NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F062885

Metagenome Family F062885

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062885
Family Type Metagenome
Number of Sequences 130
Average Sequence Length 108 residues
Representative Sequence MNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Number of Associated Samples 97
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 72.31 %
% of genes near scaffold ends (potentially truncated) 21.54 %
% of genes from short scaffolds (< 2000 bps) 76.92 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.692 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(23.846 % of family members)
Environment Ontology (ENVO) Unclassified
(26.923 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(36.154 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 2.26%    β-sheet: 33.08%    Coil/Unstructured: 64.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF00118Cpn60_TCP1 17.69
PF08713DNA_alkylation 9.23
PF13181TPR_8 8.46
PF13414TPR_11 7.69
PF07719TPR_2 2.31
PF01370Epimerase 1.54
PF00072Response_reg 0.77
PF16363GDP_Man_Dehyd 0.77
PF07610DUF1573 0.77
PF00665rve 0.77
PF05050Methyltransf_21 0.77
PF01406tRNA-synt_1e 0.77
PF00166Cpn10 0.77
PF00515TPR_1 0.77
PF01613Flavin_Reduct 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 17.69
COG49123-methyladenine DNA glycosylase AlkDReplication, recombination and repair [L] 9.23
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.77
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.77
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.77
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.77
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.77
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.77
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.77
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.77
COG4584TransposaseMobilome: prophages, transposons [X] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000094|WSSedA1TDRAFT_c026067All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium697Open in IMG/M
3300000309|WSSedA1BaDRAFT_1009498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1664Open in IMG/M
3300000310|WSSedA1Ba2DRAFT_1037755All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium569Open in IMG/M
3300000917|WSSedA2C3DRAFT_1014424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1164Open in IMG/M
3300001281|JGI20213J14113_1011446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1315Open in IMG/M
3300002961|JGI11641J44799_10114302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium757Open in IMG/M
3300003432|JGI20214J51088_10097963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2064Open in IMG/M
3300003432|JGI20214J51088_10127945All Organisms → cellular organisms → Bacteria → Proteobacteria1798Open in IMG/M
3300003858|Ga0031656_10167711All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300003910|JGI26437J51864_10007203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2471Open in IMG/M
3300004049|Ga0055493_10018205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1097Open in IMG/M
3300004051|Ga0055492_10078928All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium707Open in IMG/M
3300004481|Ga0069718_15411667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium518Open in IMG/M
3300004481|Ga0069718_16289542All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium619Open in IMG/M
3300005216|Ga0068994_10060665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium898Open in IMG/M
3300005252|Ga0068712_1027068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2855Open in IMG/M
3300005254|Ga0068714_10143324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1091Open in IMG/M
3300005254|Ga0068714_10169355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium962Open in IMG/M
3300006224|Ga0079037_100026260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4221Open in IMG/M
3300006224|Ga0079037_100368628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1352Open in IMG/M
3300006224|Ga0079037_101586909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium653Open in IMG/M
3300006930|Ga0079303_10055552All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1411Open in IMG/M
3300007072|Ga0073932_1005890All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria12951Open in IMG/M
3300009009|Ga0105105_10003874All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5950Open in IMG/M
3300009037|Ga0105093_10003932All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5845Open in IMG/M
3300009053|Ga0105095_10136006All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1338Open in IMG/M
3300009075|Ga0105090_10456969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium777Open in IMG/M
