Basic Information | |
---|---|
Family ID | F062972 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 130 |
Average Sequence Length | 45 residues |
Representative Sequence | DPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.23 % |
% of genes from short scaffolds (< 2000 bps) | 89.23 % |
Associated GOLD sequencing projects | 114 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (68.462 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.692 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.538 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.06% β-sheet: 0.00% Coil/Unstructured: 81.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF13673 | Acetyltransf_10 | 23.08 |
PF07478 | Dala_Dala_lig_C | 20.00 |
PF00583 | Acetyltransf_1 | 11.54 |
PF14698 | ASL_C2 | 5.38 |
PF00005 | ABC_tran | 5.38 |
PF10397 | ADSL_C | 3.85 |
PF01425 | Amidase | 3.08 |
PF04055 | Radical_SAM | 2.31 |
PF00291 | PALP | 1.54 |
PF13563 | 2_5_RNA_ligase2 | 1.54 |
PF05988 | DUF899 | 1.54 |
PF00440 | TetR_N | 1.54 |
PF00155 | Aminotran_1_2 | 1.54 |
PF00106 | adh_short | 1.54 |
PF00903 | Glyoxalase | 1.54 |
PF10518 | TAT_signal | 0.77 |
PF13977 | TetR_C_6 | 0.77 |
PF01070 | FMN_dh | 0.77 |
PF08240 | ADH_N | 0.77 |
PF00202 | Aminotran_3 | 0.77 |
PF12681 | Glyoxalase_2 | 0.77 |
PF00754 | F5_F8_type_C | 0.77 |
PF12706 | Lactamase_B_2 | 0.77 |
PF03992 | ABM | 0.77 |
PF00696 | AA_kinase | 0.77 |
PF12680 | SnoaL_2 | 0.77 |
PF02679 | ComA | 0.77 |
PF00775 | Dioxygenase_C | 0.77 |
PF03743 | TrbI | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 3.08 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.54 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.77 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.77 |
COG1809 | Phosphosulfolactate synthase, CoM biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.77 |
COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.77 |
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.46 % |
Unclassified | root | N/A | 31.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001686|C688J18823_10829585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10147764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 948 | Open in IMG/M |
3300004635|Ga0062388_102954439 | Not Available | 502 | Open in IMG/M |
3300005434|Ga0070709_10714455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
3300005437|Ga0070710_10894585 | Not Available | 640 | Open in IMG/M |
3300005539|Ga0068853_100138617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 2182 | Open in IMG/M |
3300005558|Ga0066698_10911631 | Not Available | 562 | Open in IMG/M |
3300005559|Ga0066700_10704335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 692 | Open in IMG/M |
3300005563|Ga0068855_100350765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 1625 | Open in IMG/M |
3300005602|Ga0070762_10554693 | Not Available | 758 | Open in IMG/M |
3300005614|Ga0068856_100022780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium chubuense | 6090 | Open in IMG/M |
3300005764|Ga0066903_101645252 | Not Available | 1220 | Open in IMG/M |
3300006175|Ga0070712_100115161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis niigatensis | 2014 | Open in IMG/M |
3300006575|Ga0074053_11420389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
3300006580|Ga0074049_11928740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300006605|Ga0074057_12215857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 752 | Open in IMG/M |
