NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F062208

Metagenome Family F062208

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062208
Family Type Metagenome
Number of Sequences 131
Average Sequence Length 43 residues
Representative Sequence VTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPAS
Number of Associated Samples 116
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.76 %
% of genes near scaffold ends (potentially truncated) 99.24 %
% of genes from short scaffolds (< 2000 bps) 93.13 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.237 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(12.214 % of family members)
Environment Ontology (ENVO) Unclassified
(27.481 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.931 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.06%    β-sheet: 2.78%    Coil/Unstructured: 79.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF02653BPD_transp_2 93.89
PF00005ABC_tran 2.29
PF12826HHH_2 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.24 %
UnclassifiedrootN/A0.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004156|Ga0062589_100492467All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300004633|Ga0066395_10333798All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005175|Ga0066673_10545447All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300005177|Ga0066690_10148365All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300005180|Ga0066685_10836037All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005295|Ga0065707_10545196All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300005331|Ga0070670_101073383All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300005332|Ga0066388_103507526All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300005332|Ga0066388_106080114All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300005356|Ga0070674_101258388All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005438|Ga0070701_10806400All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300005451|Ga0066681_10203379All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300005454|Ga0066687_10523977All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005457|Ga0070662_100016790All Organisms → cellular organisms → Bacteria4921Open in IMG/M
3300005457|Ga0070662_101642510All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005471|Ga0070698_101378285All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300005526|Ga0073909_10707537All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005546|Ga0070696_101832386All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium525Open in IMG/M
3300005558|Ga0066698_10968186All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005559|Ga0066700_11129883All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium512Open in IMG/M
3300005560|Ga0066670_10140455All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300005566|Ga0066693_10128263All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300005617|Ga0068859_100610986All Organisms → cellular organisms → Bacteria → Proteobacteria1183Open in IMG/M
