga0244776_1044900213300024348EstuarineMTALSIQPTFPTFTDSDGTALENGFIWIGVAGSDP
Ga0255142_1000094613300024352FreshwaterMSALSIQPTYPIFTDIDGQPLEGGFVWIGQENLDPQVNPDKATLKRL
Ga0208784_103134623300025732AqueousMPALSINVPFPVFQDRDGQPLDNGYVYIGTPYLDPQ
Ga0208644_101805313300025889AqueousMTALSIQPPYPLLTDIDGQPLEDGYIWIGVANLPPIGN
Ga0208644_127120813300025889AqueousMSALSVQPTFPIFTDVDGQPLEDGYIWIGTVNLPA
Ga0255270_107268223300026572FreshwaterMSALSIQPTYPIFTDIDGQPLEGGFVWIGQENLDPQVNPI
Ga0209704_104066713300027693Freshwater SedimentMSALSIQPPYPAFAGADGLPLENGYIWIGTVNLNPQV
Ga0209492_105277123300027721Freshwater SedimentMTALSIQPPYPTITDIDGQPLEDGYIWIGVANLPPI
Ga0209492_126129013300027721Freshwater SedimentMSALSINPPYPLFPDIDGQPLENGFVWIGAVNLDPQSNPI
(restricted) Ga0247836_123927713300027728FreshwaterMSALSVEPPFPAFAGADGQPLDDGYIWIGTVNLNPIT
(restricted) Ga0247833_119504023300027730FreshwaterMSALSVEPPFPAFADADGQPLEDGYIWIGTVNLNPITNPIVAFFDA
Ga0209593_1014480623300027743Freshwater SedimentMTALSIQPPFPIITDIDGQPLEDGYIWIGVANLPP
Ga0209593_1024212213300027743Freshwater SedimentMTALSIQPPFPTIPDIDGQPLEDGYIWIGVANLPPIGNPIA
Ga0209229_1036058213300027805Freshwater And SedimentMSTVSVPAPYPAFAGADGQPLEDGYIWIGTAGLPPIGNSINVYWDAAQTLAA
Ga0209354_1029882013300027808Freshwater LakeMSALSVEPPYPAFADADGQPLDDGYILIGTVNLNPITNPIDVYFDSALT
Ga0209668_1025124413300027899Freshwater Lake SedimentMPATSIQSPFPIFTDIDGQPLEQGQVWLGTAGNNPISSP
Ga0209253_1003426543300027900Freshwater Lake SedimentMTALSIQPPFPIITDIDGQPLEDGYIWIGTAGLNPIGNPISV
Ga0209820_101274013300027956Freshwater SedimentMSTVSVPAPYPAFAGADGQPLEDGYIWIGTAGLPPIGNAINVYW
Ga0209820_101290513300027956Freshwater SedimentMTALSIQPPFPTITDIDGQPLEDGYIWIGVANLPPIG
Ga0209079_1002736813300027972Freshwater SedimentMTALSIQPPFPTIPDIDGQPLEDGYIWIGVANLPPIGNP
(restricted) Ga0247834_116448123300027977FreshwaterMSALSIQVPFPVFQDRDGQPLDNGYVWIGTANLNPQT
Ga0247723_109372513300028025Deep Subsurface SedimentMSALSIQAPYPAFAGTDGQPLENGYIWIGTVNLNPQ
(restricted) Ga0247838_109131423300028044FreshwaterMSALSVEPPYPAFADADGQPLENGYIWIGTVNLNPITNPIVAY
(restricted) Ga0247835_102796313300028114FreshwaterMSALSVEPPYPAFADADGQPLENGYIWIGTVNLNPITNPIVAYFDS
(restricted) Ga0247839_110423213300028553FreshwaterMSALSVEPPFPAFAGADGQPLDDGYIWIGTVNLNPITN
(restricted) Ga0247832_128855023300028557FreshwaterMSALSVEPPFPAFAGADGQPLEDGFINVGVVNLNPITNPIAAF
(restricted) Ga0247831_101852713300028559FreshwaterMSALSVEPPYPAFAGADGQPLDDGYIWIGTVNLNPITNPIVAYFDSALTITAVQ
(restricted) Ga0247843_109810213300028569FreshwaterMSALSIQPTFPIFTETDGQPLENGYIWIGVANLDP
Ga0307378_1022627513300031566SoilMSATSISPPFPIFSDSDGQPLENGYIWIGTANLNPQV
Ga0315293_1063782023300031746SedimentMSALSIRPPYPAFAGADGQPLDDGYIWIGTANLSPQVNQIGVYWDPS
Ga0315288_1049360113300031772SedimentMSALSIRPPYPAFAGADGQPLDDGYIWIGTANLSPQV
Ga0315909_1030478013300031857FreshwaterMSALSIQPPYPAFAGADGLPLENGYIWVGTVNLNPQTN
Ga0315904_1039257513300031951FreshwaterMSALSIQPTYPIFSETDGQPLEDGYIWIGTVNLDPQV
Ga0315294_1027218413300031952SedimentMSALSVEAPYPAFAGTDGQPLEDGFINVGVVNLNPIT
Ga0315278_1027780623300031997SedimentMSALSIRPPYPAFAGDDGQPLDDGYIWIGTANLSPQVN
Ga0315905_1029251713300032092FreshwaterMSALSVEPPYPAFADADGQPLDDGYILIGTVNLNPITNPIDVYFDSPLTIA
Ga0315905_1147645513300032092FreshwaterMSSLSVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIVVYFNPALTITAV
Ga0315903_1032136213300032116FreshwaterMSSLSVEPPYPAFADADGQPLEDGYIWIGTANLNPITNPIVVYFNPALTI
Ga0315277_1033655713300032118SedimentMSALSIQPPYPAFAGADGQPLDDGYIWIGTANLSPQVNQ
Ga0315276_1028076913300032177SedimentMTALSIQPPFPVFSDSDGQPLDNGYIWIGTVNLAPQTNPIS
Ga0316625_10072239213300033418SoilMTALSIQPTFPIFTDIDGQPLEDGYVFIGTANLPPITNP
Ga0335003_0021095_1_1203300033995FreshwaterMAALSIQVPYPVFYDRDGQPLDNGNIYIGVANLDPVTNPL
Ga0334991_0131905_3_1313300034013FreshwaterMTVLLVQPPYPLFTDTAGQPLDNGYVWVGEANLAPQTNPIVVY
Ga0310130_0080126_862_9723300034073Fracking WaterMSALSIQPTFPIFTDIDGQPLEDGFIWIGQANLDPQV
Ga0335035_0294462_1_1683300034105FreshwaterMSTLSVQPPYPAFADADGQPLEDGYIWIGAVNLNPITNPIVAYWDAALTITAVQPI
Ga0335007_0030165_4151_42613300034283FreshwaterMSAIQIETPFPIFNDIDGQPLENGYIFVGVVNLNPIT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.