3300006796|Ga0066665_11600732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
3300006804|Ga0079221_10302758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 939 | Open in IMG/M |
3300006806|Ga0079220_10207577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1137 | Open in IMG/M |
3300006953|Ga0074063_10051370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 748 | Open in IMG/M |
3300007076|Ga0075435_101478859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
3300007258|Ga0099793_10517929 | Not Available | 593 | Open in IMG/M |
3300007982|Ga0102924_1013392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 6598 | Open in IMG/M |
3300009093|Ga0105240_11795790 | Not Available | 639 | Open in IMG/M |
3300009101|Ga0105247_10441474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
3300009143|Ga0099792_11141845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300009148|Ga0105243_11704036 | Not Available | 659 | Open in IMG/M |
3300009174|Ga0105241_11076029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 756 | Open in IMG/M |
3300009176|Ga0105242_11236034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 768 | Open in IMG/M |
3300009698|Ga0116216_10063581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2270 | Open in IMG/M |
3300010323|Ga0134086_10370293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
3300010358|Ga0126370_12084871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
3300010359|Ga0126376_12815694 | Not Available | 536 | Open in IMG/M |
3300010360|Ga0126372_13295807 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300010362|Ga0126377_12497418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 592 | Open in IMG/M |
3300010376|Ga0126381_102202021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 793 | Open in IMG/M |
3300010858|Ga0126345_1001208 | Not Available | 3015 | Open in IMG/M |
3300010866|Ga0126344_1018479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2332 | Open in IMG/M |
3300010876|Ga0126361_11244755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1402 | Open in IMG/M |
3300010880|Ga0126350_12421754 | Not Available | 523 | Open in IMG/M |
3300011119|Ga0105246_10331402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. CNS-139 | 1241 | Open in IMG/M |
3300012200|Ga0137382_10412350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
3300012357|Ga0137384_10064936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3027 | Open in IMG/M |
3300012357|Ga0137384_10765378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 782 | Open in IMG/M |
3300012514|Ga0157330_1009422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
3300012929|Ga0137404_11115477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 724 | Open in IMG/M |
3300016294|Ga0182041_10700093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis | 898 | Open in IMG/M |
3300016422|Ga0182039_10594813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis | 966 | Open in IMG/M |
3300017821|Ga0187812_1285784 | Not Available | 525 | Open in IMG/M |
3300017924|Ga0187820_1225776 | Not Available | 593 | Open in IMG/M |
3300017972|Ga0187781_10251177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1251 | Open in IMG/M |
3300017999|Ga0187767_10222065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