3300009078|Ga0105106_10048841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium3128Open in IMG/M
3300009078|Ga0105106_10287854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1191Open in IMG/M
3300009081|Ga0105098_10021902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2453Open in IMG/M
3300009082|Ga0105099_10456570All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium769Open in IMG/M
3300009085|Ga0105103_10014896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium3778Open in IMG/M
3300009085|Ga0105103_10236136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium985Open in IMG/M
3300009087|Ga0105107_10642532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium738Open in IMG/M
3300009091|Ga0102851_10006752All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria7528Open in IMG/M
3300009091|Ga0102851_11667869All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium715Open in IMG/M
3300009091|Ga0102851_11901086All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium672Open in IMG/M
3300009111|Ga0115026_10050643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2295Open in IMG/M
3300009111|Ga0115026_10080308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1923Open in IMG/M
3300009111|Ga0115026_10108755All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1708Open in IMG/M
3300009131|Ga0115027_10057248All Organisms → cellular organisms → Bacteria2041Open in IMG/M
3300009131|Ga0115027_10850891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium700Open in IMG/M
3300009146|Ga0105091_10029165All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2397Open in IMG/M
3300009165|Ga0105102_10487050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium668Open in IMG/M
3300009167|Ga0113563_10816972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1057Open in IMG/M
3300009167|Ga0113563_10968339All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium977Open in IMG/M
3300009168|Ga0105104_10062872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2010Open in IMG/M
3300009169|Ga0105097_10012568All Organisms → cellular organisms → Bacteria4389Open in IMG/M
3300009179|Ga0115028_10052280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2071Open in IMG/M
3300009179|Ga0115028_10174938All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1329Open in IMG/M
3300009179|Ga0115028_10433149All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium935Open in IMG/M
3300009179|Ga0115028_10510599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium876Open in IMG/M
3300009430|Ga0114938_1098251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1066Open in IMG/M
3300009509|Ga0123573_10287384All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300010413|Ga0136851_10044422All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4869Open in IMG/M
3300011340|Ga0151652_13153897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1062Open in IMG/M
3300012152|Ga0137347_1017484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1013Open in IMG/M
3300012964|Ga0153916_13367515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Candidatus Magnetomorum → unclassified Candidatus Magnetomorum → Candidatus Magnetomorum sp. HK-1502Open in IMG/M
(restricted) 3300013136|Ga0172370_10065851All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium2788Open in IMG/M
3300014313|Ga0075347_1026168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1113Open in IMG/M
3300014319|Ga0075348_1184254All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium570Open in IMG/M
3300014324|Ga0075352_1171945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium623Open in IMG/M
3300017966|Ga0187776_11330591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium544Open in IMG/M
3300018068|Ga0184636_1105244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium969Open in IMG/M
3300018070|Ga0184631_10360223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium602Open in IMG/M
3300022554|Ga0212093_1013334All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini7300Open in IMG/M
(restricted) 3300024054|Ga0233425_10034068All Organisms → cellular organisms → Bacteria3980Open in IMG/M
3300025950|Ga0210134_1009334All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1410Open in IMG/M
3300025968|Ga0210103_1000403All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini8409Open in IMG/M
3300026026|Ga0210129_1026944All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium972Open in IMG/M
3300026464|Ga0256814_1009898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium915Open in IMG/M
3300026476|Ga0256808_1011636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1072Open in IMG/M
3300027592|Ga0209270_1028167All Organisms → cellular organisms → Bacteria2243Open in IMG/M
