NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F063171

Metagenome Family F063171

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063171
Family Type Metagenome
Number of Sequences 130
Average Sequence Length 75 residues
Representative Sequence MASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELNKYLNGR
Number of Associated Samples 74
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.31 %
% of genes near scaffold ends (potentially truncated) 33.85 %
% of genes from short scaffolds (< 2000 bps) 89.23 %
Associated GOLD sequencing projects 67
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.615 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(64.615 % of family members)
Environment Ontology (ENVO) Unclassified
(99.231 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(100.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.04%    β-sheet: 16.50%    Coil/Unstructured: 51.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF00581Rhodanese 6.15
PF00856SET 2.31
PF00291PALP 2.31
PF13673Acetyltransf_10 0.77



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.15 %
UnclassifiedrootN/A13.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001450|JGI24006J15134_10005955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6289Open in IMG/M
3300001450|JGI24006J15134_10028738All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2465Open in IMG/M
3300001450|JGI24006J15134_10067738All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1381Open in IMG/M
3300006735|Ga0098038_1028613All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2087Open in IMG/M
3300006735|Ga0098038_1035880All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1834Open in IMG/M
3300006735|Ga0098038_1070674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1235Open in IMG/M
3300006735|Ga0098038_1202841All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium641Open in IMG/M
3300006737|Ga0098037_1167323Not Available732Open in IMG/M
3300006737|Ga0098037_1204124All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium646Open in IMG/M
3300006754|Ga0098044_1280355All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium641Open in IMG/M
3300006922|Ga0098045_1131685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium581Open in IMG/M
3300008050|Ga0098052_1147508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium933Open in IMG/M
3300010153|Ga0098059_1182219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium821Open in IMG/M
3300012920|Ga0160423_10271644All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1170Open in IMG/M
3300013010|Ga0129327_10627547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300017704|Ga0181371_1019686All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1127Open in IMG/M
3300017704|Ga0181371_1037553All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium793Open in IMG/M
3300017705|Ga0181372_1008420All Organisms → Viruses → Predicted Viral1894Open in IMG/M
3300017705|Ga0181372_1027072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium974Open in IMG/M
3300017705|Ga0181372_1097450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300017706|Ga0181377_1003735All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4321Open in IMG/M
3300017706|Ga0181377_1012628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1988Open in IMG/M
3300017706|Ga0181377_1033156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1058Open in IMG/M
3300017706|Ga0181377_1078886All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium589Open in IMG/M
3300017708|Ga0181369_1018771All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1695Open in IMG/M
