NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063128

Metagenome / Metatranscriptome Family F063128

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063128
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 120 residues
Representative Sequence VEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI
Number of Associated Samples 103
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 21.54 %
% of genes near scaffold ends (potentially truncated) 52.31 %
% of genes from short scaffolds (< 2000 bps) 86.15 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(30.000 % of family members)
Environment Ontology (ENVO) Unclassified
(40.769 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.385 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.67%    β-sheet: 11.33%    Coil/Unstructured: 38.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF08240ADH_N 4.62
PF02494HYR 2.31
PF07743HSCB_C 1.54
PF04389Peptidase_M28 1.54
PF09976TPR_21 0.77
PF07992Pyr_redox_2 0.77
PF02729OTCace_N 0.77
PF13754Big_3_4 0.77
PF13174TPR_6 0.77
PF16757Fucosidase_C 0.77
PF00261Tropomyosin 0.77
PF13424TPR_12 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG1076DnaJ domain-containing proteinPosttranslational modification, protein turnover, chaperones [O] 1.54
COG1196Chromosome segregation ATPase SmcCell cycle control, cell division, chromosome partitioning [D] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_102124778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1082Open in IMG/M
3300000956|JGI10216J12902_101667956All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium639Open in IMG/M
3300000956|JGI10216J12902_102299029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2020Open in IMG/M
3300000956|JGI10216J12902_104711410All Organisms → cellular organisms → Bacteria2171Open in IMG/M
3300000956|JGI10216J12902_108211917All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium701Open in IMG/M
3300002100|JGI24809J26612_1000339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes15104Open in IMG/M
3300004156|Ga0062589_100291266All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1255Open in IMG/M
3300004157|Ga0062590_100395862All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300004157|Ga0062590_100418953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1106Open in IMG/M
3300004157|Ga0062590_102108346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium588Open in IMG/M
3300004463|Ga0063356_100003863All Organisms → cellular organisms → Bacteria12717Open in IMG/M
3300004463|Ga0063356_100338028All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300005289|Ga0065704_10181174All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1236Open in IMG/M
3300005290|Ga0065712_10265982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium926Open in IMG/M
3300005293|Ga0065715_10028288All Organisms → cellular organisms → Bacteria2097Open in IMG/M
3300005295|Ga0065707_10219476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1231Open in IMG/M
3300005333|Ga0070677_10628357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium598Open in IMG/M
3300005334|Ga0068869_100309224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1278Open in IMG/M
3300005338|Ga0068868_101375755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium658Open in IMG/M
3300005343|Ga0070687_100574269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium771Open in IMG/M
3300005353|Ga0070669_100990621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium721Open in IMG/M
3300005354|Ga0070675_101955976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium541Open in IMG/M
3300005441|Ga0070700_100169705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1510Open in IMG/M
3300005441|Ga0070700_101051643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium672Open in IMG/M
3300005471|Ga0070698_100116219All Organisms → cellular organisms → Bacteria2639Open in IMG/M
3300005471|Ga0070698_101815047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium562Open in IMG/M
3300005539|Ga0068853_100643467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1009Open in IMG/M
3300005577|Ga0068857_100286620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1516Open in IMG/M
3300005718|Ga0068866_11307761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium527Open in IMG/M
3300005840|Ga0068870_10249954All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1099Open in IMG/M
3300005843|Ga0068860_100705732All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1019Open in IMG/M
3300006058|Ga0075432_10435090All Organisms → cellular organisms → Bacteria → Fusobacteria → Fusobacteriia → Fusobacteriales → Fusobacteriaceae → Fusobacterium → Fusobacterium nucleatum573Open in IMG/M