3300018006|Ga0187804_10471925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300018062|Ga0187784_11289872 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300021178|Ga0210408_10147641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1861 | Open in IMG/M |
3300021178|Ga0210408_10156589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1805 | Open in IMG/M |
3300021405|Ga0210387_11269424 | Not Available | 637 | Open in IMG/M |
3300021407|Ga0210383_10457466 | Not Available | 1102 | Open in IMG/M |
3300021433|Ga0210391_10702704 | Not Available | 792 | Open in IMG/M |
3300021445|Ga0182009_10488956 | Not Available | 647 | Open in IMG/M |
3300021474|Ga0210390_10997317 | Not Available | 684 | Open in IMG/M |
3300025134|Ga0207416_1085958 | Not Available | 1171 | Open in IMG/M |
3300025898|Ga0207692_10197220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
3300025898|Ga0207692_10229425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
3300025914|Ga0207671_10142072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. SM1 | 1850 | Open in IMG/M |
3300025915|Ga0207693_10113120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis niigatensis | 2129 | Open in IMG/M |
3300025942|Ga0207689_10010636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus ruber | 7920 | Open in IMG/M |
3300025949|Ga0207667_10850066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
3300025949|Ga0207667_11832209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
3300025986|Ga0207658_11189677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 697 | Open in IMG/M |
3300026041|Ga0207639_11821373 | Not Available | 569 | Open in IMG/M |
3300027064|Ga0208724_1000913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2456 | Open in IMG/M |
3300027089|Ga0207943_101210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2214 | Open in IMG/M |
3300027158|Ga0208725_1016306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
3300027297|Ga0208241_1008830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1387 | Open in IMG/M |
3300027648|Ga0209420_1050724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1247 | Open in IMG/M |
3300027652|Ga0209007_1161068 | Not Available | 555 | Open in IMG/M |
3300027775|Ga0209177_10015091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1814 | Open in IMG/M |
3300027857|Ga0209166_10352383 | Not Available | 769 | Open in IMG/M |
3300027867|Ga0209167_10808952 | Not Available | 510 | Open in IMG/M |
3300027884|Ga0209275_10379609 | Not Available | 795 | Open in IMG/M |
3300027895|Ga0209624_10192185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora longispora | 1355 | Open in IMG/M |
3300028536|Ga0137415_11490775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
3300028877|Ga0302235_10226385 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300028906|Ga0308309_11436816 | Not Available | 590 | Open in IMG/M |
3300030013|Ga0302178_10517352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. ATCC 39149 | 518 | Open in IMG/M |
3300030617|Ga0311356_10047274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4602 | Open in IMG/M |
3300031543|Ga0318516_10728622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 562 | Open in IMG/M |
3300031544|Ga0318534_10616838 | Not Available | 616 | Open in IMG/M |
3300031546|Ga0318538_10809761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
3300031573|Ga0310915_10189808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1434 | Open in IMG/M |
3300031679|Ga0318561_10663497 | Not Available | 574 | Open in IMG/M |