3300017709|Ga0181387_1063032All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium743Open in IMG/M
3300017710|Ga0181403_1003073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3752Open in IMG/M
3300017710|Ga0181403_1058196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium806Open in IMG/M
3300017710|Ga0181403_1082016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium670Open in IMG/M
3300017710|Ga0181403_1123890Not Available539Open in IMG/M
3300017713|Ga0181391_1004591All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3745Open in IMG/M
3300017713|Ga0181391_1040370All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1118Open in IMG/M
3300017717|Ga0181404_1063308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium923Open in IMG/M
3300017717|Ga0181404_1181511All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium503Open in IMG/M
3300017718|Ga0181375_1029417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium933Open in IMG/M
3300017719|Ga0181390_1099437Not Available780Open in IMG/M
3300017719|Ga0181390_1106039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium746Open in IMG/M
3300017720|Ga0181383_1005943All Organisms → Viruses → Predicted Viral3309Open in IMG/M
3300017720|Ga0181383_1041687All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1233Open in IMG/M
3300017724|Ga0181388_1175958Not Available507Open in IMG/M
3300017725|Ga0181398_1153477All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium545Open in IMG/M
3300017726|Ga0181381_1064056Not Available794Open in IMG/M
3300017727|Ga0181401_1131439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium620Open in IMG/M
3300017728|Ga0181419_1088526Not Available769Open in IMG/M
3300017730|Ga0181417_1103978All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium687Open in IMG/M
3300017731|Ga0181416_1027878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1326Open in IMG/M
3300017731|Ga0181416_1176927Not Available516Open in IMG/M
3300017733|Ga0181426_1029565All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1077Open in IMG/M
3300017734|Ga0187222_1020009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1627Open in IMG/M
3300017734|Ga0187222_1061759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium865Open in IMG/M
3300017735|Ga0181431_1089629Not Available689Open in IMG/M
3300017738|Ga0181428_1137911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium571Open in IMG/M
3300017739|Ga0181433_1011557All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2424Open in IMG/M
3300017740|Ga0181418_1166031All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium529Open in IMG/M
3300017742|Ga0181399_1104885All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium697Open in IMG/M
3300017744|Ga0181397_1018215All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2089Open in IMG/M
3300017744|Ga0181397_1116847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium694Open in IMG/M
3300017745|Ga0181427_1028021All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1405Open in IMG/M
3300017745|Ga0181427_1069545Not Available865Open in IMG/M
3300017749|Ga0181392_1063493All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1124Open in IMG/M
3300017749|Ga0181392_1130935Not Available740Open in IMG/M
3300017750|Ga0181405_1042616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1208Open in IMG/M
3300017751|Ga0187219_1136437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium716Open in IMG/M
3300017751|Ga0187219_1218199All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300017753|Ga0181407_1032400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1406Open in IMG/M