3300006163|Ga0070715_10131027All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1207Open in IMG/M
3300006791|Ga0066653_10086108All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300006894|Ga0079215_11250700All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium569Open in IMG/M
3300007004|Ga0079218_12889739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium577Open in IMG/M
3300009094|Ga0111539_10300724All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1867Open in IMG/M
3300009094|Ga0111539_10630055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1249Open in IMG/M
3300009100|Ga0075418_10839526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium992Open in IMG/M
3300009100|Ga0075418_10923146All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium944Open in IMG/M
3300009156|Ga0111538_10190055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2606Open in IMG/M
3300009177|Ga0105248_12185646All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium630Open in IMG/M
3300009609|Ga0105347_1407102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium585Open in IMG/M
3300009678|Ga0105252_10426211All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium609Open in IMG/M
3300010400|Ga0134122_10700971All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium951Open in IMG/M
3300010403|Ga0134123_10964790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium865Open in IMG/M
3300011333|Ga0127502_10998917All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1723Open in IMG/M
3300012892|Ga0157294_10044714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium983Open in IMG/M
3300012892|Ga0157294_10114041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium711Open in IMG/M
3300012892|Ga0157294_10180682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium608Open in IMG/M
3300012893|Ga0157284_10011283All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1581Open in IMG/M
3300012893|Ga0157284_10040002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1023Open in IMG/M
3300012895|Ga0157309_10193073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium633Open in IMG/M
3300012899|Ga0157299_10041798All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium989Open in IMG/M
3300012899|Ga0157299_10186223All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium615Open in IMG/M
3300012900|Ga0157292_10124761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium794Open in IMG/M
3300012903|Ga0157289_10089689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium860Open in IMG/M
3300012904|Ga0157282_10042940All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1069Open in IMG/M
3300012905|Ga0157296_10022878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1245Open in IMG/M
3300012905|Ga0157296_10359046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium531Open in IMG/M
3300012908|Ga0157286_10154016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium735Open in IMG/M
3300012909|Ga0157290_10056604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1032Open in IMG/M
3300012911|Ga0157301_10015115All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1616Open in IMG/M
3300012913|Ga0157298_10183598All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium656Open in IMG/M
3300012914|Ga0157297_10499577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium511Open in IMG/M
3300013296|Ga0157374_10782581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium969Open in IMG/M
3300013306|Ga0163162_10398432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1509Open in IMG/M
3300014326|Ga0157380_10033501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3956Open in IMG/M
3300014326|Ga0157380_11956941All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium647Open in IMG/M
3300014969|Ga0157376_10508517All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1185Open in IMG/M
3300015200|Ga0173480_10058047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1762Open in IMG/M
3300015200|Ga0173480_10515036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium719Open in IMG/M
3300015200|Ga0173480_10637511All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium659Open in IMG/M
3300015201|Ga0173478_10138764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium951Open in IMG/M
3300015371|Ga0132258_10660212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2630Open in IMG/M
3300015371|Ga0132258_11297516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1840Open in IMG/M
3300015371|Ga0132258_11870179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1512Open in IMG/M
