NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F062681

Metagenome Family F062681

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062681
Family Type Metagenome
Number of Sequences 130
Average Sequence Length 84 residues
Representative Sequence MTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Number of Associated Samples 100
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.15 %
% of genes near scaffold ends (potentially truncated) 33.08 %
% of genes from short scaffolds (< 2000 bps) 78.46 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.231 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(28.462 % of family members)
Environment Ontology (ENVO) Unclassified
(76.923 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.615 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.72%    β-sheet: 16.28%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF01507PAPS_reduct 3.08
PF00589Phage_integrase 2.31
PF00145DNA_methylase 1.54
PF03237Terminase_6N 1.54
PF06945DUF1289 1.54
PF13481AAA_25 0.77
PF13551HTH_29 0.77
PF11753DUF3310 0.77
PF01555N6_N4_Mtase 0.77
PF02567PhzC-PhzF 0.77
PF13936HTH_38 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 1.54
COG3313Predicted Fe-S protein YdhL, DUF1289 familyGeneral function prediction only [R] 1.54
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.77
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.77
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.77
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.15 %
UnclassifiedrootN/A3.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10259343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.542Open in IMG/M
3300000115|DelMOSum2011_c10027028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2605Open in IMG/M
3300000115|DelMOSum2011_c10126521All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.791Open in IMG/M
3300000117|DelMOWin2010_c10033514All Organisms → Viruses → Predicted Viral2465Open in IMG/M
3300000117|DelMOWin2010_c10166989All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.708Open in IMG/M
3300000949|BBAY94_10144659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.646Open in IMG/M
3300000949|BBAY94_10180557All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.570Open in IMG/M
3300000973|BBAY93_10157243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.571Open in IMG/M
3300001460|JGI24003J15210_10021472All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2449Open in IMG/M
3300001460|JGI24003J15210_10035428All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1783Open in IMG/M
3300001460|JGI24003J15210_10139575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.635Open in IMG/M
3300004097|Ga0055584_101698729All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.652Open in IMG/M
3300004829|Ga0068515_123921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.763Open in IMG/M
3300004951|Ga0068513_1030169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.591Open in IMG/M
3300006027|Ga0075462_10021401All Organisms → Viruses → Predicted Viral2085Open in IMG/M
3300006735|Ga0098038_1094525All Organisms → Viruses → Predicted Viral1036Open in IMG/M
3300006735|Ga0098038_1094925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1033Open in IMG/M
3300006735|Ga0098038_1221629All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.605Open in IMG/M
3300006737|Ga0098037_1039684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1717Open in IMG/M
3300006737|Ga0098037_1066311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1282Open in IMG/M
3300006737|Ga0098037_1094830All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300006752|Ga0098048_1011699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3077Open in IMG/M
3300006752|Ga0098048_1033507All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1665Open in IMG/M
3300006789|Ga0098054_1358610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.516Open in IMG/M
3300006802|Ga0070749_10235843All Organisms → Viruses → Predicted Viral1040Open in IMG/M
3300006802|Ga0070749_10519764Not Available647Open in IMG/M
3300006802|Ga0070749_10561695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.618Open in IMG/M
3300006916|Ga0070750_10013655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.4229Open in IMG/M
3300006916|Ga0070750_10155008All Organisms → Viruses → Predicted Viral1034Open in IMG/M
3300006920|Ga0070748_1083789All Organisms → Viruses → Predicted Viral1228Open in IMG/M
3300006920|Ga0070748_1343679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.527Open in IMG/M
3300006921|Ga0098060_1058650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1127Open in IMG/M