3300017753|Ga0181407_1147288Not Available582Open in IMG/M
3300017753|Ga0181407_1180261All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium515Open in IMG/M
3300017755|Ga0181411_1166060All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium631Open in IMG/M
3300017757|Ga0181420_1043607All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1450Open in IMG/M
3300017757|Ga0181420_1068958All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1114Open in IMG/M
3300017757|Ga0181420_1076853Not Available1045Open in IMG/M
3300017757|Ga0181420_1110324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium841Open in IMG/M
3300017758|Ga0181409_1063829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1122Open in IMG/M
3300017758|Ga0181409_1084054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium957Open in IMG/M
3300017759|Ga0181414_1021046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1777Open in IMG/M
3300017759|Ga0181414_1187995All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300017760|Ga0181408_1094351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium781Open in IMG/M
3300017762|Ga0181422_1242407Not Available535Open in IMG/M
3300017763|Ga0181410_1206383All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300017764|Ga0181385_1111709All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium835Open in IMG/M
3300017764|Ga0181385_1161783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium678Open in IMG/M
3300017764|Ga0181385_1259656All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium520Open in IMG/M
3300017765|Ga0181413_1005525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3944Open in IMG/M
3300017765|Ga0181413_1143102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium722Open in IMG/M
3300017765|Ga0181413_1150100Not Available703Open in IMG/M
3300017765|Ga0181413_1165737All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium664Open in IMG/M
3300017765|Ga0181413_1213352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium575Open in IMG/M
3300017768|Ga0187220_1059309All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1151Open in IMG/M
3300017769|Ga0187221_1103814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium867Open in IMG/M
3300017769|Ga0187221_1168506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium643Open in IMG/M
3300017770|Ga0187217_1117367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium900Open in IMG/M
3300017770|Ga0187217_1121177All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium883Open in IMG/M
3300017770|Ga0187217_1246105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium584Open in IMG/M
3300017771|Ga0181425_1212186All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium605Open in IMG/M
3300017771|Ga0181425_1223489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium586Open in IMG/M
3300017772|Ga0181430_1058392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1188Open in IMG/M
3300017772|Ga0181430_1148702All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium681Open in IMG/M
3300017772|Ga0181430_1179593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium609Open in IMG/M
3300017773|Ga0181386_1055117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1273Open in IMG/M
3300017775|Ga0181432_1012787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2075Open in IMG/M
3300017775|Ga0181432_1027329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1514Open in IMG/M
3300017775|Ga0181432_1028955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1476Open in IMG/M
3300017776|Ga0181394_1021414All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2325Open in IMG/M