3300015374|Ga0132255_102872020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium736Open in IMG/M
3300017792|Ga0163161_11188489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium659Open in IMG/M
3300018053|Ga0184626_10457946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium501Open in IMG/M
3300018067|Ga0184611_1000075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes15863Open in IMG/M
3300018469|Ga0190270_10002783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae8582Open in IMG/M
3300018476|Ga0190274_10275461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1546Open in IMG/M
3300018476|Ga0190274_10442562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1278Open in IMG/M
3300018476|Ga0190274_11047397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium893Open in IMG/M
3300018476|Ga0190274_13676455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium518Open in IMG/M
3300018481|Ga0190271_11120863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium910Open in IMG/M
3300018481|Ga0190271_13309782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium540Open in IMG/M
3300019356|Ga0173481_10001530All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5617Open in IMG/M
3300020000|Ga0193692_1083422All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium694Open in IMG/M
3300020003|Ga0193739_1124620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium637Open in IMG/M
3300020009|Ga0193740_1001266All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5531Open in IMG/M
3300020016|Ga0193696_1060684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium992Open in IMG/M
3300020020|Ga0193738_1000322All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes28748Open in IMG/M
3300020020|Ga0193738_1169777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium565Open in IMG/M
3300022894|Ga0247778_1150370All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium639Open in IMG/M
3300022898|Ga0247745_1023612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium891Open in IMG/M
3300022899|Ga0247795_1032005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium861Open in IMG/M
3300023057|Ga0247797_1011306All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → unclassified Flavihumibacter → Flavihumibacter sp. ZG6271068Open in IMG/M
3300023066|Ga0247793_1053116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium651Open in IMG/M
3300023071|Ga0247752_1013241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1137Open in IMG/M
3300023077|Ga0247802_1001757All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2346Open in IMG/M
3300023261|Ga0247796_1034764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → unclassified Flavihumibacter → Flavihumibacter sp. ZG627834Open in IMG/M
3300023266|Ga0247789_1113390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium548Open in IMG/M
3300025925|Ga0207650_11242128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium634Open in IMG/M
3300025936|Ga0207670_10508951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium979Open in IMG/M
3300025945|Ga0207679_10956356All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium785Open in IMG/M
3300025945|Ga0207679_12097118All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium514Open in IMG/M
3300025961|Ga0207712_10175574All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1678Open in IMG/M
3300025972|Ga0207668_10390683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1174Open in IMG/M
3300026075|Ga0207708_10150257All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1833Open in IMG/M
3300026075|Ga0207708_10280663All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1350Open in IMG/M
3300026116|Ga0207674_10052584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4154Open in IMG/M
3300026118|Ga0207675_100797469All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes957Open in IMG/M
3300026142|Ga0207698_11246180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium758Open in IMG/M
3300026285|Ga0209438_1080263All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1047Open in IMG/M
3300027831|Ga0209797_10000075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae42431Open in IMG/M
3300027840|Ga0209683_10043229All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1957Open in IMG/M
3300027886|Ga0209486_11173338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium525Open in IMG/M
3300027907|Ga0207428_10210611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1460Open in IMG/M
3300027992|Ga0247750_1016605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium718Open in IMG/M