3300031680|Ga0318574_10940121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
3300031681|Ga0318572_10022508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3185 | Open in IMG/M |
3300031682|Ga0318560_10785243 | Not Available | 514 | Open in IMG/M |
3300031713|Ga0318496_10257432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 962 | Open in IMG/M |
3300031713|Ga0318496_10507362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
3300031715|Ga0307476_11439153 | Not Available | 501 | Open in IMG/M |
3300031718|Ga0307474_10162023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1691 | Open in IMG/M |
3300031744|Ga0306918_11286709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
3300031747|Ga0318502_10631519 | Not Available | 646 | Open in IMG/M |
3300031765|Ga0318554_10191630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1163 | Open in IMG/M |
3300031768|Ga0318509_10715126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium | 556 | Open in IMG/M |
3300031770|Ga0318521_10797458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis | 575 | Open in IMG/M |
3300031777|Ga0318543_10168764 | Not Available | 966 | Open in IMG/M |
3300031794|Ga0318503_10217867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis | 619 | Open in IMG/M |
3300031805|Ga0318497_10275891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis | 934 | Open in IMG/M |
3300031819|Ga0318568_10464639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300031819|Ga0318568_10823942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis | 575 | Open in IMG/M |
3300031845|Ga0318511_10342034 | Not Available | 680 | Open in IMG/M |
3300031845|Ga0318511_10346754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 676 | Open in IMG/M |
3300031860|Ga0318495_10159733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
3300031894|Ga0318522_10263474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → Clavibacter michiganensis → Clavibacter michiganensis subsp. michiganensis | 653 | Open in IMG/M |
3300031896|Ga0318551_10406391 | Not Available | 775 | Open in IMG/M |
3300031945|Ga0310913_10487437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
3300032035|Ga0310911_10811551 | Not Available | 541 | Open in IMG/M |
3300032041|Ga0318549_10187923 | Not Available | 926 | Open in IMG/M |
3300032059|Ga0318533_10337848 | Not Available | 1096 | Open in IMG/M |
3300032068|Ga0318553_10655808 | Not Available | 549 | Open in IMG/M |
3300032094|Ga0318540_10170517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
3300032160|Ga0311301_11317873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 910 | Open in IMG/M |
3300032261|Ga0306920_103164735 | Not Available | 617 | Open in IMG/M |
3300032261|Ga0306920_104328972 | Not Available | 510 | Open in IMG/M |
3300032828|Ga0335080_12060791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
3300032895|Ga0335074_10933375 | Not Available | 779 | Open in IMG/M |
3300032896|Ga0335075_10405107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1448 | Open in IMG/M |
3300032896|Ga0335075_10709382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 965 | Open in IMG/M |
3300032896|Ga0335075_11228549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
3300033134|Ga0335073_11537847 | Not Available | 639 | Open in IMG/M |