3300017776|Ga0181394_1127450Not Available800Open in IMG/M
3300017779|Ga0181395_1125475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium815Open in IMG/M
3300017779|Ga0181395_1275366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium511Open in IMG/M
3300017781|Ga0181423_1146021All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium913Open in IMG/M
3300017782|Ga0181380_1222616Not Available629Open in IMG/M
3300017782|Ga0181380_1262329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium571Open in IMG/M
3300017783|Ga0181379_1180282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium745Open in IMG/M
3300020403|Ga0211532_10369005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium542Open in IMG/M
3300020438|Ga0211576_10212369All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1027Open in IMG/M
3300020438|Ga0211576_10592723All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300020465|Ga0211640_10642814All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300020470|Ga0211543_10226458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium920Open in IMG/M
3300020470|Ga0211543_10476095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300020471|Ga0211614_10212833All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium838Open in IMG/M
3300022164|Ga0212022_1048727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium655Open in IMG/M
3300025086|Ga0208157_1029820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1583Open in IMG/M
3300025102|Ga0208666_1039874All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1369Open in IMG/M
3300025102|Ga0208666_1057727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1063Open in IMG/M
3300025102|Ga0208666_1141899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium545Open in IMG/M
3300025120|Ga0209535_1047189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1866Open in IMG/M
3300025137|Ga0209336_10040894Not Available1491Open in IMG/M
3300025138|Ga0209634_1020118Not Available3734Open in IMG/M
3300025138|Ga0209634_1170981All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium863Open in IMG/M
3300025168|Ga0209337_1055681All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2026Open in IMG/M
3300025168|Ga0209337_1181602All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium876Open in IMG/M
3300025168|Ga0209337_1186061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium860Open in IMG/M
3300029448|Ga0183755_1060520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium899Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater64.62%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.92%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.15%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.77%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.77%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017704Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017718Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaGEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020465Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24006J15134_10005955123300001450MarineVSFRSSEKVAKNLFMASNRKVASLIEKKRKILKEIDDLQNNCEHLNKVVKSIKENEDSSTFVVRCVCEGCGKTIGIPTQQEIKKYLNGF*
JGI24006J15134_1002873823300001450MarineMASNKKVASLIEKKRVILKEIDDLQNNCEHLDKVIKSIKENEDSSTFVVRCVCGDCGKMIGMPTQQELNEYLNGIR*
JGI24006J15134_1006773813300001450MarineYFMANDRKVASLIEEKRKISKKIDDLQNNCEHLHKIVKSIKENEDSSTFVVRCVCGGCGKTIGMPTPQELNKYLNGR*
Ga0098038_102861343300006735MarineMASNKKVASLIEKKRIISKEINDLQNNCEHLHKVVKSIKENEDSSTFIIRYVCGGCEKTIGVPTQQELNKYLNGR*
Ga0098038_103588033300006735MarineMANNKKVASLLKKKHEISKEIEDLQSNCGHLNKTIKSIKENEDSSTFVVRCVCGGCDKVIGIPTQQELNEYLNGIR*