3300028381|Ga0268264_10282529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1555Open in IMG/M
3300028802|Ga0307503_10498621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium656Open in IMG/M
3300031538|Ga0310888_10617679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium659Open in IMG/M
3300031547|Ga0310887_10937293All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium550Open in IMG/M
3300031944|Ga0310884_10261834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium950Open in IMG/M
3300032017|Ga0310899_10709588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium511Open in IMG/M
3300032144|Ga0315910_10000039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes235940Open in IMG/M
3300032157|Ga0315912_10225682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium1471Open in IMG/M
3300034115|Ga0364945_0186185All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → unclassified Bacteroidia → Bacteroidia bacterium631Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil30.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.38%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.08%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.08%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.08%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.08%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.31%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.54%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.54%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.54%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.54%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.54%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.77%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.77%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002100Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDAEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027992Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10212477823300000559SoilMIMNAVSEVEKIIRDYIEQKQKSYYYHRRKNDAEKEYNKLLVSCGGEEKKFSLDEANKIYQAFKEMEVNEELLKNAEDKFNEADEKLKELGTILFHASITANITIPPINGEGVISKQVTVSFPNGQALVI*
JGI10216J12902_10166795623300000956SoilKIISDYLEQKQRSHYYHKKKNDAEKEYNKLLVSFGGEAKNFSLDEANKIYHAFREIQLNEEHLKNAEEKFNAADEKLKELGHILFHATITADIVIPPVNGEALISKQVTVSFPNGQALVI
JGI10216J12902_10229902923300000956SoilMIMKSVSEVEKIIQDYIEQKQRSHYYHKRKNDAEKEYNKLLVSCGGEEKSFSLEEANKIYQAFKEMQVNEEYLRNAENKFNEADEKLKELGSILFHASITADILIPPINGEGIISKQVTVSFPNGQALVI*
JGI10216J12902_10471141023300000956SoilMNAGSEVEKIIQDYIEHKQKSHYYHKKKNDAEKEYNKLLVNCGGEDKNFSLEEANKIYRAFKEMQTNEDYLKSAQEKFSEADEKLKELGSILFHASITADIMIPPLNGEGFISKHVTVSFPNGQALVI*
JGI10216J12902_10821191713300000956SoilKIISDYLEQKQRSHYYHKKKNDAEKEYNKLLVSFGGEAKNFSLDEANKIYHAFREIEVNEEHLKNAEEKFNAADEKLKELGHILFHATITADITIPPVNGEAVISKQVTVSFPNGQALVI
JGI24809J26612_100033933300002100SoilMITNSSLEIEKIIQDYIEQQRKSNYYHRKKTDAEKEYNKLLVSSGGETKNFSLEEANKIYKAFKEIEVNEEYFKEAENKFNVADEKMKELGHILFHATISAEITIPPINGEQVITKQVTISFPNGQVVVK*
Ga0062589_10029126613300004156SoilSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADAKLRELGSILFHASITADIRIPPINGEGILSKQVTVSFPNGQALVI*
Ga0062590_10039586223300004157SoilMNAGSEVEKIIRDYIEQQRKSQYYHKKKNDAEKEYNKLLVNFGGEAKNFSLEEANKIYQAFREIQINEEQLKSAEDKFNDADEKLKELGHILFHATITANITIPPVNGEEVVSKQITVSFPNGQALVI*
Ga0062590_10041895313300004157SoilYHKRKNDAEKEYNKLLVSYGGEEKNFSLEEANKIYRAFKEMQVNEELLKNAEDKFNEADEKLKELGSILFHASVTAEIKIPPVNGEGFISKQITVSFPNGQALVI*
Ga0062590_10210834613300004157SoilIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADEKLRELGSILFHASITADIRIPPINGEGILSKQVTVSFPNGQALVI*
Ga0063356_10000386393300004463Arabidopsis Thaliana RhizosphereMIMNTVSEVEKIIQDYIEQKQKSHYYHKKKNDAEKEYNKLLVSCGGEEKNFSLDEANNIYRAFKEMQVNEECLKNAEDKFNEADEKLKELGSILFHASITADIIIPPVNGEGFVSKQVTVSFPNGQALVI*
Ga0063356_10033802823300004463Arabidopsis Thaliana RhizosphereMNTGSEVEKIIRDYIEQQRKSQYYHKKKNDAEKEYNKLLVNFGGEAKNFSLEEANKIYQAFREIQINEEQLKTAEDKFNDADEKLKELGHILFHATITADIMIPPVNGEEVVSKQITVSFPNGQALVI*
Ga0065704_1018117413300005289Switchgrass RhizosphereSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLEEANNIYKAFKEIEINEENLKEAENKFNEADEKMKELGNILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVR*
Ga0065712_1026598213300005290Miscanthus RhizosphereHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEASKIYQAFKEMQVNEELLKNTEDKFNEADEKLKELGSILFHASITADIMIPPLNGEGVISKQVIVSFPNGQALVI*
Ga0065715_1002828823300005293Miscanthus RhizosphereMIXNAVSEVEKIIQDYIEQKQKSHYYHKRKNDAEXEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKEXGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0065707_1021947613300005295Switchgrass RhizosphereMSINTVSDVEKIIQEYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADEKLRELGSILFHASITADIRIPPIN