3300033828|Ga0334850_097788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. ATCC 39149 | 564 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.69% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.15% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.38% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.08% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.31% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.31% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.31% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.31% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.31% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.54% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.54% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.54% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.54% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.77% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
3300027089 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015 (SPAdes) | Environmental | Open in IMG/M |
3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J18823_108295851 | 3300001686 | Soil | WLEPHEAPPTRTIALCYARHRPMTATARTLITAIRAQSA* |
JGIcombinedJ51221_101477643 | 3300003505 | Forest Soil | AASRAIDPALTWLEPHEPSAPRTIALCYPRHRPVTATARSLITAIRAQAS* |
Ga0062388_1029544391 | 3300004635 | Bog Forest Soil | VDPALTWLEPREPTAPRTIVLCYPRDRPVTATARSLITAIRAQAA* |
Ga0070709_107144551 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PALTWLEPDEATAQRTIALCYARHRPLTATARTLITAIRSQGG* |
Ga0070710_108945851 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0068853_1001386171 | 3300005539 | Corn Rhizosphere | GRVAASRAVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0066698_109116312 | 3300005558 | Soil | TWLEPDEATAQRTIVLCYARHRPVTATARTLITAIRSQAA* |
Ga0066700_107043351 | 3300005559 | Soil | ASRAVDPALTWLEPHEAPPRRTIAVCYARHRPVTATARTLITAIRAQGA* |
Ga0068855_1003507651 | 3300005563 | Corn Rhizosphere | EATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0070762_105546931 | 3300005602 | Soil | CIGRVAARRAVDPALTWLEPYDGAVPRTIALCYPRDRPVSATARSLITAIRAQAA* |
Ga0068856_1000227801 | 3300005614 | Corn Rhizosphere | ALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0066903_1016452521 | 3300005764 | Tropical Forest Soil | DPALTWLEPHEPAAPRAIALCYPRDRPVTATARSLITAIRRQGTHPGRAA* |
Ga0070712_1001151611 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AASRAVDPALTWLEPDEATAQRTIAVCYARHRPLTATARTLITAIRSQAG* |
Ga0074053_114203892 | 3300006575 | Soil | DEATAQRTIALCYARHRPVTATARTLISAIRSQAG* |
Ga0074049_119287402 | 3300006580 | Soil | TWLEPDEATAQRTIVLCYARHRPVTATARTLITAIRSQAG* |
Ga0074057_122158572 | 3300006605 | Soil | AVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLISAIRSQAG* |
Ga0066665_116007322 | 3300006796 | Soil | WAVDPVLTWLDPDEGTAPRTIALCYARHRPLTATARTLITAIRSQAA* |
Ga0079221_103027581 | 3300006804 | Agricultural Soil | DPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0079220_102075773 | 3300006806 | Agricultural Soil | LTWLEPDEATAQRTIALCYARHRPLTATARTLITAIRSQAG* |
Ga0074063_100513701 | 3300006953 | Soil | ALTWLEPDEATAQRTIALCYARHRPVTATARTLISAIRSQAG* |
Ga0075435_1014788592 | 3300007076 | Populus Rhizosphere | ALTWLEPDEATAQRTIALCYARHRPLTATARTLITAIRSQGG* |
Ga0099793_105179292 | 3300007258 | Vadose Zone Soil | LTWLEPDEATAQRTIAVCYARHRPLTATARTLITAIRSQAG* |
Ga0102924_10133921 | 3300007982 | Iron-Sulfur Acid Spring | ALTWLEPHDAAAPRTIAVCYPRDRPVTATARSLITAIRAQAA* |