3300027675|Ga0209077_1105873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium781Open in IMG/M
3300027690|Ga0209164_1052688All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1881Open in IMG/M
3300027690|Ga0209164_1198187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium675Open in IMG/M
3300027693|Ga0209704_1017456All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1792Open in IMG/M
3300027713|Ga0209286_1011048All Organisms → cellular organisms → Bacteria → Proteobacteria3205Open in IMG/M
3300027713|Ga0209286_1011650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium3132Open in IMG/M
3300027715|Ga0208665_10204423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium622Open in IMG/M
3300027721|Ga0209492_1007315All Organisms → cellular organisms → Bacteria → Proteobacteria3645Open in IMG/M
3300027743|Ga0209593_10212134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium680Open in IMG/M
3300027811|Ga0256868_10256592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium731Open in IMG/M
3300027871|Ga0209397_10037758All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales1703Open in IMG/M
3300027877|Ga0209293_10033084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1988Open in IMG/M
3300027887|Ga0208980_10226438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1090Open in IMG/M
3300027887|Ga0208980_10562664All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium651Open in IMG/M
3300027890|Ga0209496_10040756All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales1692Open in IMG/M
3300027890|Ga0209496_10520293All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium634Open in IMG/M
3300027972|Ga0209079_10134114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium848Open in IMG/M
3300029827|Ga0134606_10108772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium871Open in IMG/M
3300030613|Ga0299915_10029751All Organisms → cellular organisms → Bacteria4091Open in IMG/M
3300031873|Ga0315297_10375617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1191Open in IMG/M
3300032156|Ga0315295_10557991All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1162Open in IMG/M
3300032163|Ga0315281_11287304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium726Open in IMG/M
3300032163|Ga0315281_12318681All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium505Open in IMG/M
3300032342|Ga0315286_11419623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium668Open in IMG/M
3300032397|Ga0315287_10505774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1434Open in IMG/M
3300032516|Ga0315273_11118284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium999Open in IMG/M
3300033406|Ga0316604_10297022All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium880Open in IMG/M
3300033406|Ga0316604_10401137All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium752Open in IMG/M
3300033406|Ga0316604_10545253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium638Open in IMG/M
3300033408|Ga0316605_10455683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1168Open in IMG/M
3300033413|Ga0316603_10075193All Organisms → cellular organisms → Bacteria2576Open in IMG/M
3300033413|Ga0316603_11933120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium558Open in IMG/M
3300033414|Ga0316619_10812339All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium800Open in IMG/M
3300033414|Ga0316619_10880521All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium771Open in IMG/M
3300033416|Ga0316622_100805985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1091Open in IMG/M
3300033416|Ga0316622_103412773All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium500Open in IMG/M
3300033418|Ga0316625_100115671All Organisms → cellular organisms → Bacteria1561Open in IMG/M
3300033419|Ga0316601_100049338All Organisms → cellular organisms → Bacteria3102Open in IMG/M
3300033419|Ga0316601_101002822All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium833Open in IMG/M
3300033419|Ga0316601_101883555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium603Open in IMG/M
3300033419|Ga0316601_102422158All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium528Open in IMG/M
3300033434|Ga0316613_10030950All Organisms → cellular organisms → Bacteria3011Open in IMG/M
3300033434|Ga0316613_11266249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium508Open in IMG/M
3300033480|Ga0316620_10365379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1291Open in IMG/M
3300033481|Ga0316600_10403979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium937Open in IMG/M
3300033482|Ga0316627_102239003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium572Open in IMG/M
3300033483|Ga0316629_10083314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1745Open in IMG/M