Ga0098038_107067433300006735MarineMALDKKVASLIEKKREISKEINDLQNNCEHLDKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR*
Ga0098038_120284133300006735MarineMASNKKVASLIEKKRKISKEIDDLQNKCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGSR*
Ga0098037_116732333300006737MarineMASNKKVASLIEKKRIISKEINDLQNNCEHLHKVVKSIKENEDSSTFVIRYVCGGCEKTIGVPTQQELNKYLNGR*
Ga0098037_120412433300006737MarineMALDKKVASLIEKKRKISKEINDLQNNCEHLDKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR*
Ga0098044_128035513300006754MarineMAKSKKVASLIEKKRVISKEIDDLQNNCEHLNKIVKSIKENEASSTFIVRCVCGDCEKTIGMPTTQELNKYLNGR*
Ga0098045_113168513300006922MarineLIEEKRKISKKINDLQNKCNHLNEIIKSIKENEDSSTFVVRCVCGGCDKVIGIPTQQELNEYLNGIR*
Ga0098052_114750813300008050MarineMAKFKKVASLIEKKRVISKEIDDLQNNCEHLNKIIKSIKENEDSSTFVVRCVCGDCEKTIGMPTQQELNKYLNGR*
Ga0098059_118221913300010153MarineMANNKKVASLLKKKHEISKEIEDLQSNCGQLNKTIKSIKENEDSSTFVVRCVCGGCDKVIGIPTQQELNEYLNGIR*
Ga0160423_1027164433300012920Surface SeawaterMALNQKVSSLFEKKRLISKEIENLQNNCEHLKKVIKSIKENEDSSTFIIRCVCEDCNKIVGMPTQQELNEYLNGTR*
Ga0129327_1062754713300013010Freshwater To Marine Saline GradientMASDKKVASLIEKKRKILKEIKYLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKMIGMPTQHELNEYLNGIR*
Ga0181371_101968633300017704MarineMAKFKKVASLIEKKREILKEIENLQDNCEHLNKIVKSIKENEASSTFIVRCVCGDCEKVISMPTTQELNKYLNGR
Ga0181371_103755313300017704MarineMAKSKKVASLIEKKRVISKEINELQNNCEHLNKIVKSIKENEASSTFIVRCVCRDCEKTIGMPTTQELNKYLNGR
Ga0181372_100842033300017705MarineMANNKKVASLIEEKRKISKEIDDLQNKCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGMPTQQELNRYLNGSR
Ga0181372_102707213300017705MarineMAKFKKVASLIEKKRVISKEIDDLQNNCEHLNKIVKSIKENEASSTFIVRCVCRDCEKTIGMPTTQELNKYLNGR
Ga0181372_109745013300017705MarineMAKSKKVASLIEKKREISKEIDNLQNNCKHLNKVIKSTKENEDSSTFVVRCVCVGCGKTIGVPTPQELNKYLNGR
Ga0181377_100373593300017706MarineMARSKKVASLIEKKRVISKEINDLQNNCEHLNKVVKSIKENEDTSTFVVRCVCGDCEKIIGMPTQQELNKYLNGR
Ga0181377_101262843300017706MarineMASDKKVASLIEEKRKISKKINDLQNKCNHLNEIIKSIKENEDSSTFVVRCVCGDCGKVIRMPTQQELNKYLNGR
Ga0181377_103315633300017706MarineMANTKKVASLLEKKRKISKEINDLQNNCEHLDKVVKSIKENEDSSTFVVRCVCGGCGKIIGVPNDNEIKKYLEK
Ga0181377_107888613300017706MarineMANIKKVASLIEKKRKISKEIEHLQNNCEHLNKVIKSIKENEDSSTFVIRCICGGCGKTIGMPTQQELNKYLNGR
Ga0181369_101877123300017708MarineMASNKKVASLIEKKRIISKEINDLQNNCEHLHKVVKSIKENEDSSTFIIRYVCGGCEKTIGVPTQQELNKYLNGR
Ga0181387_106303223300017709SeawaterMASDKKVASLIEKKRKISKEIDDLQNSCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIRVPTPQELNKYLNGR
Ga0181403_100307363300017710SeawaterMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELKKYLNGR
Ga0181403_105819613300017710SeawaterKRLLKIYFMASDKKVASLIEKKRKILKEINDLQNNCEHLNKVIKSIKENEDSSTFVVRCVCGGCGKMIGMPTQHELNEYLNGIR
Ga0181403_108201633300017710SeawaterEKKRKISKEIEDLQNNCEHLNKIIKSIKENEDSSTFVIRYVCGECGKMIGIPNNSEIKKYLK
Ga0181403_112389013300017710SeawaterMASNKKVASLIEKKRKILKEINDLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGDCGKVIRMPTQQELNKYLNGR
Ga0181391_100459123300017713SeawaterMASNKKVASLIEEKRKISKKINDLQNKCNHLNEIIKSIKENEDSSTFVVRCVCGDCGKVIRMPTQQELNKYLNGR
Ga0181391_104037013300017713SeawaterMASDKKVASLIEKKRKISKEIDDLQSNCEHLNKVVKSVKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181404_106330823300017717SeawaterMANSKKVASLIEKKRKISKEIEDLQNNCEHLNKIIKSIKENEDSSTFVIRYVCGECGKMIGIPNNSEIKKYLK
Ga0181404_118151123300017717SeawaterTKRLLKIYFMASDKKVASLIEKKRKILKEINDLQNNCEHLNKVIKSIKENEDSSTFVVRCVCGGCGKMIGMPTQHELNEYLNGIR
Ga0181375_102941713300017718MarineMARFKKVASLIEKKRIISKEIDYLQNNCEHLSKIVKSIKENEASSTFIVRCVCGDCEKVISMPTTQELNKYLNGR
Ga0181390_109943713300017719SeawaterMASDKKVASLIEKKRKILKEIDNLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCEKVIGMPT
Ga0181390_110603913300017719SeawaterMASNKKVASLIEKKRKISKEINDLQNNCEHLDKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELKKYLNGR
Ga0181383_100594323300017720SeawaterMALDRKVASLIEKKREISKEINDLQNNCEHLDKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181383_104168743300017720SeawaterIEVTKRLLKIYFMASDKKVASLIEKKRKISKEIDDLQSNCEHLNKVVKSVKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181388_117595813300017724SeawaterMASNRKVASLIEKKRKISKEIDDLQNNCEHLHKIIKSIKENEDSSTFVVRCVCGDCGKMIGMPTQHELNEYLNGIR
Ga0181398_115347713300017725SeawaterMASDKKVASLIEKKRKISKEIDNLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181381_106405613300017726SeawaterMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCEKVIGMPTQQEL
Ga0181401_113143923300017727SeawaterMASDKKVASLIEKKRKILKEINDLQNNCEHLNKVIKSIKENEDSSTFVVRCVCGDCGKVIRMPTQQELNKYLNGR
Ga0181419_108852613300017728SeawaterMASNKKVASLIEKKREISKEINDLQNNCEHLDKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181417_110397813300017730SeawaterMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFIVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181416_102787813300017731SeawaterMASNKKVASLIEKKRVILKEIDDLQNNCEHLDKVIKSIKENEDSSTFVVRCVCGDCGKMIGMPTQQELNKYLNGR
Ga0181416_117692713300017731SeawaterMAKFKKVASLIEKKRIISKEIDDLQNNCEHLNKIIKSIKENEDSSTFIVRCVCRDCEKIIGMPTTQELNKYLNGR
Ga0181426_102956513300017733SeawaterMASDKKVASLIEKKRKILKEIDNLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGMPTPQELNK
Ga0187222_102000923300017734SeawaterMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQKLKKYLNGR
Ga0187222_106175933300017734SeawaterMASNKKVASLIEKKRKISKEIDDLQNNCEHLHKIIKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181431_108962913300017735SeawaterMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGDCGKMIGMPT
Ga0181428_113791113300017738SeawaterKIYFMAKFKKVASLIEKKRKISKEIEDLQDKCAHLEKSIKSIKENEDSSTFVIRCVCGGCEKVIGMPTQQELNKYLNGR
Ga0181433_101155723300017739SeawaterMASNKKVASLIEKKRKISKEIVDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKMIGMPTQQELNKYLNGR
Ga0181418_116603113300017740SeawaterFYFMASNKKVASLIEEKRKISKKINDLQNKCNHLNEIIKSIKENEDSSTFVVRCVCGDCGKVIRMPTQQELNKYLNGR
Ga0181399_110488513300017742SeawaterMASNKKVASLIEKKREISKEINDLQNNCEHLDKVVKSIKENEDSSTFVVRCVCVGCGKTIGVPTQQELNKYLNGR
Ga0181397_101821563300017744SeawaterMYDWRCSIEVTKRLLKIYFMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELKKYLNGR
Ga0181397_111684713300017744SeawaterMASNRKVASLIEKKRKISKEIDDLQNSCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIRVPTPQELNKYLNGR
Ga0181427_102802133300017745SeawaterMARSKKVASLIEKKRVISKEINDLQNNCEHLDKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181427_106954513300017745SeawaterMASNKKVASLIEKKRKISKEIDDLQNNCEHLSKVIKSIKENEDSSTFVVRCVCGGCEKTIGMPTQQELNK
Ga0181392_106349343300017749SeawaterLRKGCLKFYFMASNKKVASLIKEKRKISKKINDLQNKCNHLNEIIKSIKENEDSSTFVVRCVCGDCGKVIRMPTQQELNKYLNGR
Ga0181392_113093513300017749SeawaterMASNKKVASLIEKKRKISKEIDDLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGMPTPQELNKYLNGR
Ga0181405_104261613300017750SeawaterMASNRKVASLIEKKRKISKEIDDLQNSCEHLNKVVKSIKENEDSSTFVVRCVCGDCGKVIRMPTQQELNKYLNGR
Ga0187219_113643713300017751SeawaterMALDRKVASLIEKKREISKEINDLQNNCEHLDKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELKKYLNGR
Ga0187219_121819913300017751SeawaterKVASLIEKKRKILKEINDLQNNCEHLNKVIKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181407_103240013300017753SeawaterEVTKRLLKIYFMASNKKVASLIEKKRKILKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181407_114728813300017753SeawaterMALDRKVASLIEKKREISKEINDLQNNCEHLDKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTKQELNKYLNGR
Ga0181407_118026123300017753SeawaterMASNKKVASLIDKKRKISKEIDDLQNNCEHLHKVVKSIQENEDSSTFVVRCVCGGCGKIIGIPTQQQLNEYLNGIR