Ga0070677_1062835713300005333Miscanthus RhizosphereHKRKNDAEKEYNKLLVSCGGEEKNFSLEEADKIYRAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIMIPPINGEGIVSKQVTVSFPNGQALVI*
Ga0068869_10030922413300005334Miscanthus RhizosphereRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0068868_10137575523300005338Miscanthus RhizosphereHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0070687_10057426913300005343Switchgrass RhizosphereVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0070669_10099062113300005353Switchgrass RhizosphereMITNSSLEIEKIIQDYIEQQRKSNYYHRKKTDAEKEYNKLLVSSGGETKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0070675_10195597613300005354Miscanthus RhizosphereMITNGGLEIEKIIQDYIEQQRRSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLKEANKIYKAFKEIEINEEYLKEAENKFNEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVK*
Ga0070700_10016970523300005441Corn, Switchgrass And Miscanthus RhizosphereMSINTVSDVEKIIQEYIEQKQKSHYYHKRKNDAEKEYNKLLVSCAGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADEKLRELGSILFHASITADIRIPPVNGEGILSKQVTVSFPNGQALVI*
Ga0070700_10105164313300005441Corn, Switchgrass And Miscanthus RhizosphereKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0070698_10011621923300005471Corn, Switchgrass And Miscanthus RhizosphereMITNAVSEVEKIIRNYVELRQKFNYCHKKKTDAEKEYNKLLVTFGGETKNFSLEEANKIYIAYREMQVNEEHLKIAECKFNEADEKLTELGHILFHATITGEITLSPINGETVIAKQVTVSFPNGQALVI*
Ga0070698_10181504713300005471Corn, Switchgrass And Miscanthus RhizosphereMITNTVFEIEKIIQDYIEQQQKSNYYHKKKSDAEKEYNKLLVSAGGESKVFSLEEANKIYKAFKDIEVNEEHLKAAEDKFNEADQKMIELGQILFHATITADIIIPPVNGAQVITKQVTISFPNGQVVVK*
Ga0068853_10064346713300005539Corn RhizosphereQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0068857_10028662023300005577Corn RhizosphereMITNTGSEIEKIIQDYIEQQRRSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLEEANKIYKAFKEIEINDEYLKEAENKFNEADEKMKELGHILFHATITADITI
Ga0068866_1130776123300005718Miscanthus RhizosphereEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0068870_1024995423300005840Miscanthus RhizosphereYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0068860_10070573223300005843Switchgrass RhizosphereQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0075432_1043509013300006058Populus RhizosphereMIINAVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCSGEEKNFSLEEANKIYEAYKEMQVNEALLKNAEDKFLEADEKLRELGSILFHASITADIKIPPVNGEGVLAKQVTVSFPNGQALII*
Ga0070715_1013102713300006163Corn, Switchgrass And Miscanthus RhizosphereMIMNSVSEVEKIIYDYIEQKQKSHYYHKRKNDTEKEYNKLLVSCGGEEKNFSLEEANKIYLAFKEMQVNEEHLKNAEDKFIEADEKLKELGNILFHASITADIIIPPINGEGIVSKQITVSFPNGQALVI*
Ga0066653_1008610833300006791SoilMNAVSEVEKIIQDYIEQKHRSHYYHKRKNDAEKEYNKLLVSCGGKEKNFSLEEANKIYRAFKEMQVNEEHLKNAEDKFSEADEKLKELGSILIHASITADIMIPPINGEGIISKQVTVSFPNGQALVV*
Ga0079215_1125070013300006894Agricultural SoilMIMNAVSEVEKIIQDYIEQKQKSHYYHKRRNDAEKEYNKLLVSCGGEEKNFSLEEANKIYLAFKEMQVNEELLKSAEEKFNEADEKLKELGSILFHASITGDILIPPINGEGIISKQITVSFPNGQALVI*
Ga0079218_1288973913300007004Agricultural SoilNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEEFLKNAEDKFNEADEKLKELGNILFHASITANITIPPINGEGVVSKQVTVSFPNRQALVI*
Ga0111539_1030072423300009094Populus RhizosphereMIMNADSEVEKIIQDYIEQKQKSYYYHKKKNDAEKEYNKLLVSCGGEEKNVSLEEANKIYRAFKEMQLNEELLKNAGDKFNEADEKLKELGSILFHASITADIIIPPINGEAIISKQVTVSFPNGQALVI*
Ga0111539_1063005523300009094Populus RhizosphereMIINSVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSYGGEEKNFSLEEANKIYRAFIEMQINEEYLKNAEDKFNEADEKLKELGSILFHASITADIMIPPVNGEGFVSKQVTVSFPNGQALVI*
Ga0075418_1083952623300009100Populus RhizosphereMNSVSEVARIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYLAFKEMQVNEELLKNAEDKFNEADEKLKELGSILFHASITADIKIPPVNGEAIVSKQVTVSFPNGQALVI*
Ga0075418_1092314623300009100Populus RhizosphereMNSVSEVEKIIQDYIEQKQKSHYYHKRKSDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKETQVNAELLKNAEDKFNEADEKLKELGSILFHASITAEIIIPPINGEGIVSKQVTVSFPNGQALVI*
Ga0111538_1019005523300009156Populus RhizosphereMNSVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSYGGEEKNFSLEEANKIYRAFIEMQINEEYLKNAEDKFNEADEKLKELGSILFHASITADIMIPPVNGEGFVSKQVTVSFPNGQALVI*
Ga0105248_1218564613300009177Switchgrass RhizosphereKSHYYHKRKNDAEKEYNKLLVSFGGEEKNFSLEEANKIYKAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIIIAPINGEGIISKQVTVSFPNGQALVIQ*
Ga0105347_140710213300009609SoilIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYLAFKEMQVNEEYLKSAEDKFNEADEKLKELGSILFHASITANIIIPPVNGEGFVSKQVTVSFPSGQALVI*
Ga0105252_1042621113300009678SoilMNSVSDVEKIIQDYVEQKQKSLYYHKRKNDAEKEYNKLLVSYGGEEKNFSLEEANKIYRAFKEMQVNEEYLKKAEDKFNEADEKLKELGSILFHASITADIIIPPVNGEGFVSKQVNVSFPNGQALVI*