3300005713|Ga0066905_100917768All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300005713|Ga0066905_100973453All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300005719|Ga0068861_101611617All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005764|Ga0066903_105049498All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300005841|Ga0068863_100624184All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300005937|Ga0081455_10771627All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300006032|Ga0066696_10410089All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300006034|Ga0066656_10359836All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300006049|Ga0075417_10179353All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300006163|Ga0070715_10622190All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300006175|Ga0070712_100414130All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300006844|Ga0075428_102135490All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300006853|Ga0075420_100253422All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300006853|Ga0075420_100725207All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300006871|Ga0075434_101970936All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300006914|Ga0075436_101042749All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300006918|Ga0079216_11514853All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium562Open in IMG/M
3300006954|Ga0079219_11979329All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300007788|Ga0099795_10262874All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300009100|Ga0075418_10572970All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300009137|Ga0066709_104471061All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300009156|Ga0111538_12323687All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300009162|Ga0075423_10885486All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300009176|Ga0105242_11075602All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300009792|Ga0126374_11412414All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300009800|Ga0105069_1022244All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium648Open in IMG/M
3300010047|Ga0126382_10209535All Organisms → cellular organisms → Bacteria → Proteobacteria1394Open in IMG/M
3300010323|Ga0134086_10013456All Organisms → cellular organisms → Bacteria2549Open in IMG/M
3300010360|Ga0126372_10147112All Organisms → cellular organisms → Bacteria → Proteobacteria1875Open in IMG/M
3300010360|Ga0126372_12690005All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300010362|Ga0126377_11634156All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300010362|Ga0126377_11821904All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300010362|Ga0126377_13238443All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300010366|Ga0126379_10408513All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300010398|Ga0126383_10852426All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300010400|Ga0134122_11796282All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300011419|Ga0137446_1014863All Organisms → cellular organisms → Bacteria → Proteobacteria1533Open in IMG/M
3300012200|Ga0137382_10500023All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300012203|Ga0137399_10971500All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300012228|Ga0137459_1072094All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300012582|Ga0137358_10276893All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300012922|Ga0137394_11489130All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012961|Ga0164302_10305792All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300013100|Ga0157373_10945689All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300013306|Ga0163162_10176432All Organisms → cellular organisms → Bacteria2262Open in IMG/M
3300013306|Ga0163162_12722425All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300013307|Ga0157372_12346461All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300015262|Ga0182007_10042896All Organisms → cellular organisms → Bacteria → Proteobacteria1505Open in IMG/M