Ga0181411_116606023300017755SeawaterMASDKKVASLIEKKRKISKEIVDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKMIGMPTQQELNKYLNGR
Ga0181420_104360743300017757SeawaterMASNKKVASLIEKKRKISKEIKYLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181420_106895813300017757SeawaterMAKFKKVASLIEKKREILKEIENLQDNCEHLDKVVKSIKENEDSSTFVVRCVCVGCGKTIGVPTQQELNKYLNGR
Ga0181420_107685323300017757SeawaterMASNKKVASLIEKKRKISKEIDDLQNNCEHLHKIIKSIKENEDSSTFVVRCVCGGCGKTIGM
Ga0181420_111032413300017757SeawaterKVASLIEKKRKISKEIDDLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNEYLNGSR
Ga0181409_106382913300017758SeawaterDWRCSVEVTKRLLKIYFMASDKKVASLIEKKRKILKEINDLQNNCEHLNKVIKSIKENEDSSTFVVRCVCGGCGKMIGMPTQHELNEYLNGIR
Ga0181409_108405413300017758SeawaterYFMASNKKVASLIEKKRKISKEIDDLQNNCEHLHKIIKSIKENEDSSTFVIRCVCGGCEKVIGMPTQQELNKYLNGR
Ga0181414_102104613300017759SeawaterKIYFMASDKKVASLIEKKRKILKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181414_118799523300017759SeawaterYFMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181408_109435133300017760SeawaterMASNRKVASLIEKKRKISKEIDDLQNNCEHLSKVIKSIKENEDSSTFVVRCVCGDCGKMIGMPTQHELNEYLNGIR
Ga0181422_124240713300017762SeawaterMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGV
Ga0181410_120638313300017763SeawaterKRLLKIYFMASDKKVASLIEKKRKISKEIDDLQSNCEHLNKVVKSVKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181385_111170913300017764SeawaterSNRKVASLIEKKRKILKEIDDLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIRVPTPQELNKYLNGR
Ga0181385_116178333300017764SeawaterMASNKKVASLIEKRRKISKEIDDLQNNCGHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNEYLNGSR
Ga0181385_125965613300017764SeawaterVTKRLLKIYFMASDKKVASLIEKKRKISKEIDDLQSNCEHLNKVVKSVKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181413_100552593300017765SeawaterMSNSKKVASLIEKKRKISKEIEDLQNNCEHLNKIIKSIKENEDSSTFVIRYVCGECGKMIGIPNNSEIKKYLK
Ga0181413_114310233300017765SeawaterRGVKVTKRGCLKFYFMANDKKVASLIEKRRKISKEIFDLQSNCEHLHKIIKSIKENEDSSTFVVRCVCGGCGKTIGMPTQQELNKYLNGR
Ga0181413_115010013300017765SeawaterMASNKKVATLIEKKREISKEINDLQNNCEHLHKVIKSIKENEDSSTFVVRCVCGGCEKTIGMPTQQELNKYLNGR
Ga0181413_116573733300017765SeawaterVGCSIEVTKRLLKIYFMASNKKVASLIEKKRKISKEIDDLQNNCEHLSKVIKSIKENEDSSTFVVRCVCGDCGKMIGMPTQHELNEYLNGIR
Ga0181413_121335233300017765SeawaterLIEKQRKISKDIDDLQKSCEHLNKGVKSIKENEDSSTFVVRCVCGGCGKTIRVPTPQELNKYLNGR
Ga0187220_105930943300017768SeawaterSLIEKKRKISKEIDDLQNNCEHLSKVIKSIKENEDSSTFVVRCVCGDCGKMIGMPTQHELNEYLNGIR
Ga0187221_110381413300017769SeawaterMASNKKVASLIDKKRKISKEIDDLQSNCEHLNKVVKSVKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0187221_116850623300017769SeawaterMANSKKVASLIEKKRKISKEIEDLQNNCEHLNKIIKSIKENEDSSTFVIRYVCGECGKMIGMPTQHELNEYLNGIR
Ga0187217_111736713300017770SeawaterKIYFMANTKKVAFLLAKKRKILKEINDLQNNCDHLNKVIKSIKENEDSSTFVVRCVCGGCGKTIGMPTPQELNKYLNGR
Ga0187217_112117713300017770SeawaterMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKMIGMPTQQELNKYLNGR
Ga0187217_124610513300017770SeawaterRLLKIYFMASDKKVASLIEKKRKISKEIEDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181425_121218613300017771SeawaterMASNKKVASLIEKKRKISKEIDDLQNNCEHLNKVVKSIKENEDSSTFIVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181425_122348933300017771SeawaterKIYFMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKMIGMPTQQELNKYLNGR
Ga0181430_105839213300017772SeawaterLKIYFMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELKKYLNGR
Ga0181430_114870213300017772SeawaterMASNRKVASLIEKKREISKEINDLQNNCEHLDKVVKSIKENEDSSTFVIRYVCGGCGKTIGVPTQQEINKYLNGR
Ga0181430_117959333300017772SeawaterFYFMAKFKKVASLIEKKRIISKEIDDLQNNCEHLNKIIKSIKENEDSSTFIVRCVCRDCEKIIGMPTTQELNKYLNGR
