NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062955

Metagenome / Metatranscriptome Family F062955

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062955
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 50 residues
Representative Sequence RTELEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Number of Associated Samples 107
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.77 %
% of genes near scaffold ends (potentially truncated) 98.46 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.923 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(26.923 % of family members)
Environment Ontology (ENVO) Unclassified
(29.231 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.17%    β-sheet: 0.00%    Coil/Unstructured: 45.83%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF02518HATPase_c 23.08
PF07568HisKA_2 20.77
PF16363GDP_Man_Dehyd 10.77
PF13185GAF_2 10.00
PF03951Gln-synt_N 6.15
PF01370Epimerase 1.54
PF12697Abhydrolase_6 0.77
PF00561Abhydrolase_1 0.77
PF08445FR47 0.77
PF13492GAF_3 0.77
PF01590GAF 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG3920Two-component sensor histidine kinase, HisKA and HATPase domainsSignal transduction mechanisms [T] 20.77
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 6.15


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.92 %
UnclassifiedrootN/A3.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_117062730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium868Open in IMG/M
3300002568|C688J35102_120550720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1170Open in IMG/M
3300004153|Ga0063455_100840021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300004157|Ga0062590_100717120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia904Open in IMG/M
3300004479|Ga0062595_100966200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300004643|Ga0062591_100314300All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300005171|Ga0066677_10854698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300005178|Ga0066688_10585580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300005181|Ga0066678_10078532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1952Open in IMG/M
3300005186|Ga0066676_10368305Not Available964Open in IMG/M
3300005339|Ga0070660_101685298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300005439|Ga0070711_100109005All Organisms → cellular organisms → Bacteria2029Open in IMG/M
3300005439|Ga0070711_101861087All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005468|Ga0070707_101751154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300005471|Ga0070698_101458268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300005518|Ga0070699_101658601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300005526|Ga0073909_10114939All Organisms → cellular organisms → Bacteria → Terrabacteria group1082Open in IMG/M
3300005543|Ga0070672_100877056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium792Open in IMG/M
3300005546|Ga0070696_101877922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300005566|Ga0066693_10074430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1184Open in IMG/M
3300005843|Ga0068860_100379271All Organisms → cellular organisms → Bacteria → Terrabacteria group1396Open in IMG/M
3300005843|Ga0068860_100601427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1105Open in IMG/M
3300006034|Ga0066656_11130801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300006046|Ga0066652_100109895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2242Open in IMG/M