3300033485|Ga0316626_10241257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1443Open in IMG/M
3300033486|Ga0316624_10230151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1457Open in IMG/M
3300033487|Ga0316630_11811721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium557Open in IMG/M
3300033488|Ga0316621_10751962All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium709Open in IMG/M
3300033513|Ga0316628_100556444All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales1489Open in IMG/M
3300033513|Ga0316628_100846150All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1208Open in IMG/M
3300033513|Ga0316628_101568978All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium877Open in IMG/M
3300033513|Ga0316628_102390902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium699Open in IMG/M
3300033521|Ga0316616_100557791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1332Open in IMG/M
3300033557|Ga0316617_101174679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium760Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil23.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment16.92%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland10.00%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland7.69%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands6.15%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.38%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.62%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture4.62%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.31%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.54%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.54%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment1.54%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.54%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.54%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.54%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.77%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.77%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.77%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.77%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.77%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000094Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 TuleEnvironmentalOpen in IMG/M
3300000309Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300000310Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300000917Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A2 CattailEnvironmentalOpen in IMG/M
3300001281Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300002961Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003858Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DIEnvironmentalOpen in IMG/M
3300003910Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LWEnvironmentalOpen in IMG/M
3300004049Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2EnvironmentalOpen in IMG/M
3300004051Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005216Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2EnvironmentalOpen in IMG/M
3300005252Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaGEngineeredOpen in IMG/M
3300005254Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaGEngineeredOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007072Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaGEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009430Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big SpringEnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300012152Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013136 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5mEnvironmentalOpen in IMG/M
3300014313Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018070Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1EnvironmentalOpen in IMG/M
3300022554Dewar_combined assemblyEnvironmentalOpen in IMG/M
3300024054 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MGEnvironmentalOpen in IMG/M
3300025950Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025968Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026026Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026464Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5EnvironmentalOpen in IMG/M
3300026476Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6EnvironmentalOpen in IMG/M
3300027592Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027690Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027713Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027715Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027811Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeqEnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300029827Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047EnvironmentalOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