Ga0134122_1070097123300010400Terrestrial SoilNYYHKRKNDSEKEYNKLLVSCGGEEKNFSLDEADKIYRAFKEMQVNEEQLKNAEDKFNEADEKLKELGSILFHATITADIIIPPLNGEGIISKQVTVSFPNGQALVI*
Ga0134123_1096479023300010403Terrestrial SoilNRFIINENFMIMNAVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNAELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0127502_1099891723300011333SoilKEYNKLLVNCGGEDKNFSLDEANKIYRAFKEMQINEDHLKNAEEKFSEADEKLKELGSILFHASITADIMIPPLNGEGFISKHVTVSFPNGQALVI*
Ga0157294_1004471423300012892SoilMNSVSEVEKIIQDYIEQKQKSHYYHKKKNDAEKEYNKLLVSYGGEEKNFSLEEANKIYQAFKEMQVNEELLRNAGDKFNEADEKLKELGSILFHASIRADIMIPPVNGEGFVSKQVTVSFPNGQALVI*
Ga0157294_1011404113300012892SoilYHKRKSDAEKEYNKLLVSCGGEEKNFSLEEANKIYKAFKEIQLNEEHLKNAEDKFNEADEKLKELGRILFHASITADIMIPPINGEGIVSKQVTVSFPNGQTLVI*
Ga0157294_1018068213300012892SoilYIEQKQKSHYYHKRKSDAEKEYNKLLVSYGGEEKNFSLEEANNIYRAFKEMQVNEDLLRNAENKFNEADEKLKELGSILFHASITANIIIPPINGEGVVSKLVTVSFPNGQALVI*
Ga0157284_1001128323300012893SoilMSINTVSDVEKIIQEYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADEKLRELGSILFHASITADIRIPPINGEGILSKQVTVSFPNGQALVI*
Ga0157284_1004000223300012893SoilMNAISEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYQAFKEMQVNEELLKNAGDKFNEADEKLKELGSILFHASIRADIMIPPVNGEGFVSKQVTVSFPNGQALVI*
Ga0157309_1019307313300012895SoilMNAVSEVGKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI*
Ga0157299_1004179813300012899SoilIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADAKLRELGSILFHASITADIRIPPINGEGILSKQVTVSFPNGQALVI*
Ga0157299_1018622313300012899SoilNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIMIPPINGEGIVSKQVTVSFPNGQALVI*
Ga0157292_1012476113300012900SoilMIINTVSEVEKIIQDYVEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEVLLKNAEDKFNEADEKLKELGSILFHASITADIMIPPINGEGIVSKQVTVSFPNGQALVI*
Ga0157289_1008968923300012903SoilEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANNIYLAFKEMQVNEVLLKNAEDKFNEADEKLKELGSILFHASITADIMIPPINGEGIVSKQVTVSFPNGQALVI*
Ga0157282_1004294023300012904SoilMIINAVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADAKLRELGSILFHASITADIRIPPINGEGILSKQVTVSFPNGQALVI*
Ga0157296_1002287813300012905SoilNKLLVSCGGEEKNFSLEEANKIYKAFKEIQLNEEHLKNAEDKFNEADEKLKELGSILFHATITADIMIPPINGEGIVSKQVTVSFPNGQVLVI*
Ga0157296_1035904613300012905SoilLQYHKRKNDAEKEYNKLLVSCGGEEKIFSLEEANKIYRAFKEMQVNEELLKNAEDKFNEADEKLKELGSILFHASVTAEIKIPPVNGEGFISKQITVSFPNGQALVI*
Ga0157286_1015401623300012908SoilMNSVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADEKLRELGSILFHASITADIRIPPINGEGILSKQVTVSFPNGQALVI*
Ga0157290_1005660423300012909SoilMNTVSEVEKIIQDYIEQKQKSHYYHKKKNDAEKEYNKLLVSCGGEEKNFSLDEANNIYRAFKEMQVNEECLKNAEDKFNEADEKLKELGSILFHASITADIIIPPVNGEGFVSKQVTVSFPNGQALVI*
Ga0157301_1001511513300012911SoilTDAEKEYNKLLVSSGGETKSFSLEEANKIYKAFKEIEINEEYLKEAENKFIEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVR*
Ga0157298_1018359813300012913SoilKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIMIPPINGEGIVSKQVTVSFPNGQALVI*
Ga0157297_1049957723300012914SoilIEQQRRSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLEEANKIYKAFKEIEINEEYLKEAENKFIEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFANGQVFVR*
Ga0157374_1078258123300013296Miscanthus RhizosphereMITNGGSEIEKIIQDYIEQQRRSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLKEANKIYKAFKEIEINEEYLKEAENKFNEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVK*
Ga0163162_1039843213300013306Switchgrass RhizosphereNDAEKEYNKLLVSCGGEEKNFSLEEASKIYQAFKEMQVNEELLKNTEDKFNEADEKLKELGSILFHASITADIMIPPLNGEGVISKQVIVSFPNGQALVI*
Ga0157380_1003350123300014326Switchgrass RhizosphereMNSVSEVEKIIQDYIEQKQKSQYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYQAFKEMQVNEELLRNAGDKFNEADEKLKELGSILFHASIRADIMIPPVNGEGFVSKQVTVSFPNGQALVI*
Ga0157380_1195694113300014326Switchgrass RhizosphereKSHFYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEADKIYRAFKEMQVNEEHLKNAEDKFNEADENLKELGSILFQASITADIKIPPINGEGVVSKQVTVSFPNGQALVI*
Ga0157376_1050851723300014969Miscanthus RhizosphereYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYQAFKEMQVNEEHLKIAEDKFNEADEKLKELGNILFHASITADIIIPPINGEGIISKQVTVSFPNGQALVIQ*
Ga0173480_1005804713300015200SoilTIMIMNSVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYQAFKEMQVNEELLRNAGDKFNEADEKLKELGSILFHASIRADIMIPPVNGEGFVSKQVTVSFPNGQALVI*
Ga0173480_1051503623300015200SoilMNTVSEVEKIIQDYIGQKQKSHYYHKRKNDAEKEYNKLLVSYGGEEKNFSLEEANNIYRAFKEMQVNEDLLRNAENKFNEADEKLKELGSILFHASITANIIIPPINGEGVVSKLVTVSFPNGQALVI*
Ga0173480_1063751123300015200SoilYNKLLVSYGGEEKNFSLEEANKIYKAFKEMQVNEEHLKTAEDKFNEADEKLKELGNILFHASITADIVIPPINGEGIVSKQVTVSFPNGQALVI*
Ga0173478_1013876423300015201SoilVLIINKIFMSIHAVSEVEKIIQEYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYQAFKEMQVNEELLKNAEDKFNEADAKLRELGSILFHASITADIRIPPINGEGILSKQVTVSFPNGQALVI*