Ga0105240_117957901 | 3300009093 | Corn Rhizosphere | IGRVAASRAVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0105247_104414741 | 3300009101 | Switchgrass Rhizosphere | ACIGRVAASRAVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0099792_111418451 | 3300009143 | Vadose Zone Soil | VLTWLEPQEAPPTRTIALCYARHRPMTATARTLITAIRGQGA* |
Ga0105243_117040362 | 3300009148 | Miscanthus Rhizosphere | SRAVDPALTWLEPDEATAQRTIAVCYARHRPLTATARTLITAIRSQAG* |
Ga0105241_110760291 | 3300009174 | Corn Rhizosphere | RAVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0105242_112360342 | 3300009176 | Miscanthus Rhizosphere | VDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0116216_100635811 | 3300009698 | Peatlands Soil | WLEPHETSAPRTIALCYPRHRPVSATARSLISAIRAQAA* |
Ga0134086_103702932 | 3300010323 | Grasslands Soil | WLEPDEATAQRTIALCYARHRPLTATARTLITAIRAQAAWA* |
Ga0126370_120848711 | 3300010358 | Tropical Forest Soil | EATARRTIALSYARHRPLTATARTLITAIRSQAA* |
Ga0126376_128156941 | 3300010359 | Tropical Forest Soil | LGRAGASRAIDPALTWLEPAEAPGGRTIAVCYARHRPLTATARTLITAIRAQAAY* |
Ga0126372_132958071 | 3300010360 | Tropical Forest Soil | SRAIDPALTWLEPREPRAPRTIALCYPRHRPPSATARSLITAIRAQAT* |
Ga0126377_124974182 | 3300010362 | Tropical Forest Soil | PDEATAQRTIALCYARHRPVTATTRSLITAIRSQAG* |
Ga0126381_1022020212 | 3300010376 | Tropical Forest Soil | ACIGRLAARRAVDPALTWLSPREPLALREIVLNYPRRRRLSATALALVAAIRAQAA* |
Ga0126345_10012081 | 3300010858 | Boreal Forest Soil | ACIGRVAASRAVDPALTWLEPHDAAAPRTIALCYPRDRPVTATARSLITAIRAQAA* |
Ga0126344_10184791 | 3300010866 | Boreal Forest Soil | LEPHDAAAPRTIALCYPRDRPVTATARSLITAIRAQAA* |
Ga0126361_112447551 | 3300010876 | Boreal Forest Soil | HDAGAPRTIAVCYPRDRPVTATARSLITAIRAQAA* |
Ga0126350_124217542 | 3300010880 | Boreal Forest Soil | TWLEPHDAGAPRTIVLCYPRDRPVSATARSLITAIRDQAA* |
Ga0105246_103314021 | 3300011119 | Miscanthus Rhizosphere | SRAVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG* |
Ga0137382_104123503 | 3300012200 | Vadose Zone Soil | VDPALTWLEPDEATAQRTIALCYARHRPLTATARTLITAIRSQAG* |
Ga0137384_100649365 | 3300012357 | Vadose Zone Soil | EPQEGPPTRTIALCYARHRPMTATASTLITAIRGQAA* |
Ga0137384_107653782 | 3300012357 | Vadose Zone Soil | VAASRAVDPALTWLEPDEATAQRTIALCYARHRPLTATARTLITAIRSQAAWA* |
Ga0157330_10094223 | 3300012514 | Soil | TWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGA* |
Ga0137404_111154771 | 3300012929 | Vadose Zone Soil | VDPALTWLEPDEATAQRTIAVCYARHRPLTATARTLITAIRSQAG* |
Ga0182041_107000931 | 3300016294 | Soil | AALTWLEPREPLAARTIALCYPRHRPLAATARSLIAAIRAQAM |
Ga0182039_105948131 | 3300016422 | Soil | RAIDAALTWLEPREPLAARTIALCYPRHRPLAATARSLIAAIRAQAM |
Ga0187812_12857842 | 3300017821 | Freshwater Sediment | CIGRVAARRAVDPALTWLEPDEPATPRTIALIYPRHRPVTATARSLITAIRAQAA |
Ga0187820_12257761 | 3300017924 | Freshwater Sediment | VDPALTWLDPHEPSAPRSISMCYLRHRPVSATARSLISAIRAQGVWPQAQ |
Ga0187781_102511773 | 3300017972 | Tropical Peatland | TWLEPHEPSAPRTIALCYPRDRPVTATARSLIAAIRAQAT |
Ga0187767_102220652 | 3300017999 | Tropical Peatland | PDEATARRTIALSYARHRPLTATARTLITAIRSQAA |
Ga0187804_104719253 | 3300018006 | Freshwater Sediment | WLEPQEPAASRTIALCYPRDRPVTATARSLITAIRAQAT |
Ga0187784_112898722 | 3300018062 | Tropical Peatland | WLKPHEPTAPRTIALCYPRHRQVTATARSLIRAIRAQAA |
Ga0210408_101476411 | 3300021178 | Soil | HEAPPRRTIAVCYARHRPVTATARTLITAIRAQGA |
Ga0210408_101565893 | 3300021178 | Soil | HDAAAPRTIALCYPRDRPVTATARSLITAIRAQAA |
Ga0210387_112694242 | 3300021405 | Soil | DPALTWLEPHDAAASRTIALCYPRDRPVTATARSLITAIRAQAA |
Ga0210383_104574661 | 3300021407 | Soil | ASRAVDPALTWLEPHEPVAARTIVLCYPRDRPVTATARSLITAIRGQAA |