WSSedA1TDRAFT_02606713300000094WetlandMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLPEFREGETLTMAFHDSGSVLPAEHLKTAVRKIKRNEEGKLKGQYLVDLEILKSYH*
WSSedA1BaDRAFT_100949833300000309WetlandMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
WSSedA1Ba2DRAFT_103775513300000310WetlandNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLPEFREGETLTMAFHDSGSVLPAEHLKTAVRKIKRNEEGKLKGQYLVDLEILKSYH*
WSSedA2C3DRAFT_101442423300000917WetlandMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH*
JGI20213J14113_101144633300001281WetlandMNLSTLREVQQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH*
JGI11641J44799_1011430223300002961WetlandNQGTSGACEVEVGPLRFKVWHKSPTFLCLLAGQDPSTLPEFREGETLTMAYHDAGSILPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
JGI20214J51088_1009796323300003432WetlandMNLSTLHEVPQANQESSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDVGSILPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
JGI20214J51088_1012794523300003432WetlandMNLSALREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
Ga0031656_1016771123300003858Freshwater Lake SedimentMNTSTLREVPRANQETSSACMVEVGPLRFKVWHKSPTYLCLLAEQDPSTLLEFREGEMLSMEYYDADSILPSEHLKTSVRKIKR
JGI26437J51864_1000720313300003910Freshwater Lake SedimentMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRNERGKLKGQYLVDLEILKSYH*
Ga0055493_1001820523300004049Natural And Restored WetlandsMNLSTLREASQTTQETSGACEVEIGSLRFKVWHKSPTYLCLLAGYDTSALLELREGEMLSLVYHGVGSDLPSEHLKTAIRKIKRNDGGKLKGQYLVDLEILKSYH*
Ga0055492_1007892813300004051Natural And Restored WetlandsMNLSTLREASQTTQETSGACEVEIGSLRFKVWHKSPTYLCLLAGYDASALLELREGEMLSLVYHGVGSDLPSEHLKTAIRKIKRNDGGKLKGQYLVDLEILKSYH*
Ga0069718_1541166713300004481SedimentMNFSTVHEVPQANQEPFSACEVEVGPLRLKVWHKSPTYLCLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0069718_1628954213300004481SedimentMNASTLREVPHANQETSRACMVEVGPLRFKVWHKSSTYLCLLAEQDPSALLEFRQGEMLSMEYYDAYSILPSEHLKTSVRKIKRNDGGRLKGQYLVDLEILKSYH*
Ga0068994_1006066523300005216Natural And Restored WetlandsMNLSTLREVPQANPGISSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
Ga0068712_102706833300005252Enrichment CultureMNVSTLHELPRPNQEITDGCSVEVGPLRFKVWHKSPTYLCLLAGQDPSALFEFREGTTLTLEYFDGNSSLPSERLNTAVRKIKRNVGERLKGQYLVDLEILKSYH*
Ga0068714_1014332423300005254Enrichment CultureMNVSTLREMPRPSQEITGGCSVEVGPLRFKVWHKSPTYLCLLAGQDPDALFEFREGATLTLAYFDGNSILPSERLSTAVRKIKRNAGERLKGQYLVDLEILKSYH*
Ga0068714_1016935513300005254Enrichment CultureMNVSTLREMPRPNPAIASGCSVEVGPLRFKVWHKSPTYLCLLAGQDPSALCEFREGTTLTLEYFDGNSRLPSERLNTAVRKIKRNVGERLKGQYLVDLEILKSYH*
Ga0079037_10002626023300006224Freshwater WetlandsMNLSTLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKAAVRKIKRNDGGKLNGEYLVDLEILKSYH*
Ga0079037_10036862813300006224Freshwater WetlandsMNLSTLHEVPQVTQEPFSACEVEVGALRFKVWHKSPTYLCFLAGQDPSTLLEFREGKTLTIVYYNSGSSFPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0079037_10158690923300006224Freshwater WetlandsGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLPEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
Ga0079303_1005555213300006930Deep SubsurfaceMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLPEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
Ga0073932_100589093300007072Hot Spring SedimentMNVSTLREIPRSKQEITGGCSVEMGPLRFKVWHKSPTYLCLLAGQDPSAFLEFREGATLTLEYFDGNSSLPSERLNTAVRKIKRNAGERLKGQYLVDLEILKSYH*
Ga0105105_1000387453300009009Freshwater SedimentVQVLVLREFYTRRNAIMNLSTVHEVPQANQEPFSACEVEVGPLRLKVWHKSPTYICLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0105093_1000393243300009037Freshwater SedimentLDEAAKRRREIMDFSPLRELPRANQGSSSACLVEVGPLRFKVWHKSPTYLCLLADEDPSTLLEFRVGKMLMMEYHDADSSLPSERLTTAVRKIKRNDGGKLKGQYLVDLEILKSYH*
Ga0105095_1013600633300009053Freshwater SedimentLDEAAKRRREIMDFSPLRELPRANQGSSRACLVEVGPLRFKVWHKSPTYLCLLADEDPSTLLEFRVGKMLMMEYHDADSSLPSERLTTAVRKIKRNDGGKLKGQYLVDLEILKSYH*
Ga0105090_1045696913300009075Freshwater SedimentVQVLVLRESYTRRNAIMNLSTVHEVPQANREPFSACEVEVGPLRLKVWHKSPTYLCLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0105106_1004884133300009078Freshwater SedimentVQARSLDEAAKRRREIMDFSPLRELPRANQGSSSACLVEVGPLRFKVWHKSPTYLCLLADEDPSTLLEFRVGKMLMMEYHDADSSLPSERLTTAVRKIKRNDGGKLKGQYLVDLEILKSYH*
Ga0105106_1028785423300009078Freshwater SedimentVQVLVLREFYTRRNAIMNLSTVHEVPQANQEPFSACEVEVGPLRLKVWHKSPTYICLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERG
Ga0105098_1002190223300009081Freshwater SedimentVQVLVLRESYTRRNAIMNLSTVHEVPQANQEPFTACEVEVGPLRLKVWHKSPTYLCLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0105099_1045657013300009082Freshwater SedimentVQARSLDEAAKRRREIMDFSPLRELPRANQGSSRACLVEVGPLRFKVWHKSPTYLCLLADEDPSTLLEFRVGKMLMMEYHDADSSLPSERLTTAVRKIKRNDGGKLKGQYLVDLEILKSYH*