Ga0132258_1066021223300015371Arabidopsis RhizosphereMNAISEVEKIIHDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYMAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIMIPPINGEGILSKQVTVSFPNGQVLVI*
Ga0132258_1129751623300015371Arabidopsis RhizosphereMNAVSEVEKIIRDYIEQKQKSLYYHKKKSDAEKEYNKLLVSYGGEEKNFSLEEANKIYLAFKEMQVNEEHLKNAEDKFNEADENLKELGHILFHATITADIIIPPINGEGVISKQVTVSFPNGQALVI*
Ga0132258_1187017923300015371Arabidopsis RhizosphereMNAISEVEKIIGDYIEQKQKSLYYHKKKNDAEKEYNKLLVSYGGQEKNFSLEEANKIYCAFKEMQVNEEHLKNAEDKFNEADEKLKELGHILFHATITADIIIPPVNGEGVISKQVTVSFPNGQALVI*
Ga0132255_10287202013300015374Arabidopsis RhizosphereMNTASEVEKIIQDYIEQKQKSHYYHKRKNDAGKEYNKLLVSCGGEEKNFSLEEANKIYLAFKEMQVNEEHLKNAEDKFNEADERLKELGNILFHASITADIMIPPINGGSSVSKHVTVS
Ga0163161_1118848923300017792Switchgrass RhizosphereIIIIRGRMMEKEYNKLLVSYGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI
Ga0184626_1045794623300018053Groundwater SedimentHKRKNVAEKEYNKLLVSFGGEEKNFSLEEANKIYKAFKEMQVNEEHLKNAEDKFNEADENLKELGSILFQASITADIKIPPINGVGVVSKQVTVSFPNGQALVI
Ga0184611_100007583300018067Groundwater SedimentMIINSVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSYGGEEKNFSLEEANKIYRAFIEMQINEEYLKNAEDKFNEADEKLKELGSILFHASITADIMIPPVNGEGFVSKQVTVSFPNGQALVI
Ga0190270_1000278353300018469SoilMIMNAVSEVEKIIQDYIEQKQKSLYYHKKKNDAEKEYNKLLVSYGGEEKNFSLEEANKIYQAFKEMQVNEELIKNAEDKFSKADEKLKELGSILFHASITANLMMPPINGEGVISKQVTVSFPNGQALVI
Ga0190274_1027546113300018476SoilMIINIVSEVEKIIQDYIEQKQRSHYYHKRKNDAEKEYNKLLVSYGGEEKNFSLEEANKIYMAFKEMQVNEGHLKNAEDKFNEADEKLKELGNILFHASITANIIIPPINGEGFISKQVSVSFPNGQALVI
Ga0190274_1044256223300018476SoilMIMNSVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANNIYRAFKEMQVNEEYLKNAEDKFNEADDKLKELGSILFHASITANIIVPPINGEGFVSKQVTVSFPNGQALVI
Ga0190274_1104739723300018476SoilMIMNSVSEVEKIIHDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANNIYQAFKEMQVNEELLRNAEDKFSEADEKLKELGSILFHASITADIIIPPVNGEGFVSKHVTVSFPNGQALVI
Ga0190274_1367645513300018476SoilTKVMTINSVSEVEKIIQDYIEQKKKSHYYHKRKNDAEKEYNKLLVSYGGEEKNFSLEEANKIYRAFIEMQVNEEYLKNAEDKFNEADEKLKELGSILFHASITADIMIPPVNGEGFVSKQVTVSFPNGQALVI
Ga0190271_1112086313300018481SoilYYHKRRNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKSAEEKFNEADEKLKELGSILFHASITGDILIPPINGEGIISKQITVSFPNGQALVI
Ga0190271_1330978213300018481SoilMIMNSVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDEANKIYRAFKEMQVNEEYLKSAEDKFNEADEKLKELGSILFHASITADIIIPPVNGEGFVSKQVNVSFPNGQ
Ga0173481_1000153033300019356SoilMITNTGSEIEKIIQDYIEQQRRSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLEEANKIYKAFKEIEINEEYLKEAENKFIEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVR
Ga0193692_108342223300020000SoilMITNTVSEIEEIIQDYIEQQRKTNYYHKKKTDAEKEYNKLLVSSGGESKNFSLEEANRIYKAFKEIEVNEACLKTAEDKFNEADKKMMELGQILFHATVTADIMIPPINGEQVITKQVTVTFPNGQVLIK
Ga0193739_112462013300020003SoilMNAVSEVEKIIQDYIEQKQRSHYYHKRKNDAEKEYNKLLVSCGGEEKIFSLEEANKIYRAFKEMQVNEELLKDAEDKFNEADEKLKELGSILFHASITGDIIIPPLNGEGVISKQVTVSFPNGQALVI
Ga0193740_100126633300020009SoilMIMNSFSEVEKIIQDYIEQKQKAHYYHKRKNDAEKEYNKLLVSCGGEEKKFSLDEANKIYQAFKEMQINEEFLKSAEDKFNEADEKLKELGTILFHASITANITIPPLNGGGVISKQVIVSFPNGQALVI
Ga0193696_106068413300020016SoilMITNTVTEIEKIIQEYMEQRQKSNYYHKKKSDAEKEYNKLLVSSGGESKVFSLEEANKIYRAFKDIEVNEEHLKAAEDKFNEADKKMIELGQILFHASISADIMIPPVNGEQVITKQVTISFPNGQVVVK
Ga0193738_100032283300020020SoilMIMNAVSEVEKIIQDYIEQKQRSHYYHKRKNDAEKEYNKLLVSCGGEEKIFSLEEANKIYRAFKEMQVNEELLKDAEDKFNEADEKLKELGSILFHASITGDIIIPPLNGEGVISKQVTVSFPNGQALVI
Ga0193738_116977713300020020SoilMITQTVSEVEKMIQDYVEQQQKSHYYHKKKNDAEKEYNKLLVSLGGEEKQFSIQEANRIYSAFREMEINEEKLKIAEDKFNAADEKLKELGRILFHATITAAITVPPINGEAVMSKQVTVSFPNGQA
Ga0247778_115037013300022894Plant LitterETKPHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIMIPPINGEGIVSKQVTVSFPNGQALVI
Ga0247745_102361213300022898SoilMIINAVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADEKLRELGSILFHASITADIRIPPINGEGILSKQVTVSFPNGQALVI
Ga0247795_103200523300022899SoilMIMNTVSEVEKIIQDYIEQKQKSLQYHKRKNDAEKEYNKLLVSCGGEEKIFSLEEANKIYRAFKEMQVNEELLKNAEDKFNEADEKLKELGSILFHASVTAEIKIPPVNGEGFISKQITVSFPNGQALVI
Ga0247797_101130613300023057SoilMIMNAVSEVEKIIQDYIEQKQKSYYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKNAEDKFNEADEKLKELGSILFHASITADIIIPPINGEAIISKQVTVSFPNGQALVI
Ga0247793_105311623300023066SoilQEYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYHAFKEKQVNEDLLKNAEDKFNEADEKLRELGTILFHASITADIKIPPVNGEGIVSKQVTVSFPNGQALVI
Ga0247752_101324113300023071SoilSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLEEANKIYKAFKEIEINEEYLKEAENKFNEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVR
Ga0247802_100175733300023077SoilMSINTVSHVEKIIQEYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADAKLRELGSILFHASITADIRIPPINGEGILSKQVTVSFPNGQALVI