3300006928|Ga0098041_1266659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.545Open in IMG/M
3300006929|Ga0098036_1091332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.937Open in IMG/M
3300006990|Ga0098046_1008457All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2893Open in IMG/M
3300007229|Ga0075468_10087600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1002Open in IMG/M
3300007236|Ga0075463_10089787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.991Open in IMG/M
3300007236|Ga0075463_10212656Not Available622Open in IMG/M
3300007276|Ga0070747_1122913All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.945Open in IMG/M
3300007963|Ga0110931_1051879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1238Open in IMG/M
3300009077|Ga0115552_1148663All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.985Open in IMG/M
3300009124|Ga0118687_10001153Not Available10150Open in IMG/M
3300009124|Ga0118687_10016635All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2407Open in IMG/M
3300009435|Ga0115546_1250603All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.607Open in IMG/M
3300009437|Ga0115556_1132391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.930Open in IMG/M
3300009481|Ga0114932_10213362All Organisms → Viruses → Predicted Viral1172Open in IMG/M
3300009481|Ga0114932_10574075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.661Open in IMG/M
3300009593|Ga0115011_10051059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2826Open in IMG/M
3300010148|Ga0098043_1106660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.814Open in IMG/M
3300010149|Ga0098049_1035397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1614Open in IMG/M
3300010150|Ga0098056_1060368All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1306Open in IMG/M
3300010153|Ga0098059_1106059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1116Open in IMG/M
3300010392|Ga0118731_103798744All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2018Open in IMG/M
3300012920|Ga0160423_10562945All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.773Open in IMG/M
3300013010|Ga0129327_10037467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2469Open in IMG/M
3300017697|Ga0180120_10018216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3300Open in IMG/M
3300017697|Ga0180120_10146114All Organisms → Viruses → Predicted Viral1004Open in IMG/M
3300017709|Ga0181387_1035476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.982Open in IMG/M
3300017714|Ga0181412_1040695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1211Open in IMG/M
3300017719|Ga0181390_1063520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1054Open in IMG/M
3300017720|Ga0181383_1077392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.893Open in IMG/M
3300017727|Ga0181401_1001897Not Available7939Open in IMG/M
3300017728|Ga0181419_1012019All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2524Open in IMG/M
3300017728|Ga0181419_1128177All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.616Open in IMG/M
3300017733|Ga0181426_1065979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.719Open in IMG/M
3300017738|Ga0181428_1032565All Organisms → Viruses → Predicted Viral1211Open in IMG/M
3300017742|Ga0181399_1080157All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.822Open in IMG/M
3300017749|Ga0181392_1213989All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.550Open in IMG/M
3300017752|Ga0181400_1183103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.583Open in IMG/M
3300017755|Ga0181411_1210733All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.543Open in IMG/M
3300017759|Ga0181414_1044988All Organisms → Viruses → Predicted Viral1185Open in IMG/M
3300017760|Ga0181408_1167792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.562Open in IMG/M
3300017762|Ga0181422_1051678All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1318Open in IMG/M
3300017764|Ga0181385_1237341All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.547Open in IMG/M
3300017769|Ga0187221_1022548All Organisms → Viruses → Predicted Viral2191Open in IMG/M
3300017773|Ga0181386_1093062All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.944Open in IMG/M
3300017773|Ga0181386_1094093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.937Open in IMG/M
3300017773|Ga0181386_1112290All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.846Open in IMG/M
3300017779|Ga0181395_1124083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.821Open in IMG/M
3300017951|Ga0181577_10053316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2874Open in IMG/M
3300017963|Ga0180437_10027337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5914Open in IMG/M