Ga0105103_1001489653300009085Freshwater SedimentMNLSTVHEVPQANQEPFTACEVEVGPLRLKVWHKSPTYLCLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0105103_1023613623300009085Freshwater SedimentMQLLLQREPYTMRNVIMNLPTLREVPQANEEPSCACEAEVGPLRFKVWHKSPTYLCILAGQDPDTLLEFREGETLTIAYHDLSSSVPSEHLKTAVRRIKRNDRGRLKGQYLVDLEILKSYH*
Ga0105107_1064253213300009087Freshwater SedimentMNFSPLRELPRANQGSSRACLVEVGPLRFKVWHKSPTYLCLLADEDPSTLLEFRVGKMLMMEYHDADSSLPSERLTTAVRKIKRNDGGKLKGQYLVDLEILKS
Ga0102851_1000675243300009091Freshwater WetlandsMDSAVYFCAVRPLKETAKRRRTIMNLSTLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKAAVRKIKRNDGGKLNGEYLVDLEILKSYH*
Ga0102851_1166786913300009091Freshwater WetlandsMPQANQKPFSACEVEVGPLRFKVWHKSPTYLCLLAEHDPSTLLEFREGEMLTLAYHDFGSNLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0102851_1190108623300009091Freshwater WetlandsMNLSTLREVQQADLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
Ga0115026_1005064333300009111WetlandMNLSTLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKAAVRKIKRNEGGKLNGEYLVDLEILKSYH*
Ga0115026_1008030823300009111WetlandMVIKLLANLIFAVSGMDSAVYFCAGTVFHRVLLRRNVIMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRNERGKLKGQYLVDLEILKSYH*
Ga0115026_1010875533300009111WetlandMNLSTLREVQQADLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH*
Ga0115027_1005724823300009131WetlandMVIKLLANLIFAFSGMDSAVYFCACTVFHRVLLRRNVIMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRNERGKLKGQYLVDLEILKSYH*
Ga0115027_1085089123300009131WetlandMSLSTLHEVPQADKEPFSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGKTLTIVYYDSDSSFPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0105091_1002916533300009146Freshwater SedimentMQLLLQREPYTMRNVIMNLPTLREVPQANEEPSCACEAEVGPLRFKVWHKSPTYLCLLAGEDPDTLLEFREGETLTIAYHDPSSSVPSEHLKTAVRRIKRNDRGRLKGQYLVDLEILKSYH*
Ga0105102_1048705023300009165Freshwater SedimentMQLLLQREPYTMRNVIMNLPTLREVPQANEEPSCACEAEVGPLRFKVWHKSPTYLCLLAGEDPDTLLEFREGETLTIAYHDLSSSVPSEHLKTAVRRIKRN
Ga0113563_1081697213300009167Freshwater WetlandsMNLSTLHEVPQVTQEPFSACEVEVGALRFKVWHKSPTYLCFLAGQDPSTLLEFREGKTLTIVYYDSGSSFPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0113563_1096833913300009167Freshwater WetlandsEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRNERGKLKGQYLVDLEILKSYH*
Ga0105104_1006287223300009168Freshwater SedimentMRNVIMNLPTLREVPQANEEPSCACEAEVGPLRFKVWHKSPTYLCILAGQDPDTLLEFREGETLTIAYHDLSSSVPSEHLKTAVRRIKRNDRGRLKGQYLVDLEILKSYH*
Ga0105097_1001256843300009169Freshwater SedimentLLYKWLLNHWQTSLLLFLAWIVQCTFVQVLVLRESYTRRNAIMNLSTVHEVPQANQEPFTACEVEVGPLRLKVWHKSPTYLCLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0115028_1005228033300009179WetlandMVIKPLANLIFAVSGMDSAVYFCAGTVFHRVLLRRNVIMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0115028_1017493823300009179WetlandMQFLAQIVQCTIVHALVFKKFSKRRKVIMNLSTLYEVPQATHEPFSACEAEVGPLRFKVWHKSPTYLCLLAGRNPSTLIGFREGERLTVACREAGSSFPSEHFTTAVRKIKRNESGKLKGQYLVDLEILKSYH*
Ga0115028_1043314923300009179WetlandMNLSTLHEVPQADKEPFSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGKTLTIVYYDSDSSFPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH*
Ga0115028_1051059923300009179WetlandMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLPEFREGETLTMAFHDSGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
Ga0114938_109825113300009430GroundwaterMVFKLLANLIFAVSGMDSAVYFCAGTVFHRVLLRRNVIMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRNERGKLKGQYLVDLEILKSYH*
Ga0123573_1028738433300009509Mangrove SedimentMLLLREFSERRKVIMNLSTLREGPETGEGTSGACEVEIDSLRFKVWHKSPTYLCLLAGPDPSALLELREGRMLTLAYYGDGSNLPSEHLKTAIRKIKRNDGGKLKGQYLVDLEILKSYH*
Ga0136851_1004442253300010413Mangrove SedimentVKVLLLREFSERRKVIMNLSTLREASQTSEETSGACEVEIGSLRFKVWHKSPTYLCLLAGHDPSALLEFREGKMLTLVYHGVGSDLPSEHLRTAIRKIKRNDEGKLKGQYLVDLEILKSYH*
Ga0151652_1315389733300011340WetlandMNLSTLREGQQADLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH*
Ga0137347_101748423300012152SoilMVEVGPLRFKVWHKSSTYLCLLAEQDPSALLEFREGEMLSMEYYDADSILPSEHLKTSVRKIKRNDGGRLKGQYLVDLEIPKSYH*
Ga0153916_1336751513300012964Freshwater WetlandsMSLSSLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSNLLEFREGEMLTMEYYDTGSSLPSEHLKTAVRKIKRNDAGRLRGQYLVDL
(restricted) Ga0172370_1006585133300013136FreshwaterMSAIRKNIVMNLSTLYEVPQAKQEPFSACEVEVGLLRFKVWHRSPTYLCLLAGQNPSTLLEFREGEMLTVAYHGFDSTVPSEHLTAAIRKIKRNETGKLKGQYLVDLEILKSYH*
Ga0075347_102616823300014313Natural And Restored WetlandsVKVLLFREFYERRKVIMNLSTLREASQTTQETSGACEVEIGSLRFKVWHKSPTYLCLLAGYDTSALLELREGEMLSLVYHGVGSDLPSEHLKTAIRKIKRNDGGKLKGQYLVDLEILKSY
Ga0075348_118425413300014319Natural And Restored WetlandsVKALLFREFYERRKVIMNLSTLREASQTTQETSGACEVEIGSLRFKVWHKSPTYLCLLAGYDTSALLELREGEMLSLVYHGVGSDLPSEHFKTAIRKIKRNDGGKLKGQYLVDLEILKSYH*
Ga0075352_117194513300014324Natural And Restored WetlandsMNLSTLREVPQANQGTSGACEVEVGPLRFKVWHKSPTFLCLLAGQDLSTLPEFREGETLTMAYHDAGSILPAEQLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH*