Ga0247796_103476423300023261SoilQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYHAFKEKQVNEDLLKNAEDKFNEADEKLRELGTILFHASITADIKIPPVNGEGIVSKQVTVSFPNGQALVI
Ga0247789_111339023300023266SoilKEYNKLLVSYGGEEKNFSLEEANNIYRAFKEMQVNEDLLRNAENKFNEADEKLKELGSILFHASITANIIIPPINGEGVVSKLVTVSFPNGQALVI
Ga0207650_1124212813300025925Switchgrass RhizosphereMITNSVSEVEKIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLDEANRIYHAFKDMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIIIPPINGEGIISKQVTVSFPNGQALVIQ
Ga0207670_1050895123300025936Switchgrass RhizosphereRKNDAEKEYNKLLVSCGGEEKNFSLEEASKIYQAFKEMQVNEELLKNTEDKFNEADEKLKELGSILFHASITADIMIPPLNGEGVISKQVIVSFPNGQALVI
Ga0207679_1095635613300025945Corn RhizosphereMITNTGSEIEKIIQDYIEQQRRSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLEEANKIYKAFKEIEINEEYLKEAENKFIEADEKMKELGHILFHATITADITIPPINGEQVISKQ
Ga0207679_1209711823300025945Corn RhizosphereEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADVIIPPLNGEGIVSKHVTVSFPNGQALVI
Ga0207712_1017557413300025961Switchgrass RhizosphereTDAEKEYNKLLVSSGGETKSFSLKEANKIYKAFKEIEINEEYLKEAENKFNEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVK
Ga0207668_1039068323300025972Switchgrass RhizosphereRKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMEVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPINGEGIISKQVTVSFPNGQALVIQ
Ga0207708_1015025723300026075Corn, Switchgrass And Miscanthus RhizosphereMSINTVSDVEKIIQEYIEQKQKSHYYHKRKNDAEKEYNKLLVSCAGEEKNFSLDQANKIYQAFKEMQVNEELLKNAEDKFNEADEKLRELGSILFHASITADIRIPPVNGEGILSKQVTVSFPNGQALVI
Ga0207708_1028066313300026075Corn, Switchgrass And Miscanthus RhizosphereQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI
Ga0207674_1005258443300026116Corn RhizosphereMITNTGSEIEKIIQDYIEQQRRSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLEEANKIYKAFKEIEINDEYLKEAENKFNEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVR
Ga0207675_10079746923300026118Switchgrass RhizosphereMNCNADFMITNTGSEIEKIIQDYIEQQRRSHYYHKKKTDAEKEYNKLLVSSGGETKSFSLEEANKIYKAFKEIEINEEYLKEAENKFIEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVR
Ga0207698_1124618023300026142Corn RhizosphereKRKNDAEKEYNKLLVSCGGEEKNFSLEEASKIYQAFKEMQVNEEHLKIAEDKFNEADEKLKELGNILFHASITADIIIPPINGEGIISKQVTVSFPNGQALVIQ
Ga0209438_108026323300026285Grasslands SoilMITNIVSEIEEIIQDYIEQQRKTNYYHKKKTDAEKEYNKLLVSSGGESKNVSLEEANKIYKAFKEIEVNEEYLKTAEDKFNEADQKMMELGQILFHATITADIMIPPINGEQVITKQVTVTFPNGQVLIK
Ga0209797_10000075173300027831Wetland SedimentMIMNDVSNVEKIIQDYIEQKQKSSYYHKKKNDAEKEYNKLLVSSGGEAKNLSAEDANKIYRAFREMEFNQEHLKKAEDKFNEADEKLKELGRILFYATITADITVPPINGEAVISKQITVSFPNGQALVI
Ga0209683_1004322923300027840Wetland SedimentMIMNDVSNVEKIIQDYIEQKQRSNYYHKKKNDAEKEYNKLLVSSGGEAKNLSAEDANKIYRAFREMEFNQEHLKKAEDKFNEADEKLKELGRILFYATITADITVPPINGEAVISKQITVSFPNGQALVI
Ga0209486_1117333823300027886Agricultural SoilNCVSEVEKIIQDYIEQKQKSLYYHKKKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEEFLKNAEDKFNEADEKLKELGNILFHASITANITIPPINGEGVVSKQVTVSFPNRQALVI
Ga0207428_1021061113300027907Populus RhizosphereMIMNADSEVEKIIQDYIEQKQKSYYYHKKKNDAEKEYNKLLVSCGGEEKNVSLEEANKIYRAFKEMQLNEELLKNAGDKFNEADEKLKELGSILFHASITADIIIPPINGEAIISKQVTVSFPNGQALVI
Ga0247750_101660513300027992SoilQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYKAFKEMQVNEEHLKNAEDKFNEADENLKELGSILFQASITADIKIPPINGEGVVSKQVTVSFPNGQALVI
Ga0268264_1028252923300028381Switchgrass RhizosphereKNDAEKEYNKLLVSCGGEEKNFSLDEANRIYQAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIIIAPINGEGIISKQVTVSFPNGQALVIQ
Ga0307503_1049862113300028802SoilRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYKAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIMIPPINGEGIVSKQVTVSFPNGQALVI
Ga0310888_1061767913300031538SoilYHKKKTDAEKEYNKLLVSSGGETKSFSLEEANKIYKAFKEIEINEEYLKEAENKFNEADEKMKELGHILFHATITADITIPPINGEQVISKQVTVSFPNGQVFVK
Ga0310887_1093729313300031547SoilKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFHASITADIMIPPINGEGIVSKQVIVSFPNGQALVI
Ga0310884_1026183413300031944SoilQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEADKIYRAFKEMQVNEEHLKNAEDKFNEADEKLKELGSILFQASITADIKIPPINGEGVVSKQVTVSFPNGQALVI
Ga0310899_1070958823300032017SoilKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEADKIYRAFKEMQVNEEHLKNAEDKFNEADENLKELGSILFQASITADIKIPPINGEGVVSKQVTVSFPNGQALVI
Ga0315910_100000391403300032144SoilMIMNTVSEIEKIIQNYIEHQRKSNYYHKKKSEAEKEYNKLLVSLGGETKCFSLEEANKIYKAFKEIQINEEYWKEAENKFIEADEKMKELGNILFHASITADITIPPINGEQVISKQVTVTFPNGQVFVK
Ga0315912_1022568213300032157SoilMIMNSVSEVERIIQDYIEQKQKSHYYHKRKNDAEKEYNKLLVSCGGEEKNFSLEEANNIYRAFKEMQANEELLKNAEDKFNEADEKLKELGSILFHASITADIIIPPVNGEGFDTKHVTVSFPSGQALVI
Ga0364945_0186185_2_3133300034115SedimentKRKNDAEKEYNKLLVSCGGEEKNFSLEEANKIYRAFKEMQVNEELLKKAEDKFNEADEKLKELGSILFHASITADIIIPPLNGEGIVSKQVTVSFPNGQALVI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.