3300017963|Ga0180437_10285229All Organisms → Viruses → Predicted Viral1262Open in IMG/M
3300018080|Ga0180433_10694348All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.757Open in IMG/M
3300018416|Ga0181553_10174772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1260Open in IMG/M
3300018420|Ga0181563_10679798All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.569Open in IMG/M
3300018428|Ga0181568_10527305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.938Open in IMG/M
3300019706|Ga0193995_1024753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.679Open in IMG/M
3300019735|Ga0193990_1026147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.712Open in IMG/M
3300019738|Ga0193994_1017292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.871Open in IMG/M
3300019751|Ga0194029_1003128All Organisms → Viruses → Predicted Viral2165Open in IMG/M
3300019757|Ga0193964_1104593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.594Open in IMG/M
3300020403|Ga0211532_10043329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2180Open in IMG/M
3300020439|Ga0211558_10013474All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.4224Open in IMG/M
3300021356|Ga0213858_10414812All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.631Open in IMG/M
3300021389|Ga0213868_10466472All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.685Open in IMG/M
3300021465|Ga0193947_1026931All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.891Open in IMG/M
3300022068|Ga0212021_1008294All Organisms → Viruses → Predicted Viral1696Open in IMG/M
3300022068|Ga0212021_1017415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1311Open in IMG/M
3300022074|Ga0224906_1031038All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1826Open in IMG/M
3300022178|Ga0196887_1033348All Organisms → Viruses → Predicted Viral1417Open in IMG/M
3300022178|Ga0196887_1047289All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1112Open in IMG/M
3300022929|Ga0255752_10057412All Organisms → Viruses → Predicted Viral2372Open in IMG/M
3300024413|Ga0233393_1111043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.582Open in IMG/M
3300024428|Ga0233396_1035339All Organisms → Viruses → Predicted Viral1477Open in IMG/M
3300025070|Ga0208667_1022444All Organisms → Viruses → Predicted Viral1210Open in IMG/M
3300025083|Ga0208791_1003079All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.5241Open in IMG/M
3300025085|Ga0208792_1082925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.570Open in IMG/M
3300025086|Ga0208157_1033331All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1472Open in IMG/M
3300025086|Ga0208157_1096161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.718Open in IMG/M
3300025099|Ga0208669_1115804All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.547Open in IMG/M
3300025108|Ga0208793_1055541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1205Open in IMG/M
3300025120|Ga0209535_1032533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2439Open in IMG/M
3300025120|Ga0209535_1070505All Organisms → Viruses → Predicted Viral1375Open in IMG/M
3300025128|Ga0208919_1032903All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1865Open in IMG/M
3300025128|Ga0208919_1173901All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.657Open in IMG/M
3300025128|Ga0208919_1223616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.556Open in IMG/M
3300025137|Ga0209336_10040951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1489Open in IMG/M
3300025151|Ga0209645_1007796All Organisms → cellular organisms → Bacteria4460Open in IMG/M
3300025508|Ga0208148_1019877All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1918Open in IMG/M
3300025543|Ga0208303_1088573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.673Open in IMG/M
3300025645|Ga0208643_1085791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.888Open in IMG/M
3300025712|Ga0209305_1102850All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.911Open in IMG/M
3300025759|Ga0208899_1032219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2438Open in IMG/M
3300025759|Ga0208899_1049894All Organisms → Viruses → Predicted Viral1798Open in IMG/M
3300025889|Ga0208644_1059918All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2053Open in IMG/M
3300025889|Ga0208644_1292598Not Available651Open in IMG/M
3300027906|Ga0209404_10072148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1993Open in IMG/M
3300032011|Ga0315316_10693473All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.846Open in IMG/M
3300032073|Ga0315315_10040508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.4330Open in IMG/M