3300006046|Ga0066652_101069067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300006046|Ga0066652_101640784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300006049|Ga0075417_10395242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300006051|Ga0075364_11172510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300006175|Ga0070712_101015959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300006576|Ga0074047_11310741All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300006618|Ga0101566_10738793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300006624|Ga0101567_10108396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium726Open in IMG/M
3300006800|Ga0066660_11472611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300006871|Ga0075434_101235445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium759Open in IMG/M
3300009012|Ga0066710_101620088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium990Open in IMG/M
3300009012|Ga0066710_103478647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300009012|Ga0066710_103895538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300009012|Ga0066710_104646949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300009093|Ga0105240_11168838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium816Open in IMG/M
3300009137|Ga0066709_100728538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1429Open in IMG/M
3300009137|Ga0066709_102015008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300009147|Ga0114129_12276128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium651Open in IMG/M
3300009148|Ga0105243_10082651All Organisms → cellular organisms → Bacteria2625Open in IMG/M
3300009148|Ga0105243_11774868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300009176|Ga0105242_11320477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia746Open in IMG/M
3300009823|Ga0105078_1063220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300010325|Ga0134064_10226952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300010336|Ga0134071_10788149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300010366|Ga0126379_10996392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium942Open in IMG/M
3300010397|Ga0134124_12614172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300010403|Ga0134123_10162471All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300011269|Ga0137392_11245053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300012199|Ga0137383_10584355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium817Open in IMG/M
3300012204|Ga0137374_10045710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4570Open in IMG/M
3300012204|Ga0137374_11260654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300012204|Ga0137374_11286834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300012206|Ga0137380_11601062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300012207|Ga0137381_10666373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium905Open in IMG/M
3300012208|Ga0137376_11277702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia624Open in IMG/M
3300012208|Ga0137376_11619774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300012209|Ga0137379_10025762All Organisms → cellular organisms → Bacteria5655Open in IMG/M
3300012210|Ga0137378_10467298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1167Open in IMG/M
3300012210|Ga0137378_11831359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300012358|Ga0137368_10060517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3138Open in IMG/M
3300012358|Ga0137368_10172346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1571Open in IMG/M
3300012358|Ga0137368_10195492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1444Open in IMG/M
3300012358|Ga0137368_10448579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria839Open in IMG/M
3300012360|Ga0137375_10521318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1007Open in IMG/M