Ga0187776_1133059113300017966Tropical PeatlandMNLSTLREVPQENRGTSGACEVEVGPLRFKVWHKSPTFLCLLAGQDPSTLLEFREGETLTMAYHDVGSILPAEHLKTAVRKIKRNEGGKLKGQYLVDLEI
Ga0184636_110524423300018068Groundwater SedimentMTVSTLRAAPRANQATSSACMVADGPLRYKATHQPTTHLCLLAEQDPSALLEFREGEMLSMEYYDADSILPSEHLKTSVRKIKRNDGGRLKGQYLVDLEILKSYH
Ga0184631_1036022313300018070Groundwater SedimentMNVSTLREVPRANQETCSACMVDVGPLRFKVWHKSPTYLCLLAEQYPSALLEFREGEMLSMEYYDADSILPSEHLKTSVRKIKRNDGGRLKGQYLVDLEILKSYH
Ga0212093_101333433300022554Hot Spring SedimentMNVSTLREIPRSKQEITGGCSVEMGPLRFKVWHKSPTYLCLLAGQDPSAFLEFREGATLTLEYFDGNSSLPSERLNTAVRKIKRNAGERLKGQYLVDLEILKSYH
(restricted) Ga0233425_1003406833300024054FreshwaterMNLSTLYEVPQANHEPFSACEVEVGSFRFKVWHKSPTYLCLLAGRNPSTLLEFREGETLTVAYHDCGSTVPAEHLTTAVRKIKRNETGKLKGQYLVDLEILKSYH
Ga0210134_100933413300025950Natural And Restored WetlandsMNLSTLREASQTTQETSGACEVEIGSLRFKVWHKSPTYLCLLAGYDASALLELREGEMLSLVYHGVGSDLPSEHLKTAIRKIKRNDGGKLKGQYLVDLEILKSYH
Ga0210103_100040323300025968Natural And Restored WetlandsMNLSTLREASQTTQETSGACEVEIGSLRFKVWHKSPTYLCLLAGYDTSALLELREGEMLSLVYHGVGSDLPSEHLKTAIRKIKRNDGGKLKGQYLVDLEILKSYH
Ga0210129_102694423300026026Natural And Restored WetlandsMNLSALREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH
Ga0256814_100989823300026464SedimentMNLSTLREVPQANQGTSGACEVEVGPLRFKVWHKSTTFLCLLAGQDPSTLLEFREGETLTMAYHDAGSILPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0256808_101163613300026476SedimentMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSVIPSEHLKTAVRKIKRNEGGRLKGQYLVDLEILKSYH
Ga0209270_102816723300027592Enrichment CultureMNVSTLHELPRPNQEITDGCSVEVGPLRFKVWHKSPTYLCLLAGQDPSALFEFREGTTLTLEYFDGNSSLPSERLNTAVRKIKRNVGERLKGQYLVDLEILKSYH
Ga0209077_110587323300027675Freshwater SedimentMNLSTVHEVPQANQEPFTACEVEVGPLRLKVWHKSPTYLCLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH
Ga0209164_105268823300027690Enrichment CultureMNVSTLREMPRPNPAIASGCSVEVGPLRFKVWHKSPTYLCLLAGQDPSALCEFREGTTLTLEYFDGNSRLPSERLNTAVRKIKRNVGERLKGQYLVDLEILKSYH
Ga0209164_119818713300027690Enrichment CultureMNVSTLREMPRPSQEITGGCSVEVGPLRFKVWHKSPTYLCLLAGQDPDALFEFREGATLTLAYFDGNSILPSERLSTAVRKIKRNAGERLKGQYLVDLEILKSYH
Ga0209704_101745623300027693Freshwater SedimentMNLSTVHEVPQANQEPFSACEVEVGPLRLKVWHKSPTYLCLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH
Ga0209286_101104833300027713Freshwater SedimentMNLSTVHEVPQANQEPFSACEVEVGPLRLKVWHKSPTYICLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH
Ga0209286_101165033300027713Freshwater SedimentMDFSPLRELPRANQGSSSACLVEVGPLRFKVWHKSPTYLCLLADEDPSTLLEFRVGKMLMMEYHDADSSLPSERLTTAVRKIKRNDGGKLKGQYLVDLEILKSYH
Ga0208665_1020442313300027715Deep SubsurfaceMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLPEFREGETLTMAFHDSGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0209492_100731533300027721Freshwater SedimentLLYKWLLNHWQTSLLLFLAWIVQCTFVQVLVLRESYTRRNAIMNLSTVHEVPQANQEPFTACEVEVGPLRLKVWHKSPTYLCLLAGQDPSTLLEFREGEMLTLAYHDSGANLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH
Ga0209593_1021213423300027743Freshwater SedimentFMQLLLQREPYTMRNVIMNLPTLREVPQANEEPSCACEAEVGPLRFKVWHKSPTYLCILAGQDPDTLLEFREGETLTIAYHDLSSSVPSEHLKTAVRRIKRNDRGRLKGQYLVDLEILKSYH
Ga0256868_1025659223300027811SoilMNLSTLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLGFREGEMLTMQYHDADSSLPSEHLKTAVRKIKRNDGGKLDGEYLVDLEILKSYH
Ga0209397_1003775813300027871WetlandMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRNERGKLKGQYLVDLEILKSYH
Ga0209293_1003308413300027877WetlandMNLSTLREVQQADLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH
Ga0208980_1022643823300027887WetlandMNLSTLREVQQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0208980_1056266423300027887WetlandMNLSTLREVPQANEESTSGACEVEVGPLRFKVWHKSTTFLCLLAGQDPSTLLEFREGETLTMAYHDAGSILPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0209496_1004075633300027890WetlandMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLPEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0209496_1052029323300027890WetlandMNLSTLYEVPQATHEPFSACEAEVGPLRFKVWHKSPTYLCLLAGRNPSTLIGFREGERLTVACREAGSSFPSEHFTTAVRKIKRNESGKLKGQYLVDLEILKSYH
Ga0209079_1013411413300027972Freshwater SedimentMQLLLQREPYTMRNVIMNLPTLREVPQANEEPSCACEAEVGPLRFKVWHKSPTYLCILAGQDPDTLLEFREGETLTIAYHDLSSSVPSEHLKTAVRRIKRNDRGRLKGQYLVDLEILKSY
Ga0134606_1010877223300029827Marine SedimentMILATLREVPQVGLETSSAYEVEVGPLRFKVWHKSPTYLCLLAGEDPSALLEFREGEMLTLAYHDAGSRHPAEHLKTAVRRIKRNEGGKLRGQYLVDLEILKSYH
Ga0299915_1002975133300030613SoilMNLSTLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLGFREGEMLTMQYHDADSSLPSEHLKTAVRKIKRNDGGKLNGEYLVDLEILKSYH
Ga0315297_1037561733300031873SedimentMNASTLREVPRANQETSSACMVEVGPLRFKVWHKSSTYLCLLAEQDPSALLEFRQGEMLSMEYYDADSILPSEHLKTSVRKIKRNDGGRLKGQYLVDLEILKSYH
Ga0315295_1055799113300032156SedimentMNTSTLREVPRANQETSSACMVEVGPLRFKVWHKSPTYLCLLAEQDPSTLLEFREGEMLSMEYYDADSILPSEHLKTSVRKIKRNDGGRLKGQYLVDLEILKSYH