3300032212|Ga0316207_10141930All Organisms → Viruses → Predicted Viral1035Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.46%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous17.69%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater17.69%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.85%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.85%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment3.08%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.08%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.08%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.31%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment2.31%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface2.31%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.54%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.54%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.54%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.54%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.77%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.77%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.77%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.77%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.77%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.77%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.77%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019706Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_1-2_MGEnvironmentalOpen in IMG/M
3300019735Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_1-2_MGEnvironmentalOpen in IMG/M
3300019738Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_0-1_MGEnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019757Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_7_MGEnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021465Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_0-1_MGEnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300024413Seawater microbial communities from Monterey Bay, California, United States - 21DEnvironmentalOpen in IMG/M
3300024428Seawater microbial communities from Monterey Bay, California, United States - 32DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032212Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-week pyriteEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1025934313300000101MarineAGRYNQQGASLMTEFTNAVEKQKGLQAYEDWAQQIRXXHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFVKFLHRIGFYHD*
DelMOSum2011_1002702853300000115MarineMTEFTNAVEKQKGLQAYEDWAQQIRYIHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFVKFLHRIGFYHD*
DelMOSum2011_1012652123300000115MarineMTEFTNAVEKQKGLQAYEQWAQQIRYIHSDGWEGTRTIVYNDGRRELYNLKSNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
DelMOWin2010_1003351423300000117MarineMTEFTNAVEKQKGLQAYEEWSQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
DelMOWin2010_1016698923300000117MarineMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
BBAY94_1014465913300000949Macroalgal SurfaceRCAMTEFKDAVEKQRGLQAYEEWAQQIRYIHSDGWDNTRTVVYNDGTRKLYNIKTNQLIYEKPRNKHRRDLINSNAFSRFLEKIGFYGENNETGT*
BBAY94_1018055733300000949Macroalgal SurfaceMTEFRDAVEKQRGLQAYEQWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNALIEGEPRKQRRRDLINSNAFVKFLNQI
BBAY93_1015724323300000973Macroalgal SurfaceMTEFKDAVEKQRGLQAYEEWAQQIRYIHSDGWDNTRTVVYNDGTRKLYNIKTNQLIYEKPRNKHRRDLINSNAFSRFLEKIGFYGENNETGT*
JGI24003J15210_1002147213300001460MarineMTEFTNAVEKQKGLQAYEDWAQQIRYVXSDGWEGTRTIVYNXGRRELYNLKXNQLINXEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
JGI24003J15210_1003542863300001460MarineMTEFRDAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
JGI24003J15210_1013957523300001460MarineMTEFTNAVEKQKGLQAYEEWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0055584_10169872933300004097Pelagic MarineMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINEEPRKTRRRDLIDSN
Ga0068515_12392113300004829Marine WaterMTEFRDAVEKQKGLQAYEEWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNALIEGEPRKTRRRDLINSNAFVNFLHRIG
Ga0068513_103016923300004951Marine WaterMTEFRDAVEKQRGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNSFVKFLNQIGFYNE*
Ga0075462_1002140183300006027AqueousMTEFKDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNSFVKFLNQIGFYNE*
Ga0098038_109452543300006735MarineMTEFTNAVEKQKGLQAYEEWAQQVRYIHSDGWEGTRTIVYNDGTEKLFNLKTNQLIFEQPRKQRRRDLINSNSFVKFLNQIGFYNE*
Ga0098038_109492533300006735MarineMTEFTNEVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHE*
Ga0098038_122162923300006735MarineMTEFTNAVEKQKGLQAYEQWSQQIRYIHSDGWEGTRTIVYNDGRRELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRI
Ga0098037_103968433300006737MarineMTEFTNEVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTSVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0098037_106631153300006737MarineMTEFTNAVEKQKGLQAYEQWSQQIRYIHSDGWEGTRTIVYNDGRRELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0098037_109483043300006737MarineMTEFTNAVEKQKGLQAYELWAQQIKSYEGDCWKGIRTKIYNDGRKEVYDMKTNALIEGEPRKTRRRDLINSNSFVKFLNQIGFYNETK*
Ga0098048_101169993300006752MarineMTEFTNAVEKQKGLQAYEQWSQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0098048_103350743300006752MarineMTEFTNAVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHE*
Ga0098054_135861023300006789MarineMYSIMEINIMTEFTNAVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHE*
Ga0070749_1023584353300006802AqueousMTEFRDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKTDQLIFEEPSKQRRRDLINSNSFVKFLNQIGFYNE*
Ga0070749_1051976413300006802AqueousAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNAFVKFLNQIGFYHD*
Ga0070749_1056169533300006802AqueousAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNSFVKFLNQIGFYNE*
Ga0070750_1001365563300006916AqueousMTEFKDAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFVKFLHRIGFYHE*
Ga0070750_1015500813300006916AqueousMTEFRDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNAFVKFLNQIGFYND*
Ga0070748_108378913300006920AqueousMTEFRDAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKTDQLIFEEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0070748_134367923300006920AqueousMTEFKDAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLIDSNAF
Ga0098060_105865043300006921MarineMYSIMEINIMTEFTNEVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTSVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0098041_126665913300006928MarineKQMTEFTNAVEKQKGLQAYELWAQQIKSYEGDCWKGIRTKIYNDGRKEVYDMKTNALIEGEPRKQRRRDLINSNSFVKFLNQIGFYNETK*
Ga0098036_109133233300006929MarineGRLAMTEFRDAVEKQKGLQAYEQWSKQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0098046_100845713300006990MarineAVEKQKGLQAYEQWSQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0075468_1008760013300007229AqueousVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0075463_1008978713300007236AqueousYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNSFVKFLNQIGFYNE*
Ga0075463_1021265633300007236AqueousYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNAFVKFLNQIGFYHD*
Ga0070747_112291323300007276AqueousMTEFTNAVEKQKGLQAYEDWAQKIRYIHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFVKFLHRIGFYHD*
Ga0110931_105187923300007963MarineMTEFTNAVEKQKGLQAYELWAQQIKSYEGDCWKGIRTKIYNDGRKEVYDMKTNALIEGEPRKTRRRDLINSNSFVKFLNQIGFYNE*
Ga0115552_114866333300009077Pelagic MarineMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLIFEQPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0118687_10001153183300009124SedimentMTEFKDAVEKQRGLQAYEEWAEQIRYIHSDGWDNTRTVVYNDGTRKLYNIKTNQLILEKPRKKRRRDLINSNAFSRFLEKIGFYGENNETGT*
Ga0118687_1001663553300009124SedimentMTEFRDAVEKQRGLQAYEQWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNALIEGEPRKQRRRDLINSNSFVKFLNQIGFYNE*
Ga0115546_125060333300009435Pelagic MarineMTEFTNAVEKQKGLQAYEDWSKQIRYVHSDGWEGTRTIVYNDGRRELYNIKSNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0115556_113239113300009437Pelagic MarineMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0114932_1021336213300009481Deep SubsurfaceMTEFRDAVEKQKGLQAYEEWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTSTLIEGEPRKTRRRDLIDSNAFVKFLNQIG
Ga0114932_1057407533300009481Deep SubsurfaceMTEFKDVVEKQRGLQAYEEWAEQIRYIHSDGWDNTRTVVYNDGTRKLYNIKTNQLIYEKPRNKRRRDLINSNAFSRFLEKIGFYGENNETGT*
Ga0115011_1005105943300009593MarineMTEFRDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTQKLFNLKTDQLILEQPRKTRRRDLIDSNAFVRFLNQIGFYNE*
Ga0098043_110666013300010148MarineKQKGLQAYEEWAQQVRYIHSDGWEGTRTIVYNDGTEKLFNLKTNQLIFEQPRKQRRRDLINSNSFVKFLNQIGFYNE*
Ga0098049_103539733300010149MarineMEINIMTEFTNAVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHE*
Ga0098056_106036853300010150MarineMTEFTNAVEKQKGLQAYEQWSQQIRYIHSDGWEGTRTIVYNDGRRELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHE*
Ga0098059_110605923300010153MarineMEINIMTEFTNAVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0118731_10379874453300010392MarineMTEFTNAVEKQKGLQAYEQWAQKIRYIHSDGWEGTRTIVYNDGRRELYNLKTDQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD*
Ga0160423_1056294533300012920Surface SeawaterMTEFTNAVEKQKGLQAYELWAQQIKSYEGDCWKGIRTKIYNDGRKEVYDMKTNALIEGEPRKQRRRDLINSNSFVKFLNQIGFYNE*
Ga0129327_1003746763300013010Freshwater To Marine Saline GradientMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYH
Ga0180120_1001821673300017697Freshwater To Marine Saline GradientTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0180120_1014611413300017697Freshwater To Marine Saline GradientMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLIDSNAFTK
Ga0181387_103547633300017709SeawaterMTEFRDAVEKQKGLQAYEDWAQQIKSYEGDCWKGTRTKIYNDGRRELYNLKNNQLIFEEPRKTRRRDLIDSNAFVRFLNQIGFYHD