3300012898|Ga0157293_10300963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300012929|Ga0137404_11535133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300012930|Ga0137407_10160123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1996Open in IMG/M
3300012938|Ga0162651_100088059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300012951|Ga0164300_10619429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia642Open in IMG/M
3300012955|Ga0164298_10939050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300012957|Ga0164303_10624931All Organisms → cellular organisms → Bacteria → Terrabacteria group713Open in IMG/M
3300012977|Ga0134087_10488782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300012984|Ga0164309_11224762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium631Open in IMG/M
3300012987|Ga0164307_10141480All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300012989|Ga0164305_10609689All Organisms → cellular organisms → Bacteria → Terrabacteria group878Open in IMG/M
3300012989|Ga0164305_10722374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium817Open in IMG/M
3300014157|Ga0134078_10597106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300014166|Ga0134079_10494611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300015054|Ga0137420_1432412Not Available1604Open in IMG/M
3300015373|Ga0132257_100097270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3381Open in IMG/M
3300018027|Ga0184605_10393200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300018051|Ga0184620_10195275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300018054|Ga0184621_10011521All Organisms → cellular organisms → Bacteria2572Open in IMG/M
3300018056|Ga0184623_10241656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium825Open in IMG/M
3300018061|Ga0184619_10364815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300018071|Ga0184618_10122260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1041Open in IMG/M
3300018072|Ga0184635_10313141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300018482|Ga0066669_11184923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300020004|Ga0193755_1147190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300021078|Ga0210381_10134525All Organisms → cellular organisms → Bacteria → Terrabacteria group828Open in IMG/M
3300021413|Ga0193750_1007462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2820Open in IMG/M
3300021415|Ga0193694_1007112All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300021510|Ga0222621_1045751All Organisms → cellular organisms → Bacteria → Terrabacteria group914Open in IMG/M
3300022756|Ga0222622_10306441All Organisms → cellular organisms → Bacteria → Terrabacteria group1094Open in IMG/M
3300022756|Ga0222622_10892071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300023058|Ga0193714_1053804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300025900|Ga0207710_10762911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300025910|Ga0207684_10071010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2959Open in IMG/M
3300025917|Ga0207660_10146786All Organisms → cellular organisms → Bacteria1808Open in IMG/M
3300025930|Ga0207701_11580395All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300025939|Ga0207665_11300944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300025940|Ga0207691_10655967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium886Open in IMG/M
3300026121|Ga0207683_10259157Not Available1588Open in IMG/M
3300026538|Ga0209056_10171051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1630Open in IMG/M
3300027006|Ga0209896_1045431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300028713|Ga0307303_10173018Not Available526Open in IMG/M
3300028716|Ga0307311_10087044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium863Open in IMG/M