Ga0315281_1128730413300032163SedimentMNLSTLREVPRANQETSSACMVEVGPLRFKVWHKSSTYLCLLAEQDPSALLEFRQGEMLSMEYYDADSILPSEHLKTSVRKIKRNDGGRLKGQYLVDLEILKSYH
Ga0315281_1231868113300032163SedimentMNVSTLREVPHGNQETCSACMVEVGPLRFKVWHKSPTYLCLLAEQDPSALLEFREGEMLSMEYYDADSILPSEHLNTSVRKIKRNDGGRL
Ga0315286_1141962313300032342SedimentMNLSPLREVPRANQETCRACMVEVGPLRFKVWHKSQTYLCLLAEQDPSALLEFREGEMLSMEYYDADSILPSEHLKTSVRKIKRNDRGRLKGQYLVDLEILKSYH
Ga0315287_1050577423300032397SedimentMNASTLREVPRANQETSSACMVEVGPLRFKVWHKSSTYLCLLAEQDPSALLEFRQGEMLSMEYYEADSILPSEHLKTSVRKIKRNDGGRLKGQYLVDLEILKSYH
Ga0315273_1111828433300032516SedimentMNASTLREVPRANQETSSACMVEVGPLRFKVWHKSSTYLCLLAEQDPSALLEFRQGEMLSMEYYDADSILPSEHLKTSVRKIKRNDGG
Ga0316604_1029702223300033406SoilMSLSTLHEVPQADKEPFSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGKTLTIVYYDSDSSFPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH
Ga0316604_1040113713300033406SoilMNLSTLREVPQPDLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH
Ga0316604_1054525323300033406SoilMNLSTLHEVPQVTQEPFSACEVEVGALRFKVWHKSPTYLCFLAGQDPSTLLEFREGKTLTIAYYDSGSSFPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH
Ga0316605_1045568333300033408SoilPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKAAVRKIKRNEGGKLNGEYLVDLEILKSYH
Ga0316603_1007519323300033413SoilMNLSTLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKAAVRKIKRNDGGKLNGEYLVDLEILKSYH
Ga0316603_1193312023300033413SoilPPRTNQESSRACLVEVGPLRFKVWHKSPTYLCLLADEDPSTLLEFRVGKMLMMEYHDADSSLPSERLTTAVRKIKRNDGGKLKGQYLVDLEILKSYH
Ga0316619_1081233913300033414SoilMNLSTLREVPQADLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH
Ga0316619_1088052123300033414SoilMVIKLLANLIFAFSGMDSAVYFCACTVFHRVLLRRNVIMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRNERGKLKGQYLVDLEILKSYH
Ga0316622_10080598523300033416SoilMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH
Ga0316622_10341277313300033416SoilMNLSTLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKAAVRKIKRNDGG
Ga0316625_10011567113300033418SoilMQFLAQIVQCTIVHALVFKKFSKRRKVIMNLSTLYEVPQATHEPFSACEAEVGPLRFKVWHKSPTYLCLLAGRNPSTLIGFREGERLTVACREAGSSFPSEHFTTAVRKIKRNESGKLKGQYLVDLEILKSYH
Ga0316601_10004933843300033419SoilMNLSTLHEVPQADKEPFSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGKTLTIVYYDSDSSFPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH
Ga0316601_10100282213300033419SoilMNLSTLREVPQPDLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLPEFREGETLTMAFHDSGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0316601_10188355513300033419SoilMNLSTLHEVPQVTQELFGACEVEVGPVRFKVWHKSPTYLCLLAGQDPSALLEFREGETLTIVYYDSGSSFPSEHLKTAVRKIKR
Ga0316601_10242215813300033419SoilMNLSTLHEVPQVTQEPFSVCEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGEMLTLAYHDSGSNLPSEHLKTAVRKIKRKERGKLKGQYLVDLEILKSYH
Ga0316613_1003095033300033434SoilMNLSTLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKAAVRKIKRNEGGKLNGEYLVDLEILKSYH
Ga0316613_1126624913300033434SoilMNLSTLREVQQADLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQGPSTLPEFREGETLTMAYHDAGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0316620_1036537913300033480SoilMNLSTLREVSHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKTAVRKIKRNDSGKLNGEYLVDLEILKSYH
Ga0316600_1040397913300033481SoilMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRN
Ga0316627_10223900323300033482SoilMNLSTLREVQQADLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLPEFREGETLTMAFHDSGSVLPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0316629_1008331423300033483SoilMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH
Ga0316626_1024125733300033485SoilHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRNERGKLKGQYLVDLEILKSYH
Ga0316624_1023015133300033486SoilREVPHANQEISSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKTAVRKIKRNDSGKLNGEYLVDLEILKSYH
Ga0316630_1181172113300033487SoilREVPQPDLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDLEILKSYH
Ga0316621_1075196223300033488SoilMNLSTLREVQQADLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0316628_10055644433300033513SoilMNLSTLREVPQANLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPTTLLEFREGETLTMAYHDAGSVFPAEHLKTAVRKIKRNEGGKLKGQYLVDLEILKSYH
Ga0316628_10084615023300033513SoilMNLSTLREVPHANQETSSACVVEVGLLRFKVWHKSPTYLCLLAGQDPSALLEFREGEMLSMQYHDADSSLPSEHLKAAVRKIKR
Ga0316628_10156897813300033513SoilMNLSTLREVQQADLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDL
Ga0316628_10239090213300033513SoilMNLSTLHEVPQTNQEPFSACEVEVGPVRLKVWHKSPTYLCLLAGQDPSNLIEFREGEMLTLAYHDSGSSLPSEHLKTAVRRIKRNEGGKLKGQYLVDLEILKSYH
Ga0316616_10055779133300033521SoilMNLSTLHEMPQANQKPFSACEVEVGPLRFKVWHKSPTYLCLLAEHDPSTLLEFREGEMLTLAYHDSGSNLPSEHLKTAVRKIKRNERGKLKGQYLVDLEILKSYH
Ga0316617_10117467913300033557SoilMNLSTLREVPQPDLGTSSACEVEVGPLRFKVWHKSPTYLCLLAGQDPSTLLEFREGETLTMAYHDAGSIVPAEHLKTAVRKIKRNEGGKLRGQYLVDLEI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.