Ga0181412_104069543300017714SeawaterGLQAYEDWAQQIRYIHSDGWEGTRTIVYNDGRQELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181390_106352043300017719SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRQELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181383_107739223300017720SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRQELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHDN
Ga0181401_100189733300017727SeawaterMTEFTNAVEKQKGLQAYEQWAQQIRYVHSDGWEGTRTIVYNDGRQELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181419_101201933300017728SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYIHSDGWEGTRTIVYNDGRQELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181419_112817733300017728SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYIHSDGWENTRTIVYNDGRQELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHDN
Ga0181426_106597923300017733SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRQELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181428_103256523300017738SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181399_108015743300017742SeawaterMTEFTNAVEKQKGLQAYEQWAQQIRYVHSDGWEGTRTIVYNDGRQELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHDN
Ga0181392_121398923300017749SeawaterMTEFTNAVEKQKGLQAYEQWAQQIRYVHSDGWEGTRTIVYNDGRQELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHEKN
Ga0181400_118310313300017752SeawaterMTEFRDAVEKQKGLQAYEDWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181411_121073313300017755SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRAIVYNDGRQELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181414_104498813300017759SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRAIVYNDGRQELYNLKNNQLINEEPRKTRRRDLIDSNAFTKF
Ga0181408_116779223300017760SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYIHSDGWEGTRTIVYNDGRQELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHDN
Ga0181422_105167833300017762SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRQELYNLKSNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181385_123734133300017764SeawaterMTEFRDAVEKQKGLQAYEDWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAF
Ga0187221_102254893300017769SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRQELYNLKNNQLINEEPRKTRRRDLIESNAFTKFLHRIGFYHD
Ga0181386_109306243300017773SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRQELYNLKNNQLIFEEPRKTRRRDLIDSNSFTKFLH
Ga0181386_109409353300017773SeawaterMTEFTNAVEKQKGLQAYEEWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLIFEEPRKTRRRDLIDSNSFTKFLH
Ga0181386_111229023300017773SeawaterMTEFRDAVEKQKGLQAYEDWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFVRFLNQIGFYHD
Ga0181395_112408313300017779SeawaterFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0181577_1005331663300017951Salt MarshMTEFKDAVEKQRGLQAYEEWAEQIRYIHSDGWDNTRTVVYNDGTRKLYNIKTNQLILEKPRKKRRRDLINSNAFSRFLEKIGFYGENNETGT
Ga0180437_10027337123300017963Hypersaline Lake SedimentMTEFKDAVEKQKGLQAYEEWAEQIRYIHSDGWDNTRTVVYNDGTRKLYNIKTNQLIYEKPRNKRRRDLINSNAFSRFLEKIGFYGEKNETGT
Ga0180437_1028522933300017963Hypersaline Lake SedimentMTEFRDAVEKQKGLQAYEEWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNALIEGEPRKTRRRDLINSNSFVNFLHRIGFYHE
Ga0180433_1069434813300018080Hypersaline Lake SedimentMTEFRDAGEKQKGLQAYEEWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNALIEGEPRKTRRRDLINSNSFVNFLHRIGFYHE
Ga0181553_1017477243300018416Salt MarshMTEFRDAVEKQRGLQAYEEWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTSALIEGEPRKQRRRDLINSNSFVKFLNQIGFYND
Ga0181563_1067979823300018420Salt MarshMTEFRDAVEKQRGLQVYEEWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNKLIEGEPRKQRRRDLINSNSFVKFLNQIGFYNE
Ga0181568_1052730533300018428Salt MarshMTEFKDAVEKQRGLQAYEEWAEQIRYIHSDGWDNTRTVVYNDGTRKLYNIKTNQLIYEKPRNKHRRDLINSNAFSRFLENIGFYGENNETGT
Ga0193995_102475323300019706SedimentMTEFRDAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKTDQLIFEEPRKTRRRDLIDSNAFTKFLHRIGFYHE
Ga0193990_102614723300019735SedimentMTEFRDAVEKQRGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGRRELYNLKTDQLIFEEPRKTRRRDLIDSNAFTKFLHRIGFYHE
Ga0193994_101729233300019738SedimentMTEFRDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKTDQLIFEEPRKQRRRDLINSNSFVKFLNQIGFYNE
Ga0194029_100312883300019751FreshwaterMTEFRDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNAFVKFLNQIGFYND
Ga0193964_110459323300019757Freshwater Microbial MatMTEFTNAVEKQKGLQAYEEWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLIFEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0211532_1004332953300020403MarineMTEFRDAVEKQRGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLIFEQPRKQRRRDLINSNAFVKFLNQIGFYNDN