3300028718|Ga0307307_10090517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium926Open in IMG/M
3300028718|Ga0307307_10199979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300028718|Ga0307307_10252331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300028720|Ga0307317_10038746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1505Open in IMG/M
3300028720|Ga0307317_10189800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium693Open in IMG/M
3300028755|Ga0307316_10253659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300028771|Ga0307320_10350593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300028784|Ga0307282_10010546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3705Open in IMG/M
3300028792|Ga0307504_10285995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300028799|Ga0307284_10014380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2433Open in IMG/M
3300028819|Ga0307296_10284108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium901Open in IMG/M
3300028824|Ga0307310_10006065All Organisms → cellular organisms → Bacteria4580Open in IMG/M
3300028828|Ga0307312_11135244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300028878|Ga0307278_10124198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1159Open in IMG/M
3300028878|Ga0307278_10403765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300028881|Ga0307277_10216929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300028884|Ga0307308_10168101All Organisms → cellular organisms → Bacteria → Terrabacteria group1050Open in IMG/M
3300028885|Ga0307304_10056194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1473Open in IMG/M
3300028885|Ga0307304_10491920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil26.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.31%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.54%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.54%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.77%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.77%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006618Soil microbial communities from the Leymus chinensis steppe, China - without N additionEnvironmentalOpen in IMG/M
3300006624Soil microbial communities from the Leymus chinensis steppe, China - after adding 1.75 g N m- 2, yr-1EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009823Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11706273013300000956SoilQTLERRERDLVSYVDQLQGAMSGSSDSAAWWQSPAGGDGGVF*
C688J35102_12055072023300002568SoilEADVQLREDKMERWRTELEELEQTLERREKDLVSYVDQLQGAMSGAPNDAWWSRPAGGDGGVY*
Ga0063455_10084002113300004153SoilELEELEQTLERREKDLVSYVDQLQGAMSGAPNDAWWSRPAGGDGGVY*
Ga0062590_10071712023300004157SoilEQTLDRRERDLVSYVDQLQGVMSGNDGAWWSRPAGGDGGVR*
Ga0062595_10096620013300004479SoilTELEELERNLDRRERDLISYVDQLQGAMSGSGDAWWSRPAGGDGGV*
Ga0062591_10031430013300004643SoilEELEQTLDRRERDLVSYVDQLQGVMSGNDGAWWSRPAGGDGGVR*
Ga0066677_1085469813300005171SoilADVQIREDKIERWRTELEELEQTLDRRERDLVSYVDQLQGAMSAGDDAWWSRPAGGDGGVR*
Ga0066688_1058558023300005178SoilIERWRTELEELEQNLDRRERDLINYVDQLQGAMAGSNDAWWSRPAGGDGGV*
Ga0066678_1007853233300005181SoilELEELEQNLDRRERDLINYVDQLQGAMAGSNDAWWSRPAGGDGGV*
Ga0066676_1036830513300005186SoilQTLERREKDLVSYVDQLQGAMSGGPTNDAWWSRPAGGDGGVY*
Ga0070660_10168529813300005339Corn RhizosphereERWRTELEELEQTLDRRERDLASYVDQLQGVMANNDDAWWSRPAGSDGGVSPLDRYGA*
Ga0070711_10010900513300005439Corn, Switchgrass And Miscanthus RhizosphereDVQFREDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPVGGDGGVR*
Ga0070711_10186108723300005439Corn, Switchgrass And Miscanthus RhizosphereDVQFREDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR*
Ga0070707_10175115413300005468Corn, Switchgrass And Miscanthus RhizosphereEAEFEADVQFREDRIERWRTELEELEQTLDRRERDLVSYVDQLQGVMSSHDDAWWSRPAGGDGGVR*