3300015372|Ga0132256_100502845All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300015373|Ga0132257_101213974All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300017659|Ga0134083_10042753All Organisms → cellular organisms → Bacteria1688Open in IMG/M
3300017997|Ga0184610_1163719All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300018084|Ga0184629_10117004All Organisms → cellular organisms → Bacteria → Proteobacteria1322Open in IMG/M
3300018482|Ga0066669_11597794All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300019356|Ga0173481_10755194All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300021344|Ga0193719_10027175All Organisms → cellular organisms → Bacteria2460Open in IMG/M
3300024279|Ga0247692_1052711All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300025923|Ga0207681_11119403All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300025937|Ga0207669_11024011All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300025937|Ga0207669_11490156All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300025981|Ga0207640_10658027All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300026089|Ga0207648_10460268All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300026095|Ga0207676_10942053All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300026102|Ga0208914_1007632All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300026297|Ga0209237_1027085All Organisms → cellular organisms → Bacteria3178Open in IMG/M
3300026306|Ga0209468_1036267All Organisms → cellular organisms → Bacteria → Proteobacteria1706Open in IMG/M
3300026323|Ga0209472_1319022All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium500Open in IMG/M
3300026331|Ga0209267_1132879All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300026332|Ga0209803_1006137All Organisms → cellular organisms → Bacteria6754Open in IMG/M
3300026369|Ga0257152_1031224All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300026527|Ga0209059_1248455All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300026547|Ga0209156_10036636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2721Open in IMG/M
3300027614|Ga0209970_1118023All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300027654|Ga0209799_1049322All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300027654|Ga0209799_1130914All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300027682|Ga0209971_1122150All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300027775|Ga0209177_10394382All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300027873|Ga0209814_10115084All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300027907|Ga0207428_10377075All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300027909|Ga0209382_10380389All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300027909|Ga0209382_11271367All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300028536|Ga0137415_10022554All Organisms → cellular organisms → Bacteria → Proteobacteria6223Open in IMG/M
3300028536|Ga0137415_10540987All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300028811|Ga0307292_10502251All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300031184|Ga0307499_10198852All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031544|Ga0318534_10618224All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300031548|Ga0307408_101208141All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300031548|Ga0307408_101931549All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031713|Ga0318496_10295891All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300031740|Ga0307468_100503242All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300031740|Ga0307468_100714105All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300031819|Ga0318568_10797561All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300031820|Ga0307473_11474343All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031821|Ga0318567_10901046All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium501Open in IMG/M