Ga0211558_1001347433300020439MarineMTEFKDAVEKQRGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKTDQLIFEQPRKQRRRDLINSNAFVKFLNQIGFYND
Ga0213858_1041481233300021356SeawaterKDAVEKQKGLQAYEEWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNALIEGEPRKQRRRDLINSNSFVKFLNQIGFYNE
Ga0213868_1046647213300021389SeawaterMTEFTNAVEKQKGLQAYEEWSQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0193947_102693133300021465SedimentMTEFRDAVEKQRGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKTDQLIFEEPRKQRRRDLINSNSFVKFLNQIGFYNE
Ga0212021_100829473300022068AqueousMTEFKDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNAFVKFLNQIGFYHD
Ga0212021_101741513300022068AqueousLFRSGEFKDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNSFVKFLNQIGFYNE
Ga0224906_103103863300022074SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEATRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHENK
Ga0196887_103334813300022178AqueousMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLI
Ga0196887_104728913300022178AqueousLMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0255752_1005741213300022929Salt MarshMTEFRDAVEKQRGLQVYEEWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNALIEGEPRKQRRRDLINSNSFVKFLNQIGFY
Ga0233393_111104313300024413SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYIHSDGWEGTRTIVYNDGRQELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHEKN
Ga0233396_103533923300024428SeawaterMTEFTNAVEKQKGLQAYEDWAQQIRYIHSDGWEGTRTIVYNDGRQELYNLKNNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYYD
Ga0208667_102244413300025070MarineMTEFTNAVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHE
Ga0208791_100307923300025083MarineMYSIMEINIMTEFTNAVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHE
Ga0208792_108292513300025085MarineMYSIMEINIMTEFTNAVEKQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFTKFLH
Ga0208157_103333133300025086MarineMTEFTNAVEKQKGLQAYEEWAQQVRYIHSDGWEGTRTIVYNDGTEKLFNLKTNQLIFEQPRKQRRRDLINSNSFVKFLNQIGFYNE
Ga0208157_109616133300025086MarineQKGLQAYEEWAKQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTSVLIEGEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0208669_111580413300025099MarineQKGLQAYEEWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLIFEEPRKTRRRDLIDSNAFTKFLHRIGFYHE
Ga0208793_105554123300025108MarineMTEFTNAVEKQKGLQAYEQWSQQIRYIHSDGWEGTRTIVYNDGRRELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0209535_103253383300025120MarineMTEFTNAVEKQKGLQAYEEWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0209535_107050513300025120MarineMTEFTNAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYH
Ga0208919_103290353300025128MarineMTEFTNAVEKQKGLQAYELWAQQIKSYEGDCWKGIRTKIYNDGRKEVYDMKTNALIEGEPRKTRRRDLINSNSFVKFLNQIGFYNE
Ga0208919_117390133300025128MarineMTEFTNAVEKQKGLQAYEEWSQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINQEPRKTRRRDLID
Ga0208919_122361623300025128MarineEQWSQQIRYIHSDGWEGTRTIVYNDGRRELYNLKNNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0209336_1004095133300025137MarineMTEFRDAVEKQKGLQAYEDWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINEEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0209645_100779663300025151MarineMTEFKDAVEKQRGLQAYKEWAQQIRYIHSDGWDNTRTVVYNDGTRKLYNIKTNQLIYEKPRNKHRRDLINSNAFSRFLEKIGFYGENNETGT
Ga0208148_101987743300025508AqueousQKGLQAYEEWSQQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0208303_108857333300025543AqueousKLMTEFKDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0208643_108579113300025645AqueousMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLINQEPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0209305_110285043300025712Pelagic MarineMTEFTNAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKSNQLIFEQPRKTRRRDLIDSNAFTKFLHRIGFYHD
Ga0208899_103221953300025759AqueousMTEFKDAVEKQKGLQAYEDWAKQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLINEEPRKTRRRDLIDSNAFVKFLHRIGFYHE
Ga0208899_104989473300025759AqueousMTEFKDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNSFVKFLNQIGFYNE
Ga0208644_105991813300025889AqueousQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNSFVKFLNQIGFYNE
Ga0208644_129259833300025889AqueousQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTEKLFNLKNDQLILEQPRKQRRRDLINSNAFVKFLNQIGFYHD
Ga0209404_1007214833300027906MarineMTEFRDAVEKQKGLQAYEEWAQQIRYIHSDGWEGTRTIVYNDGTQKLFNLKTDQLILEQPRKTRRRDLIDSNAFVRFLNQIGFYNE
Ga0315316_1069347333300032011SeawaterMTEFRDAVEKQKGLQAYEDWAQQIKSYEGDCWKGTRTKIYNDGRKEVYDMKTNVLIEGEPRKTRRRDLIDSNAFVRFLNQIGFYNE
Ga0315315_1004050833300032073SeawaterMTEFTNAVEKQKGLQAYEEWAQQIRYVHSDGWEGTRTIVYNDGRRELYNLKNNQLIFEEPRKTRRRDLIDSNSFTKFLHRIGFYHE
Ga0316207_1014193023300032212Microbial MatMTEFKDAVEKQRGLQAYEEWAQQIRYIHSDGWENTRTVVYNDGTQKLYNIKTNQLIFEEPRKTRRRDLIDSNAFTKFLHRIGFYNETK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.