Ga0181386_105511733300017773SeawaterMARSKKVASLIEKKRVISKEINDLQNNCEHLNKVVKSIKENEDTSTFVVRCVCGDCEKMIGMPTQQELNKYLNGNR
Ga0181432_101278713300017775SeawaterKKVASLLEKKRIISKEIDNLQNNCEHLNKVVKSIKENEASSTFVVRCVCGYCEKIIGMPTTQELNKYLNGR
Ga0181432_102732913300017775SeawaterMAKSQKVFSLIEKKRKISKEIENLQEKCNHSKKSIKSIKEHEASSTFVVRCVCGYCEKIIGIPTTQELNKYLNGR
Ga0181432_102895533300017775SeawaterMAKTKKVASLIEEKRKISKEIENLQGNCEHLNKIVKSIKENEASSTFIVRCVCGDCEKVISMPTTQELNKYLNGR
Ga0181394_102141413300017776SeawaterMASNRKVASLIEKKRKILKEINDLQNNCEHLNKVIKSIKENEDSSTFVVRCVCGGCGKMIGMPTQHELNEYLNGIR
Ga0181394_112745013300017776SeawaterMANSKKVASLIEKKRKISKEIDDLQNNCEHLNKVVKSIKENEDSSTFIVRCVCGGCGKTIGVPTQQELN
Ga0181395_112547533300017779SeawaterSLIEKKRKISKEIDDLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIRVPTPQELNKYLNGR
Ga0181395_127536613300017779SeawaterVTKRLLKIYFMASNKKVASLIEKKRKILKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0181423_114602113300017781SeawaterMANDKKVASLIEKRRKISKEIFDLQSNCEHLHKIIKSIKENEDSSTFVVRCVCGGCGKTIGMPTQQELNKYLNGR
Ga0181380_122261623300017782SeawaterMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVP
Ga0181380_126232923300017782SeawaterWRCSIEVTKRLLKIYFMASNRKVASLIEKKRKISKESEDLQNNCEHLNKIIKSIKENEDSSTFVVRCVCGDCGKVIRMPTQQELNKYLNGR
Ga0181379_118028213300017783SeawaterMASNRKVASLIEEKRKISKKINDLQNKCNHLNEIIKSIKENEDSSTFVVRCVCGDCGKVIRMPTQQELNKYLNGR
Ga0211532_1036900523300020403MarineMALNKKVASLFEKKRLISKEINDLQNNCEHLSKVIKSIKENEDSSTFVVRCICGECGKTIGIPTQQELNNYLEK
Ga0211576_1021236913300020438MarineMASDKKVASLIEKKRKILKEIDNLQNNCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGMPTPQELNKYLNGR
Ga0211576_1059272313300020438MarineMASNKKVASLIEKKRKILKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0211640_1064281413300020465MarineMARSKKVASLIEKKRKISKEIDDLQNMCEHKNKITKSTKEHEAASTFVIRRVCGDCDKVIGMPTQH
Ga0211543_1022645813300020470MarineMANFKKVASLIEKKRKISKEIENLQNNCGHLNKIIKSIKENEDSSTFVIRYVCGDCDKVIGVPNNDEIKKYLK
Ga0211543_1047609513300020470MarineMAKFKKVASLIAKKHKISKEIEDLQKICKHTNKVIKSIKENEDSSTTVIRRICNDCEKVIGIPTQQEIYKFLNGTK
Ga0211614_1021283313300020471MarineMANTKKVAFLLAKKRKISKEINDLQNDCNHLNKVIKSIKENEDSSTFVVRCVCNDCEKIVGMPTQQELNDYLNGIR
Ga0212022_104872713300022164AqueousMASDKKVASLIEKKRKILKEINDLQNNCEHLNKVIKSIKENEDSSTFVVRCVCGGCGKMIGMPTQHELNEYLNGIR
Ga0208157_102982023300025086MarineMANNKKVASLLKKKHEISKEIEDLQSNCGHLNKTIKSIKENEDSSTFVVRCVCGGCDKVIGIPTQQELNEYLNGIR
Ga0208666_103987423300025102MarineMALDKKVASLIEKKREISKEINDLQNNCEHLDKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0208666_105772723300025102MarineMASNKKVASLIEKKRIISKEINDLQNNCEHLHKVVKSIKENEDSSTFVIRYVCGGCEKTIGVPTQQELNKYLNGR
Ga0208666_114189923300025102MarineMASNKKVASLIEKKRKISKEIDDLQNKCEHLNKVVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGSR
Ga0209535_104718923300025120MarineMASNKKVATLIEKKREISKEIDDLQNNCEHLDKVIKSIKENEDSSTFVVRCVCGDCGKMIGMPTQQELNEYLNGIR
Ga0209336_1004089423300025137MarineMASNKKVATLIEKKREISKEIDDLQNNCEHLHKVIKSIKENEDSSTFVVRCVCGGCEKTIGMPTQQELNKYLNGR
Ga0209634_102011883300025138MarineVSFRSSEKVAKNLFMASNRKVASLIEKKRKILKEIDDLQNNCEHLNKVVKSIKENEDSSTFVVRCVCEGCGKTIGIPTQQEIKKYLNGF
Ga0209634_117098113300025138MarineMASNKKVASLIEKKRVILKEIDDLQNNCEHLDKVIKSIKENEDSSTFVVRCVCGDCGKMIGMPTQQELNEYLNGIR
Ga0209337_105568143300025168MarineMASNKKVASLIEKKRKISKEIDDLQNNCEHLHKIIKSIKENEDSSTFVIRCVCGGCEKVIGMPTQQELNKYLNGR
Ga0209337_118160233300025168MarineMASNKKVASLIEKKRKISKEINDLQNNCEHLNKVVKSIKENEDSSTFVIRCVCGGCGKTIGVPTQQELNKYLNGR
Ga0209337_118606133300025168MarineMANDRKVASLIEEKRKISKKIDDLQNNCEHLHKIVKSIKENEDSSTFVVRCVCGGCGKTIGMPTPQELNKYLNGR
Ga0183755_106052023300029448MarineMASDKKVASLIEKKRKISKEIDELQSNCEHLHKIVKSIKENEDSSTFVVRCVCGGCGKTIGVPTQQELNKYLNGR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.