3300031824|Ga0307413_11429728All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300031892|Ga0310893_10141966All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300031901|Ga0307406_11618625Not Available572Open in IMG/M
3300032010|Ga0318569_10209168All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300032059|Ga0318533_10631348All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300032075|Ga0310890_11209984All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300032089|Ga0318525_10046603All Organisms → cellular organisms → Bacteria2143Open in IMG/M
3300032180|Ga0307471_100776640All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300032261|Ga0306920_100755594All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300032421|Ga0310812_10208154All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300033289|Ga0310914_11083721All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300033485|Ga0316626_10286388All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1336Open in IMG/M
3300033550|Ga0247829_10824313All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300033550|Ga0247829_11488330All Organisms → cellular organisms → Bacteria559Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.21%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.11%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.05%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.29%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.53%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.53%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.53%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.76%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.76%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009800Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026102Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026369Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-AEnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062589_10049246723300004156SoilATGVVTQIGWDGEKHTLWPWDLASKAKFKAVYPSPSWQERDSKPKPAS*
Ga0066395_1033379813300004633Tropical Forest SoilVVTQIGWDDEKHTIWPWDLAAKADFKPIFPSPGWQERESRPKSTK*
Ga0066673_1054544713300005175SoilGWDGEKHTLWPWDLAARANFKPIFPSPSWQERESKPKPAN*
Ga0066690_1014836513300005177SoilGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAG*
Ga0066685_1083603713300005180SoilVVTQIGWDGEKHTLWPWDLAAKSGFKAVYPNPSWQERDSKPKPN*
Ga0065707_1054519613300005295Switchgrass RhizosphereQIGWDGEKHTLWPWDLASKAGFKPMFPNPSWQERDARPKPAS*
Ga0070670_10107338313300005331Switchgrass RhizosphereVTQVGWDDEKHTIWPWNLAAQSGFKPIFPSPGWQERESRSKK*
Ga0066388_10350752613300005332Tropical Forest SoilTQIGWDDEKHTIWPWDLAKKADFKMIFPSPSWAERESKSKAK*
Ga0066388_10608011413300005332Tropical Forest SoilGWDGEKHTVWPWDMAAKAGFKPVFPNPNWQERESKPKPN*
Ga0070674_10125838823300005356Miscanthus RhizosphereASGVVTQVGWDDDKHTIWPWNLAAQSGFKPIFPSPTWQERESRSKK*
Ga0070701_1080640023300005438Corn, Switchgrass And Miscanthus RhizosphereATGVVTQIGWDNDKHTIWPWDLAAQAGFKTMYPAPSWPERESHKK*
Ga0066681_1020337913300005451SoilTQIGWDGEKHTVWPWELAKRAGFKVLHPNPGWQERESKPKPAS*
