Metagenome / Metatranscriptome Family F062141

Basic Information
Family ID	F062141
Family Type	Metagenome / Metatranscriptome
Number of Sequences	131
Average Sequence Length	44 residues
Representative Sequence	MPRGLIFLVIVILLLVGGIFLLSRSADEVPVKTIESDVTSNAATN
Number of Associated Samples	96
Number of Associated Scaffolds	131

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	77.10 %
% of genes near scaffold ends (potentially truncated)	30.53 %
% of genes from short scaffolds (< 2000 bps)	80.15 %
Associated GOLD sequencing projects	87
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Bacteria (99.237 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere (12.977 % of family members)
Environment Ontology (ENVO)	Unclassified (47.328 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.328 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 131 Family Scaffolds
PF01202	SKI	52.67
PF02899	Phage_int_SAM_1	6.87
PF01761	DHQ_synthase	4.58
PF02254	TrkA_N	2.29
PF12911	OppC_N	0.76
PF04964	Flp_Fap	0.76
PF07690	MFS_1	0.76
PF01592	NifU_N	0.76
PF07040	DUF1326	0.76

COG ID	Name	Functional Category	% Frequency in 131 Family Scaffolds
COG4973	Site-specific recombinase XerC	Replication, recombination and repair [L]	6.87
COG4974	Site-specific recombinase XerD	Replication, recombination and repair [L]	6.87
COG0822	Fe-S cluster assembly scaffold protein IscU, NifU family	Posttranslational modification, protein turnover, chaperones [O]	0.76
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	0.76
COG5588	Uncharacterized conserved protein, DUF1326 domain	Function unknown [S]	0.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	99.24 %
Unclassified	root	N/A	0.76 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	99.24 %
Unclassified	root	N/A	0.76 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	99.24 %
Unclassified	root	N/A	0.76 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	95.42 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.76 %
Unclassified	root	N/A	0.76 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	95.42 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.76 %
Unclassified	root	N/A	0.76 %

Name	Rank	Taxonomy	Distribution
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	85.50 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %
Unclassified	root	N/A	0.76 %

Name	Rank	Taxonomy	Distribution
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	84.73 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.76 %
unclassified Sphingomonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales	0.76 %
Unclassified	root	N/A	0.76 %

Name	Rank	Taxonomy	Distribution
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	81.68 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.76 %
Sphingomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	0.76 %
Unclassified	root	N/A	0.76 %

Name	Rank	Taxonomy	Distribution
Sphingomonas jaspsi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	58.78 %
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	14.50 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.76 %
Sphingomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	0.76 %
Unclassified	root	N/A	0.76 %