Ga0210391_107027042 | 3300021433 | Soil | TWLEPDDPATPRTIVLCYPRDRPVTATARSLITAIRAQAA |
Ga0182009_104889561 | 3300021445 | Soil | RRAVDPALTWLEPDEATAQRTIALCYARHRPVTATARSLITAIRSQAG |
Ga0210390_109973172 | 3300021474 | Soil | HDAAASRTIALRYPRDRQVTATARSLITAIRAQAA |
Ga0207416_10859581 | 3300025134 | Iron-Sulfur Acid Spring | ALTWLEPHDAAAPRTIAVCYPRDRPVTATARSLITAIRAQAA |
Ga0207692_101972201 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ASRAVDPVLTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG |
Ga0207692_102294251 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RAVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG |
Ga0207671_101420723 | 3300025914 | Corn Rhizosphere | VAASRAVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG |
Ga0207693_101131201 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG |
Ga0207689_100106361 | 3300025942 | Miscanthus Rhizosphere | VAASRAVDPALTWLEPDEATAQRTIAVCYARHRPLTATARTLITAIRSQAG |
Ga0207667_108500661 | 3300025949 | Corn Rhizosphere | AASRAVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG |
Ga0207667_118322092 | 3300025949 | Corn Rhizosphere | ALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG |
Ga0207658_111896772 | 3300025986 | Switchgrass Rhizosphere | TWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG |
Ga0207639_118213731 | 3300026041 | Corn Rhizosphere | SRAVDPALTWLEPDEATAQRTIALCYARHRPVTATARTLITAIRSQGG |
Ga0208724_10009131 | 3300027064 | Forest Soil | LTWLEPHDAAASRTIALCYPRDRPVTATARSLITAIRAQAA |
Ga0207943_1012101 | 3300027089 | Forest Soil | GRVAASRAVDPVLTWLEPHEPPAPRMMALCYARHREVTPTARSLITAILGQI |
Ga0208725_10163063 | 3300027158 | Forest Soil | AASRAIDPALTWLEPHEPSAPRTIALCYPRHRPVTATARSLITAIRAQAS |
Ga0208241_10088301 | 3300027297 | Forest Soil | PREPLATATLRTIALCYARDRPVTATARSLITAIRAVAA |
Ga0209420_10507243 | 3300027648 | Forest Soil | LTWLEPHEPPPPRMIALCYPRHRPVTATARSLMTAIRGQT |
Ga0209007_11610681 | 3300027652 | Forest Soil | HEPSAPRTIALCYPRHRPVTATARSLITAIRAQAA |
Ga0209177_100150913 | 3300027775 | Agricultural Soil | WLEPDEATAQRTIALCYARHRPLTATARTLITAIRSQGG |
Ga0209166_103523832 | 3300027857 | Surface Soil | EPHDAGAPRTIALCYPRDRPVTATARSLITAIRAQAA |
Ga0209167_108089521 | 3300027867 | Surface Soil | GRVAASRAVDPALTWLEPHEPSAPRTISLCYPRHRPVSATARSLISAIRAQGVWPQAQ |
Ga0209275_103796091 | 3300027884 | Soil | RRAVDPALTWLEPYDGTVPRTIALCYPRDRPVSATARSLITAIRAQAA |
Ga0209624_101921854 | 3300027895 | Forest Soil | CIGRVAASRAIDPALTWLEPHEPSAPRTIALCYPRHRPVTATARSLITAIRAQAS |
Ga0137415_114907752 | 3300028536 | Vadose Zone Soil | TWLEPDEATDQRTIVLGYARHRPVTATARTLITAIRSQAG |
Ga0302235_102263851 | 3300028877 | Palsa | AATRAIDPALTWLLPDEPGAPRTIALCYPRHRPITATARSLIAAILAHAG |
Ga0308309_114368162 | 3300028906 | Soil | IDPALTWLEPHDAAASRTIALCYPRDRPVTATARSLITAIRAQAA |
Ga0302178_105173522 | 3300030013 | Palsa | LEPHEPAAPRTIAVCYPRHRPLTATARSLITAIRDQAT |
Ga0311356_100472741 | 3300030617 | Palsa | AATRAIDPALTWLLPDEPGAPRTIALCYPRHRPVSATARLLITAILAHAG |
Ga0318516_107286222 | 3300031543 | Soil | HRTIVRRAVDPVLTWLEPDEATARRTIVLCHARHRPVTATARTLITAIRSQAA |
Ga0318534_106168382 | 3300031544 | Soil | PVLTWLEPDEATARRTIVLCHARQRPVTATARTLITAIRSQAA |
Ga0318538_108097612 | 3300031546 | Soil | VDPMLTWLEPDEATARRTIAVCYPRHRPLTATARTLITAIRSQPG |
Ga0310915_101898083 | 3300031573 | Soil | GRVVASRAIDPALTWLEPHEASRGRTIALCYARHRPLTATARTLITAIRAQAVKVPF |
Ga0318561_106634971 | 3300031679 | Soil | VAASRAVDPALTWLEPDEATARRTIALGYARHRPLTATARTLITAIRSQAA |
Ga0318574_109401212 | 3300031680 | Soil | MLTWLEPDEATARRTIAVCYPRHRPLTATARTLITAIRSQAG |