Ga0066687_1052397713300005454SoilVTQVGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAG*
Ga0070662_10001679073300005457Corn RhizosphereVTQIGWDGEKHTIWPWDLAKQAGYTPVYPSPNWQERDAKPKPAK*
Ga0070662_10164251013300005457Corn RhizosphereVTQIGWDGEKHTIWPWDVAIKAEFKPLFPNPSWQEREAKPKPAK*
Ga0070698_10137828523300005471Corn, Switchgrass And Miscanthus RhizosphereVVTQIGWDGEKHTIWPWDLATKAKFQMLFPNPTWQERDTKPKPS*
Ga0073909_1070753723300005526Surface SoilGWDDEKHTIWPWDLAAQAGFKPIFPSPTWQERESHIKK*
Ga0070696_10183238623300005546Corn, Switchgrass And Miscanthus RhizosphereWDGEKHTIWPWDLATKANFKVIHPSPNWQERDSKPKPAN*
Ga0066698_1096818623300005558SoilVTQIGWDDEKHTIWPWDLAAQAGFKPIFPSPSWQERESRTKK*
Ga0066700_1112988323300005559SoilGEKHTIWPWDLAKRANFKVLYPSPGWQERDTKPKPAN*
Ga0066670_1014045533300005560SoilQIGWDGEKHTLWPWDLASKAGFKPIFPNPGWQERDSTPKPAS*
Ga0066693_1012826313300005566SoilGWDGEKHTIWPSDLAKRANFKMLYPNPSWPERDAKPKPAK*
Ga0068859_10061098633300005617Switchgrass RhizosphereTQVGWDGEKHTLWPWDLAARANFKPLFPSPSWQERESKPKPAS*
Ga0066905_10091776813300005713Tropical Forest SoilGWDGEKHTIWPWELAKRANFKIIYPMPSWQERDSKPKPAS*
Ga0066905_10097345323300005713Tropical Forest SoilVVTQIGWDGEKHTVWPWDLAAKSGFKPVYPNPSWQERESKPKPNN*
Ga0068861_10161161713300005719Switchgrass RhizosphereTQVGWDGEKHTLWPWDLATRANFKPIFPNPSWQERDSKPKPAN*
Ga0066903_10504949823300005764Tropical Forest SoilVTQIGWDGEKHTIWPWDLAKRANFQILYPNPGWPERESKPKPAQ*
Ga0068863_10062418423300005841Switchgrass RhizosphereQNELASGVVTQVGWDDDKHTIWPWNLAAQSGFKAIFPSPSWQERESRSKK*
Ga0081455_1077162713300005937Tabebuia Heterophylla RhizosphereGEKHTIWPWDLAKRANFKIIYSMPSWQERDSKPKPAS*
Ga0066696_1041008923300006032SoilTGVVTQIGWDGEKHTLWPWDLAAKSGFKPVYPNPSWQERDSKPKAN*
Ga0066656_1035983623300006034SoilATGVVTQIGWDGEKHTLWPWDLAAKSGFKPIYPNPSWQERDSKPKPS*
Ga0075417_1017935323300006049Populus RhizosphereATGVVTQIGWDGEKHTLWPWDLASKSGFKALYPNPGWQERDSKPKPN*
Ga0070715_1062219013300006163Corn, Switchgrass And Miscanthus RhizosphereVVTQIGWDDEKHTIWPWDLAAQAGFKPIYPSPSWQERETRSKK*
Ga0070712_10041413013300006175Corn, Switchgrass And Miscanthus RhizosphereNELATGVVTQIGWDDEKHTIWPWDLAAQAGFKPIYPSPSWQERETRSKK*
Ga0075428_10213549013300006844Populus RhizosphereIGWDGEKHTIWPWDLAKQAGYTPVYPSPTWQERDAKPKPAK*
Ga0075420_10025342213300006853Populus RhizosphereEKHTLWPWDLAAKANFKPIVPSPSWQERESKPKPAN*
Ga0075420_10072520723300006853Populus RhizosphereATGVVTQIGWDGEKHTVWPWDMGRRANFKMVYPNPGWQERDAKPKPAS*
Ga0075434_10197093613300006871Populus RhizosphereQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERESKPKPAN*
Ga0075436_10104274923300006914Populus RhizosphereWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAS*
Ga0079216_1151485313300006918Agricultural SoilTGVVTQIGWDGEKHTIWPWELATKAKYQTLFPNPNWQERDAKPKPAN*
Ga0079219_1197932923300006954Agricultural SoilVTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPAS*
Ga0099795_1026287423300007788Vadose Zone SoilVTQIGWDDEKHTIWPWDLAAQAGFKPIYPSPSWQERETRSKK*
Ga0075418_1057297033300009100Populus RhizosphereGVVTQIGWDGEKHTIWPWDLAKQAGYTPVYPSPNWQERDAKPKPAK*
Ga0066709_10447106113300009137Grasslands SoilTGVVTQIGWDGEKHTLWPWDLASKAAFKAVYPNPSWQERDSKPKPN*
Ga0111538_1232368723300009156Populus RhizosphereDGEKHSVWPWDMGRRANFKMVYPNPGWQERDAKPKPAS*
Ga0075423_1088548613300009162Populus RhizosphereGWDGEKHTLWPWDIAAKANFKPIFPSPSWQERESKPKPAS*
Ga0105242_1107560213300009176Miscanthus RhizosphereVVTQVGWDGEKHTLWPWDLAARANFKPIFPSPSWQERESKPKPAS*
Ga0126374_1141241413300009792Tropical Forest SoilHTIWPWDLAKQAGYTPVYPSPTWQERDAKPKPAK*
Ga0105069_102224413300009800Groundwater SandHTLWPWDLATKANFKPIFPSPSWQERDSKPKPGA*
Ga0126382_1020953513300010047Tropical Forest SoilDDEKHTIWPWDLAAQAGFKPLFPSPSWQERESRSKK*