Name	Rank	Taxonomy	Distribution
Sphingomonas jaspsi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	58.78 %
Sphingomonas sp. NSE70-1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	14.50 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.76 %
Sphingomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	0.76 %
Unclassified	root	N/A	0.76 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2067725002\|GPICC_F5MS3JC01B7X5H	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	513	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_104550162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	602	Open in IMG/M
3300000956\|JGI10216J12902_104338091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	1632	Open in IMG/M
3300000956\|JGI10216J12902_109472702	All Organisms → cellular organisms → Bacteria	2685	Open in IMG/M
3300001431\|F14TB_100286425	All Organisms → cellular organisms → Bacteria	1792	Open in IMG/M
3300004016\|Ga0058689_10158943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	526	Open in IMG/M
3300004114\|Ga0062593_102390466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	596	Open in IMG/M
3300004114\|Ga0062593_102580883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	577	Open in IMG/M
3300004114\|Ga0062593_102814310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	555	Open in IMG/M
3300004156\|Ga0062589_100985511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	786	Open in IMG/M
3300004463\|Ga0063356_100214645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	2287	Open in IMG/M
3300004463\|Ga0063356_100230897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	2219	Open in IMG/M
3300004463\|Ga0063356_100446405	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1686	Open in IMG/M
3300004463\|Ga0063356_101231737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	1089	Open in IMG/M
3300004463\|Ga0063356_105380153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	550	Open in IMG/M
3300004479\|Ga0062595_100716048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	807	Open in IMG/M
3300004480\|Ga0062592_101974882	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	576	Open in IMG/M
3300005093\|Ga0062594_102443111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	572	Open in IMG/M
3300005159\|Ga0066808_1034426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	536	Open in IMG/M
3300005168\|Ga0066809_10030721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1135	Open in IMG/M
3300005290\|Ga0065712_10488216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	658	Open in IMG/M
3300005293\|Ga0065715_11042524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	534	Open in IMG/M
3300005295\|Ga0065707_10164150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1537	Open in IMG/M
3300005295\|Ga0065707_10437835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	792	Open in IMG/M
3300005331\|Ga0070670_100025738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	5063	Open in IMG/M
3300005331\|Ga0070670_101612779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	596	Open in IMG/M
3300005347\|Ga0070668_100212548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1592	Open in IMG/M
3300005347\|Ga0070668_101054902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	732	Open in IMG/M
3300005347\|Ga0070668_101435090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	630	Open in IMG/M
3300005353\|Ga0070669_101633987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	561	Open in IMG/M
3300005367\|Ga0070667_100046119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	3666	Open in IMG/M
3300005455\|Ga0070663_101628233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	576	Open in IMG/M
3300005456\|Ga0070678_102028307	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	544	Open in IMG/M
3300005518\|Ga0070699_100225608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1670	Open in IMG/M
3300005566\|Ga0066693_10449338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	528	Open in IMG/M
3300005719\|Ga0068861_102337132	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	537	Open in IMG/M
3300005844\|Ga0068862_100724465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	965	Open in IMG/M
3300005844\|Ga0068862_100873302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	883	Open in IMG/M
3300006046\|Ga0066652_100461689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1171	Open in IMG/M
3300006169\|Ga0082029_1358815	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1211	Open in IMG/M
3300006844\|Ga0075428_101575192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	687	Open in IMG/M
3300006871\|Ga0075434_102312437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	540	Open in IMG/M
3300006880\|Ga0075429_101844553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	524	Open in IMG/M
3300006881\|Ga0068865_100740309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	843	Open in IMG/M
3300006918\|Ga0079216_11867329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	518	Open in IMG/M
3300009094\|Ga0111539_10010632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	11588	Open in IMG/M
3300009094\|Ga0111539_13464331	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	507	Open in IMG/M
3300009100\|Ga0075418_11552962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	719	Open in IMG/M
3300009111\|Ga0115026_11844292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	513	Open in IMG/M
3300009156\|Ga0111538_10524838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	1500	Open in IMG/M
3300009156\|Ga0111538_10863801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1146	Open in IMG/M
3300009168\|Ga0105104_10301405	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	881	Open in IMG/M
3300010364\|Ga0134066_10063635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	984	Open in IMG/M
3300010397\|Ga0134124_12321055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	577	Open in IMG/M
3300010397\|Ga0134124_12941998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	520	Open in IMG/M
3300010403\|Ga0134123_13027077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	539	Open in IMG/M
3300013100\|Ga0157373_11118819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	591	Open in IMG/M
3300014326\|Ga0157380_10165552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	1926	Open in IMG/M
3300014326\|Ga0157380_10606515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	1084	Open in IMG/M
3300015371\|Ga0132258_10332202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	3752	Open in IMG/M
3300015371\|Ga0132258_10585258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	2800	Open in IMG/M
3300015371\|Ga0132258_10644125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	2664	Open in IMG/M
3300015371\|Ga0132258_10863347	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	2284	Open in IMG/M
3300015372\|Ga0132256_100067051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	3390	Open in IMG/M
3300015373\|Ga0132257_103096051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	606	Open in IMG/M
3300017789\|Ga0136617_10740653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	760	Open in IMG/M
3300017792\|Ga0163161_10766534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	808	Open in IMG/M
3300017792\|Ga0163161_11600516	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	574	Open in IMG/M
3300018081\|Ga0184625_10208439	All Organisms → cellular organisms → Bacteria	1025	Open in IMG/M
3300018469\|Ga0190270_12322723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	597	Open in IMG/M
3300018476\|Ga0190274_10078714	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2525	Open in IMG/M
3300018481\|Ga0190271_10166374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	2152	Open in IMG/M
3300019356\|Ga0173481_10656585	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	560	Open in IMG/M
3300020016\|Ga0193696_1115620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	682	Open in IMG/M
3300020202\|Ga0196964_10518054	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	583	Open in IMG/M
3300022756\|Ga0222622_10025116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	3097	Open in IMG/M
3300025223\|Ga0207672_1009566	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	579	Open in IMG/M
3300025907\|Ga0207645_10002602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	14073	Open in IMG/M
3300025920\|Ga0207649_11294924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	576	Open in IMG/M