Ga0070698_10145826823300005471Corn, Switchgrass And Miscanthus RhizosphereTLDRRERDLVNYVDQLQGVMSGSDSAWWSRPAGGDGGVR*
Ga0070699_10165860123300005518Corn, Switchgrass And Miscanthus RhizosphereVQFREDRIERWRTELEELEQTLDRRERDLVSYVDQLQGVMSGNDGAWWSRPAGGDGGVR*
Ga0073909_1011493913300005526Surface SoilQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR*
Ga0070672_10087705613300005543Miscanthus RhizosphereDRIERWRTELEELEQTLDRREKDLVSYVDQLQGAMSGNDGAWWSRPAGGDGGVR*
Ga0070696_10187792223300005546Corn, Switchgrass And Miscanthus RhizosphereELEELEQTLDRRERDLVSYVDQLQGVMSGNDGAWWSRPAGGDGGVR*
Ga0066693_1007443033300005566SoilERWRTELEELEQTLDRREKDLVSYVDQLQGAMSGATNDAWWSRPAGGDGGVY*
Ga0068860_10037927133300005843Switchgrass RhizosphereERRERDLVSYVDQLQGVMSGSDNAAWWSRPVGGDGGVR*
Ga0068860_10060142713300005843Switchgrass RhizosphereEDRIERWRTELEELEQTLDRREKDLVSYVDQLQGAMSGNDGAWWSRPAGGDGGVR*
Ga0066656_1113080133300006034SoilADVQFREDRIERWRTELEELEQTLDRRERDLVNYVDQLQGAMSGSDGAWWSRPAGGDGGVR*
Ga0066652_10010989513300006046SoilWRTELEELEQTLDRREKDLVSYVDQLQGAMSGATNDAWWSRPAGGDGGVY*
Ga0066652_10106906723300006046SoilELEELEQTLDRRERDLVSYVDQLQGAMSGSGSDAWWQRPAGGDGGVY*
Ga0066652_10164078433300006046SoilRIERWRTELEELEQTLDRRERDLVNYVDQLQGAMSGSDGAWWSRPAGGDGGVR*
Ga0075417_1039524223300006049Populus RhizosphereLREDRMERWRGELEELEQTLERRERDLVSYVDQLQGAMNGSGNDAAWWQRPAGGDGGVY*
Ga0075364_1117251013300006051Populus EndosphereDLDQREAEFEADVQFREDRIERWRTELEELEQTLDRRERDLASYVDQLQGVMANSDDAWWSRPAGGDGGVTPLDRYGA*
Ga0070712_10101595923300006175Corn, Switchgrass And Miscanthus RhizosphereREDRMERWRTELEELEQTLERRERDLVSYVDQLQGAMSGSSDSAAWWQRPAGGDGGVF*
Ga0074047_1131074113300006576SoilELEELEQTLERRERDLVSYVDQLQGVMSGSDDAAWWSRPVGGDGGVR*
Ga0101566_1073879313300006618SoilLEELEQTLERRERDLVSYVDQLQGAMSGVSDDAWWSRPAGGDGGVLS*
Ga0101567_1010839613300006624SoilRMERWRTELEELEQTLERRERDLVSYVDQLQGAMSGVSDDAWWSRPAGGDGGVLS*
Ga0066660_1147261123300006800SoilEQTLDRRERDLVSYVDQLQGAMSGSNDAWWSRPAGGDGGVR*
Ga0075434_10123544523300006871Populus RhizosphereELEELEQTLERREKDLVSYVDQLQGAMVSGTNDAWWQRPAGGDGGVY*
Ga0066710_10162008823300009012Grasslands SoilWRTELEDLEQTLDRRERDLASYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0066710_10347864723300009012Grasslands SoilEAEFEADVQFREDRIERWRTELEDLEQTLDRRERDLASYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0066710_10389553813300009012Grasslands SoilRTELEELEQNLDRRERDLINYVDQLQGAMAGSNDAWWSRPAGGDGGV
Ga0066710_10464694923300009012Grasslands SoilRTELEELEQNLDRRERDLINYVDQLQGAMAGSNDAWWSRPVGGDGGV
Ga0105240_1116883823300009093Corn RhizosphereDRRERDLASYVDQLQGVMANSDDAWWSRPAGGDGGVSPLDRYGA*
Ga0066709_10072853823300009137Grasslands SoilWRTELEDLEQTLDRRERDLASYVDQLQGAMSGSDGAWWSRPAGGDGGVR*
Ga0066709_10201500813300009137Grasslands SoilTLERRERDLVSYVDQMQGAMNGSGNEAWWQRPAGGDGGVY*
Ga0114129_1227612813300009147Populus RhizosphereELEELEQNLDRRERDLISYVDQLQGAMSGSNDAWWSRPAGGDGGVR*
Ga0105243_1008265133300009148Miscanthus RhizosphereADVQFREDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPVGGDGGVR*
Ga0105243_1177486813300009148Miscanthus RhizosphereADVQFREDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR*
Ga0105242_1132047723300009176Miscanthus RhizosphereEADVQFREDRIERWRTELEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR*
Ga0105078_106322013300009823Groundwater SandTELEELEQTLDRREKDLVSYVDQLQGAMSGSNDAWWSRPAGGDGGVR*
Ga0134064_1022695213300010325Grasslands SoilEDRIERWRTELEDLEQTLDRRERDLASYVDQLQGAMSGSDGAWWSRPAGGDGGVR*
Ga0134071_1078814913300010336Grasslands SoilMRDDLASYVDQLQGAMSGSDGAWWSRPAGGDGGVR*
Ga0126379_1099639223300010366Tropical Forest SoilRTELEELEQTLERREKDLTNYVDQLQGAMASPSTDTAWWQRPAGGDGGVY*
Ga0134124_1261417223300010397Terrestrial SoilEDRMERWRTELEELEQTLERRERDLVSYVDQLQGAMSGSSDSAAWWQRPAGGDGGVF*
Ga0134123_1016247133300010403Terrestrial SoilADVQFREDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDKAAWWSRPVGGDGGVR*
Ga0137392_1124505313300011269Vadose Zone SoilELEELEQTLDRRERDLVSYVDQLQGVMSGSDGAWWSRPAGGDGGVR*
Ga0137383_1058435523300012199Vadose Zone SoilREDRIERWRTELEDLEQTLDRRERDLASYVDQLQGAMSGSDGAWWTRPAGGDGGVR*
Ga0137374_1004571013300012204Vadose Zone SoilERWRTELEELEQTLERRERDLVSYVDQLQGVMSGHNDAWWSRPAGGDGGVGR*
Ga0137374_1126065413300012204Vadose Zone SoilIERWRTELEALEQTLERRERDLVSYVDQLQGVMSGSDDAWWSRPAGGDGGVR*
Ga0137374_1128683413300012204Vadose Zone SoilDVQIREDRIERWGTELEELERTLDRRERDLVSYVDQLQGAMSVGHDEAWWSRPAGGDGGVR*
Ga0137380_1160106213300012206Vadose Zone SoilERDLVNYVDQLQGVMSGSDDAWWSRPAGGDGGVR*
Ga0137381_1066637323300012207Vadose Zone SoilADVQFREDRIERWRTELEDLEQTLDRRERDLASYVDQLQGAMSGSDGAWWSRPAGGDGGVR*
Ga0137376_1127770223300012208Vadose Zone SoilEELEQTLDRRERDLVSYVDQLQGVMSGSDGAWWSRPAGGDGGVR*
Ga0137376_1161977413300012208Vadose Zone SoilERRERDLVSYVDQLQGVMSSHADDAWWSRPAGGDGGVR*
Ga0137379_1002576273300012209Vadose Zone SoilWRTELEELEQTLDRRERDLVSYVDQLQGAMSAADDAWWSRPAGGDGGVR*
Ga0137378_1046729813300012210Vadose Zone SoilELEQTLDRRERDLVSYVDQLQGAMSAGDDAWWSRPAGGDGGVR*
Ga0137378_1183135913300012210Vadose Zone SoilLEQTLDRRERDLVNYVDQLQGAMSGNDGAWWSRPAGGDGGVR*
Ga0137368_1006051763300012358Vadose Zone SoilSLDRRERDIVSYVDQLQGAISGDDAWWSRPAGGDGGVRP*
Ga0137368_1017234613300012358Vadose Zone SoilRERDIVSYVDQLQGAISGDDAWWSRPAGGDGGVRP*
Ga0137368_1019549213300012358Vadose Zone SoilRRERDLVSYVDQLQGAMSGVHDDAWWSRPAGGDGGVR*
Ga0137368_1044857933300012358Vadose Zone SoilEFEADVQFREDRIERWRTELEELEQNLDRRERDLVSYVDQLQGAMTGGNDAWWSQPAGGDGGVRG*
Ga0137375_1052131833300012360Vadose Zone SoilRWRTELDELEQTLDRRERDLVSYVDQLQGVMSNSADAWWSRPAGGDGGVPH*
Ga0157293_1030096313300012898SoilRIERWRTELEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR*
Ga0137404_1153513313300012929Vadose Zone SoilIERWRTELEELEQTLDRRERDLASYVDQLQGVMSGSDGAWWSRPAGGDGGVR*
Ga0137407_1016012313300012930Vadose Zone SoilQREAEFEADVQFREDRIERWRTELEDLEQTLDRRERDLASYVDQLQGVMSGSDGAWWSRPAGGDGGVR*
Ga0162651_10008805923300012938SoilLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR*
Ga0164300_1061942923300012951SoilEQTLDRREKDLVSYVDQLQGAMSGNDGAWWSRPAGGDGGVR*
Ga0164298_1093905013300012955SoilRWRTELEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR*
Ga0164303_1062493113300012957SoilRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR*
Ga0134087_1048878213300012977Grasslands SoilQTLERRERDLVSYVDQLQGAMSSGNDAWWSRPAGGDGGVLS*
Ga0164309_1122476213300012984SoilRREKDLVSYVDQLQGAMSGNDGAWWSRPAGGDGGVR*
Ga0164307_1014148013300012987SoilEDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNSAWWSRPAGGDGGVR*
Ga0164305_1060968913300012989SoilDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNSAWWSRPAGGDGGVR*
Ga0164305_1072237423300012989SoilEFEADVQFREDRIERWRTELEELEQTLDRREKDLVSYVDQLQGAMSGNDGAWWSRPAGGDGGVR*
Ga0134078_1059710623300014157Grasslands SoilELREAEFEADVQLREDRMERWRTELEELEQTLDRREKDLVSYVDQLQGAMGGVSNDAWWSRPAGGDGGV*
Ga0134079_1049461113300014166Grasslands SoilMERWRTELEELEQTLDRREKDLVSYVDQLQGAMSGATNDAWWSRPAGGDGGVY*
Ga0137420_143241253300015054Vadose Zone SoilERDLVNYVDQLQGAMSGNDGAWWSRPAGGDGGVR*
Ga0132257_10009727063300015373Arabidopsis RhizosphereDLVSYVDQLQGAMSGSSDSAAWWQRPAGGDGGVF*
Ga0184605_1039320013300018027Groundwater SedimentEDLEQTLDRRERDLASYVDQLQGAMSSSDGAWWSRPAGGDGGVR
Ga0184620_1019527523300018051Groundwater SedimentDRRERDLVSYVDQLQGAMSGNDGAWWSRPAGGDGGVR
Ga0184621_1001152113300018054Groundwater SedimentREDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0184623_1024165613300018056Groundwater SedimentEELEQTLDRREKDLVNYVDQLQGAMSGSDDAWWQRPAGGDGGVQH
Ga0184619_1036481523300018061Groundwater SedimentTLERREKDLISYVDQLQGAMSSSNDAWWSRPAGGDGGVLG
Ga0184618_1012226023300018071Groundwater SedimentEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0184635_1031314113300018072Groundwater SedimentQFREDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0066669_1118492323300018482Grasslands SoilLDRRERDLISYVDQLQGAMSGSNDAWWSRPAGGDGGA