Ga0134086_1001345643300010323Grasslands SoilVVTQIGWDGEKHTVWPWDLAAKSGFKAVYPSPSWQERESKPKPAN*
Ga0126372_1014711213300010360Tropical Forest SoilQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERESKPKPAS*
Ga0126372_1269000523300010360Tropical Forest SoilGEKHTIWPWDLAKRANFKIIYPMPSWQERDSKPKPAS*
Ga0126377_1163415613300010362Tropical Forest SoilTQIGWDDEKHTIWPWDLAAQANFKPIFPSPTWQERESRKK*
Ga0126377_1182190413300010362Tropical Forest SoilATGVVTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPGS*
Ga0126377_1323844323300010362Tropical Forest SoilWDDEKHTIWPWDLAAQAGFKAIFPSPSWQERESKTKK*
Ga0126379_1040851333300010366Tropical Forest SoilATGVVTQVGWDGEKHTIWPWDLAKRANFKIIYPMPSWQERDSKPKPAS*
Ga0126383_1085242613300010398Tropical Forest SoilNQKHTIWPWDLAAQAGFTPIFPFPTWAERESHKN*
Ga0134122_1179628223300010400Terrestrial SoilVVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGAN*
Ga0137446_101486313300011419SoilTQVGWDNQKHTIWPWDLATLAGFKPIFPAPGWQERETKK*
Ga0137382_1050002313300012200Vadose Zone SoilQVGWDGEKHTIWPWDLAKRANFKVLYPSPGWQERDTKPKPAN*
Ga0137399_1097150023300012203Vadose Zone SoilVVTQIGWDGEKHTVWPWDLAKRADFKPLYPTPAWLERDSKPKPGA*
Ga0137459_107209423300012228SoilASGVVTQVGWDDDKHTIWPWNLAAQSGFKAIFPSPSWQERESRSKK*
Ga0137358_1027689313300012582Vadose Zone SoilLATGVVTQIGWDGEKHTIWPWELAKRANFKIIFPSPSWQERDSKPKPAS*
Ga0137394_1148913023300012922Vadose Zone SoilGWDGEKHTLWPWDLAAKSGFKAVYPNPSWQERDSKPKPN*
Ga0164302_1030579213300012961SoilATGVVTQIGWDNDKHTIWPWDLAAQAGFKTMYPAPSWQERESHKK*
Ga0157373_1094568913300013100Corn RhizosphereTGAVTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPGS*
Ga0163162_1017643213300013306Switchgrass RhizosphereQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGAN*
Ga0163162_1272242513300013306Switchgrass RhizosphereIGWDGEKHTIWPWEMAKRANFKILFPSPSWQERDSKPKPAS*
Ga0157372_1234646123300013307Corn RhizosphereWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGAN*
Ga0182007_1004289633300015262RhizosphereIGWDNDKHTIWPWDLAAQAGFKTMYPAPSWPERESHKK*
Ga0132256_10050284513300015372Arabidopsis RhizosphereLATGVVTQIGWNGAKHTIWPWDLAKQAEYKVVHPSPSWQERDARPKP*
Ga0132257_10121397423300015373Arabidopsis RhizosphereLASGVVTQVGWDDEKHTIWPWDLAAQANFKPIFPSPSWQERDSRKK*
Ga0134083_1004275313300017659Grasslands SoilTQIGWDGEKHTVWPWDLAAKSGFKAVYPSPSWQERESKPKPN
Ga0184610_116371923300017997Groundwater SedimentVVTQIGWDDEKHTIWPWDLAAQAGFKPIFPSPSWQEREARSKK
Ga0184629_1011700433300018084Groundwater SedimentDGEKHTLWPWDLAAKSGFKAVYPNPSWQERDSKPKPN
Ga0066669_1159779413300018482Grasslands SoilQIGWDGEKHTVWPWDLATKSGFKPLYPNPGWQERDSKPKPN
Ga0173481_1075519413300019356SoilWDDEKHTIWPWDLATQAGFKTIFPSPSWQERESKTKK
Ga0193719_1002717513300021344SoilDEKHTIWPWDLAAQAGFKPIFPSPSWQEREARSKK
Ga0247692_105271113300024279SoilLATGVVTQVGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAS
Ga0207681_1111940323300025923Switchgrass RhizosphereLASGVVTQVGWDDEKHTIWPWNLAAQSGFKPIFPSPGWQERESRSKK
Ga0207669_1102401113300025937Miscanthus RhizosphereATGVVTQIGWDNDKHTIWPWDLAAQAGFKTMYPAPSWPERESHKK
Ga0207669_1149015613300025937Miscanthus RhizosphereGVVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGAN
Ga0207640_1065802713300025981Corn RhizosphereVGWDGEKHTLWPWDLAARANFKPLFPSPSWQERESKPKPAS
Ga0207648_1046026833300026089Miscanthus RhizosphereWDGEKHTLWPWDIAAKANFKPIFPSPSWQERESKPKPAS
Ga0207676_1094205323300026095Switchgrass RhizosphereTQVGWDDDKHTIWPWNLAAQSGFKAIFPSPSWQERESRSKK
Ga0208914_100763213300026102Natural And Restored WetlandsGWDNEKHTIWPWDLAKQAGFKTIFPAPGWQERDSKK
Ga0209237_102708513300026297Grasslands SoilVVTQIGWDGEKHTVWPWDLAAKSGFKAVYPSPSWQERESKPKPN
Ga0209468_103626733300026306SoilLATGVVTQVGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAG
Ga0209472_131902223300026323SoilDGEKHTVWPWELAKRAGFKVLHPNPGWQERESKPKPAS
Ga0209267_113287933300026331SoilVGWDDQKHTIWPWDLAKRAGYTMIHPNPSWAERDAKPKPR
Ga0209803_100613713300026332SoilDGEKHTLWPWDLAAKSGFKPIHPNPGWQERDSKPKPN
Ga0257152_103122413300026369SoilIGWDGEKHTIWPWELAKRANFKIIFPSPSWQERDSKPKPAS
Ga0209059_124845513300026527SoilVGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAG
Ga0209156_1003663613300026547SoilTQVGWDGEKHTLWPWDLAARANFKPIFPSPSWQERDSKPKPGN
Ga0209970_111802323300027614Arabidopsis Thaliana RhizosphereELASGVVTQIGWDGEKHTIWPWDLAKQAGYTPVYPSPNWQERDAKPKPAK
Ga0209799_104932213300027654Tropical Forest SoilGEKHTIWPWELAKRANFKIIYPMPSWQERDSKPKPAS
Ga0209799_113091413300027654Tropical Forest SoilTQVGWDGEKHTIWPWDLAKRANFKIIYPMPSWQERDSKPKPAS
Ga0209971_112215013300027682Arabidopsis Thaliana RhizosphereVTQIGWDGEKHTLWPWDLASKAKFKAVYPSPSWQERDSKPKPAS
Ga0209177_1039438223300027775Agricultural SoilVTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPAS
Ga0209814_1011508413300027873Populus RhizosphereGWDGEKHTLWPWDLASKSGFKALYPNPGWQERDSKPKPN
Ga0207428_1037707523300027907Populus RhizosphereELATGVVTQIGWDGEKHTIWPWDLAKQAGYTPVYPSPTWQERDAKPKPAK
Ga0209382_1038038913300027909Populus RhizosphereGWDGEKHTLWPWDLATKAGFKPVFPNPSWQERDSKPKPAS
Ga0209382_1127136723300027909Populus RhizosphereGWDGEKHTIWPWDLAAKAKFPVLFPNPNWQERDTKPKPAS
Ga0137415_10022554103300028536Vadose Zone SoilQIGWDGEKHTLWPWDLASKAGFKPIFPNPGWQERDSTPKPAS
Ga0137415_1054098723300028536Vadose Zone SoilVVTQIGWDGEKHTLWPWDLAAKSGFKPVYPNPSWQERDSKPKPN
Ga0307292_1050225113300028811SoilQIGWDDEKHTIWPWDLAAQAGFKPIFPSPSWQEREARSKK
Ga0307499_1019885213300031184SoilVVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPAN
Ga0318534_1061822413300031544SoilTQVGWDGEKHTIWPWDLAKRANFQIIYPNPAWPERESKPKPAQ
Ga0307408_10120814113300031548RhizosphereNVLATGVVTQIGWDGEKHTLWPWDLASKAKFKPIHPSPSWQERDSKPKPAS
Ga0307408_10193154913300031548RhizosphereGVVTQIGWDGEKHTLWPWDLASKANFKALYPNPSWQERDSKPKPGN
Ga0318496_1029589143300031713SoilKHTIWPWELAKRANFKIIYPMPSWQERDSKPKPAS
Ga0307468_10050324213300031740Hardwood Forest SoilVVTQVGWDDDKHTIWPWNLAAQSGFKPIFPSPSWQERESRSKK
Ga0307468_10071410523300031740Hardwood Forest SoilVVTQVGWDGEKHTLWPWDMATKANFKPIFPSPSWQERESKPKPAS
Ga0318568_1079756113300031819SoilSGVVTQVGWDGEKHTIWPWELAKRANFKIIYPMPSWQERDSKPKPAS
Ga0307473_1147434313300031820Hardwood Forest SoilKHTLWPWELATKANFKPIFPSPSWQERESKPKPSS
Ga0318567_1090104613300031821SoilQIGWDGEKHTIWPSELAKRANFTILYPNPGWRERESKPKPAQ
Ga0307413_1142972813300031824RhizosphereGWDGEKHTLWPWDLATKSGFKAIHPSPSWPERDSKPKPAS
Ga0310893_1014196613300031892SoilNVLATGVVTQVGWDGEKHTLWPWDLAAKANFKPIFPSPSWQERDSKPKPGS
Ga0307406_1161862513300031901RhizosphereGVVTQIGWDGEKHTLWPWDLASKVGFKAIHPNPSWQERDSKPKPAS
Ga0318569_1020916823300032010SoilGWDGEKHTIWPWELAKRANFKIIFPMPSWQERDSKPKPAS
Ga0318533_1063134813300032059SoilGWDGEKHTIWPSELAKRANFTILYPNPGWRERESKPKPAP
Ga0310890_1120998413300032075SoilLATGVVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERDSKPKPGA
Ga0318525_1004660313300032089SoilKHTIWPWELAKRANFKIIFPMPSWQERDSKPKPAS
Ga0307471_10077664033300032180Hardwood Forest SoilGWDGEKHTIWPWELAKRANFKIIFPSPSWQERDSKPKPAS
Ga0306920_10075559433300032261SoilQIGWDDEKHTVWPWDLAAQAGFKTIYPAPNWQERESRSKK
Ga0310812_1020815423300032421SoilVTQVGWDGEKHTLWPWDLAARANFKPIFPNPSWQERDSKPKPAN
Ga0310914_1108372113300033289SoilATGVVTQVGWDGEKHTLWPWDLATRANFKPIFPSPSWQERESKPKPAS
Ga0316626_1028638813300033485SoilVTQIGWDGEKHTLWPWDLATKAGFKAIYPNPSWQERDSKPKPGA
Ga0247829_1082431313300033550SoilGVVTQVGWDDEKHTIWPWDLAAQAGFKPIFPSPSWQERETRSKK
Ga0247829_1148833013300033550SoilNVLATGVVTQIGWDGEKHTLWPWDLASKSGFKPLYPNPSWQERDSKPKPN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.