Ga0318572_100225081 | 3300031681 | Soil | PVLTWLEPDEATARRTIVLCHARHRPVTATARTLITAIRSQAA |
Ga0318560_107852431 | 3300031682 | Soil | CIGRVAASRAIDPALTGLAPNDPAAPRVIALCYPRHRPVSATARSLITAIRGQAA |
Ga0318496_102574323 | 3300031713 | Soil | DPVLTWLEPDEATARRTIVLCHARHRPVTATARTLITAIRSQAA |
Ga0318496_105073622 | 3300031713 | Soil | ACIGRLAARRAVDPALTWLSPREPLALREIVLCYPRRRRLSATALALITAIRAQAA |
Ga0307476_114391531 | 3300031715 | Hardwood Forest Soil | WLEPHEPSAPRTISLCYPRHRPVSATARSLISAIRAQGVWPQAQ |
Ga0307474_101620231 | 3300031718 | Hardwood Forest Soil | DSALTWLEPHDTAAPRTIAVCYPRDRPVTATARSLITAIRAQAA |
Ga0306918_112867091 | 3300031744 | Soil | LEPDEATARRTIVLCHARQRPVTATARTLITAIRSQAA |
Ga0318502_106315192 | 3300031747 | Soil | GQACIGRLAARRAVDPALTWLSPREPLSKREIVLCYPRHRQMTATALALITAIRGQATT |
Ga0318554_101916303 | 3300031765 | Soil | SRAVDPVLTWLEPDEATARRTIVLCHARHRPVTATARTLITAIRSQAA |
Ga0318509_107151261 | 3300031768 | Soil | SRAVDPALTWLEPQEPAASRTIALCYPRDRPVTATARSLITAIRAQAT |
Ga0318521_107974581 | 3300031770 | Soil | PGQRRAVDPALTWLEPREPTASRTIALCYPRHRPVSATARSLITAIRAQAA |
Ga0318543_101687641 | 3300031777 | Soil | LTWLEPNDPAAPRVIALCYPRHRPVSATARSLITAIRGQAA |
Ga0318503_102178672 | 3300031794 | Soil | TWLEPREPLAARTIALCYPRHRPLAATARSLIAAIRAQAM |
Ga0318497_102758911 | 3300031805 | Soil | EPREPTASRTIALCYPRHRPVSATARSLITAIRAQAA |
Ga0318568_104646393 | 3300031819 | Soil | CIGRLAASRAVDPALTWLSPREPLALREIVLCYPRRRRLSATAQALITAIRGQAV |
Ga0318568_108239421 | 3300031819 | Soil | GVAASRAVDPALTWLEPREPTASRTIALCYPRHRPVSATARSLITAIRAQAA |
Ga0318511_103420341 | 3300031845 | Soil | RRIDGPALTWLEPNDPAAPRVIALCYPRHRPVSATARSLITAIRGQAA |
Ga0318511_103467541 | 3300031845 | Soil | ACIGRLAASRAVDPALTWLLPREPLALREIVLCYPRRRRLSATALALITAIRAQTV |
Ga0318495_101597331 | 3300031860 | Soil | ACIGSTARRTIAVCYPRHRPLTATARTLITAIRSQAG |
Ga0318522_102634741 | 3300031894 | Soil | SRAVDPALTWLEPREPTASRTIALCYPRHRPVSATARSLITAIRAQAA |
Ga0318551_104063913 | 3300031896 | Soil | TWLEPDEATARRTIVLCHARHRPVTATARTLITAIRSQAA |
Ga0310913_104874371 | 3300031945 | Soil | ACIGRVVASRAIDPALTWLEPHEASRGRTIALCYARHRPLTATARTLITAIRAQAVKVPF |
Ga0310911_108115512 | 3300032035 | Soil | EPNDPAAPRVIALCYPRHRPVSATARSLITAIRGQAA |
Ga0318549_101879232 | 3300032041 | Soil | HEPAAPRTIAVCYPRHRPVTATARSLITAIRAQAA |
Ga0318533_103378481 | 3300032059 | Soil | TWLEPNDPAAPRVIALCYPRHRPVSATARSLITAIRGQAA |
Ga0318553_106558081 | 3300032068 | Soil | TWLEPHEPAAPRTIAVCYPRHRPVTATARSLITAIRAQAA |
Ga0318540_101705171 | 3300032094 | Soil | RRAVDPMLTWLEPDEATARRTIAVCYPRHRPLTATARTLITAIRSQAG |
Ga0311301_113178732 | 3300032160 | Peatlands Soil | SRAVDPALTWLEPHEPSAPRTIALCYPRHRPVSATARSLISAIRAQAA |
Ga0306920_1031647352 | 3300032261 | Soil | ACIGRVAASRAVDPALTWLEPDEATARRTIALGYARHRPLTATARTLITAIRSQAA |
Ga0306920_1043289722 | 3300032261 | Soil | ASRAVDPALTWLEPDEATARRTIALGYARHRPLTATARTLITAIRSQAA |
Ga0335080_120607911 | 3300032828 | Soil | PADAPAGRTIALCYARHRPLTATARTLITAIRAQAAY |
Ga0335074_109333751 | 3300032895 | Soil | LTWLEPDDPATPRTIVLCYPRDRPVTATARSLITAIRAQAA |
Ga0335075_104051073 | 3300032896 | Soil | QPPEPAASRTIALCYPQDRPVTATARSLITAIRAQAA |
Ga0335075_107093821 | 3300032896 | Soil | RVAASRAVDPALTWLEPDEPPAPRTIALCYPRHRPVTATARSLITAICALAA |
Ga0335075_112285491 | 3300032896 | Soil | IGRLAASRAVEPALTWLAPREPQPSRVIALCYPRHRHLTATARSLITAIRAQTS |
Ga0335073_115378471 | 3300033134 | Soil | TWLEPDESPPPRTIALCYPRHRPVSATARSLISAIRAQAA |
Ga0334850_097788_2_115 | 3300033828 | Soil | EPQEPTAPRTIAVSYPRHRPLTATARSLITAIRDQAT |
⦗Top⦘ |