Ga0193755_114719013300020004SoilQREAEFEADVQFREDRIERWRTELEDLEQTLDRRERDLASYVDQLQGAMSSSDGAWWSRPAGGDGGVR
Ga0210381_1013452513300021078Groundwater SedimentERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0193750_100746213300021413SoilREAEFEADVQFREDRIERWRTELEDLEQTLDRRERDLASYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0193694_100711213300021415SoilRWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0222621_104575113300021510Groundwater SedimentVQFREDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0222622_1030644123300022756Groundwater SedimentELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0222622_1089207113300022756Groundwater SedimentELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0193714_105380423300023058SoilEAEFEADVQFREDRIERWRTELEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0207710_1076291123300025900Switchgrass RhizosphereEQTLDRREKDLVSYVDQLQGAMSGNDGAWWSRPAGGDGGVR
Ga0207684_1007101053300025910Corn, Switchgrass And Miscanthus RhizosphereELEELEQTLDRRERDLVSYVDQLQGVMSSHDDAWWSRPAGGDGGVR
Ga0207660_1014678613300025917Corn RhizosphereRERDLVSYVDQLQGVMSGSDNAAWWSRPVGGDGGVR
Ga0207701_1158039523300025930Corn, Switchgrass And Miscanthus RhizosphereTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPVGGDGGVR
Ga0207665_1130094413300025939Corn, Switchgrass And Miscanthus RhizosphereIERWRTELEELEQTLDRRERDLVNYVDQLQGAMSGSDSAWWSRPAGGDGGVR
Ga0207691_1065596723300025940Miscanthus RhizosphereAEFEADVQFREDRIERWRTELEELEQTLDRREKDLVSYVDQLQGAMSGNDGAWWSRPAGGDGGVR
Ga0207683_1025915713300026121Miscanthus RhizosphereEDRIERWRTELEELEQTLDRREKDLVSYVDQLQGAMSGNDGAWWSRPAGGDGGVR
Ga0209056_1017105113300026538SoilLDRRERDLVNYVDQLQGAMSGNDGAWWSRPAGGDGGVR
Ga0209896_104543113300027006Groundwater SandEFEADVQFREDRIERWRTELEELEQTLDRREKDLVSYVDQLQGAMSGSNDAWWSRPAGGDGGVR
Ga0307303_1017301823300028713SoilTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0307311_1008704423300028716SoilWRTELEELEQTLDRRERDLVSYVDQHQGAMSGSDGAWWSRPAGGDGGVR
Ga0307307_1009051723300028718SoilTELEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0307307_1019997913300028718SoilRTELEELEQTLERREKDLISYVDQLQGAMSSSNDAWWSRPAGGDGGVLG
Ga0307307_1025233113300028718SoilLERRERDLVSYVDQLQGVMSTHGDEAWWSRPAGGDGGVR
Ga0307317_1003874613300028720SoilQTLDRRERDLVSYVDQLQGFMSSSTDEAWWSRPAGGDGGVR
Ga0307317_1018980013300028720SoilRTELEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0307316_1025365923300028755SoilLEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0307320_1035059313300028771SoilQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0307282_1001054613300028784SoilEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0307504_1028599523300028792SoilEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0307284_1001438013300028799SoilLEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0307296_1028410813300028819SoilAEFEADVQFREDRIERWRTELEDLEQTLDRRERDLASYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0307310_1000606513300028824SoilDVQFREDRIERWRTELEELEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGV
Ga0307312_1113524413300028828SoilRTELEELEQTLERRERDLVSYVDQLQGVMSTHGDEAWWSRPAGGDGGVR
Ga0307278_1012419813300028878SoilLEELEQTLDRRERDLVSYVDQLQGVMSSHADDAWWSRPAGGDGGVR
Ga0307278_1040376523300028878SoilDARTTELKRLEGDLELREAEFEADVQFREDRIERWRTELEELEQTLDRRERDLVSYVDQLQGAMSGSDGAWWSRPAGGDGGVR
Ga0307277_1021692913300028881SoilTELEELEQTLERRERDLVSYVDQLQGVMSSHGDDAWWSRPAGGDGGVR
Ga0307308_1016810113300028884SoilEQTLERRERDLVSYVDQLQGVMSGSDNAAWWSRPAGGDGGVR
Ga0307304_1005619423300028885SoilQREAEFEADVQFREDRIERWRTELEELEQTLDRRERDLVSYVDQLQGAMSSNDGAWWSRPAGGDGGVR
Ga0307304_1049192013300028885SoilREKDLISYVDQLQGAMSSSNDAWWSRPAGGDGGVLG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.