3300025923\|Ga0207681_10376371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1142	Open in IMG/M
3300025925\|Ga0207650_10004080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	9981	Open in IMG/M
3300025926\|Ga0207659_10608692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	932	Open in IMG/M
3300025931\|Ga0207644_11714330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	526	Open in IMG/M
3300025938\|Ga0207704_10998800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	708	Open in IMG/M
3300025940\|Ga0207691_11089100	All Organisms → cellular organisms → Bacteria	665	Open in IMG/M
3300025972\|Ga0207668_10605272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	955	Open in IMG/M
3300025972\|Ga0207668_10756866	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	857	Open in IMG/M
3300025986\|Ga0207658_11256037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	677	Open in IMG/M
3300026067\|Ga0207678_10306247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	1366	Open in IMG/M
3300027907\|Ga0207428_10968195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	599	Open in IMG/M
3300028380\|Ga0268265_10020468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	4617	Open in IMG/M
3300028380\|Ga0268265_10074752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	2652	Open in IMG/M
3300028380\|Ga0268265_10783529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	928	Open in IMG/M
3300028587\|Ga0247828_10007528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	3902	Open in IMG/M
3300028587\|Ga0247828_10468881	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	741	Open in IMG/M
3300028587\|Ga0247828_10591674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	675	Open in IMG/M
3300028590\|Ga0247823_10592222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	835	Open in IMG/M
3300028889\|Ga0247827_10938820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	584	Open in IMG/M
3300030499\|Ga0268259_10077311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	716	Open in IMG/M
3300031477\|Ga0314812_101152	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	2531	Open in IMG/M
3300031492\|Ga0314808_100404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	6387	Open in IMG/M
3300031538\|Ga0310888_10003603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	5154	Open in IMG/M
3300031538\|Ga0310888_10519133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	714	Open in IMG/M
3300031548\|Ga0307408_100413393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1161	Open in IMG/M
3300031548\|Ga0307408_101087286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	741	Open in IMG/M
3300031562\|Ga0310886_10582804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	685	Open in IMG/M
3300031562\|Ga0310886_11052375	Not Available	523	Open in IMG/M
3300031731\|Ga0307405_10059255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	2412	Open in IMG/M
3300031731\|Ga0307405_11534907	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	586	Open in IMG/M
3300031731\|Ga0307405_12008739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	517	Open in IMG/M
3300031824\|Ga0307413_10122803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1762	Open in IMG/M
3300031852\|Ga0307410_10852084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	778	Open in IMG/M
3300031852\|Ga0307410_11129068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	680	Open in IMG/M
3300031858\|Ga0310892_10652785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	718	Open in IMG/M
3300031901\|Ga0307406_11939547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	525	Open in IMG/M
3300031903\|Ga0307407_11291122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	572	Open in IMG/M
3300031908\|Ga0310900_10207533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	1381	Open in IMG/M
3300031908\|Ga0310900_10705743	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	808	Open in IMG/M
3300031911\|Ga0307412_10053871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2668	Open in IMG/M
3300031911\|Ga0307412_10228391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1431	Open in IMG/M
3300031913\|Ga0310891_10000539	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	6919	Open in IMG/M
3300031995\|Ga0307409_100468382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1220	Open in IMG/M
3300032000\|Ga0310903_10109595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1188	Open in IMG/M
3300032000\|Ga0310903_10297866	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	792	Open in IMG/M
3300032002\|Ga0307416_100772302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	1055	Open in IMG/M
3300032004\|Ga0307414_10038154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	3223	Open in IMG/M
3300032004\|Ga0307414_10850460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	834	Open in IMG/M
3300032013\|Ga0310906_10484617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	834	Open in IMG/M
3300032075\|Ga0310890_10488103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi	934	Open in IMG/M
3300032126\|Ga0307415_100439772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. NSE70-1	1124	Open in IMG/M
3300032180\|Ga0307471_103805917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	534	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	57.25%
Environmental	Environmental	42.75%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	57.25%
Terrestrial	Environmental → Terrestrial	37.40%
Aquatic	Environmental → Aquatic	5.34%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	37.40%
Rhizosphere	Host-Associated → Plants → Rhizosphere	37.40%
Rhizoplane	Host-Associated → Plants → Rhizoplane	18.32%
Freshwater	Environmental → Aquatic → Freshwater	3.82%
Sediment	Environmental → Aquatic → Sediment	1.53%
Phyllosphere	Host-Associated → Plants → Phyllosphere	1.53%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	22.14%
Soil	Host-Associated → Plants → Rhizosphere → Soil	15.27%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.21%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	5.34%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.53%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.53%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.53%
Loam	Environmental → Terrestrial → Soil → Loam	1.53%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	1.53%
Ice	Environmental → Aquatic → Freshwater → Ice	0.76%
Sand	Environmental → Terrestrial → Soil → Sand	0.76%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	22.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	15.27%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	12.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.21%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	10.69%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	5.34%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.58%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.53%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.53%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.53%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	1.53%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.76%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.76%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.76%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.76%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.76%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	12.98%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	12.98%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	9.92%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	5.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.58%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.82%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.82%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	3.82%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.29%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.29%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.29%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	1.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.53%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.53%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	1.53%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.53%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.53%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.53%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	1.53%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.76%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.76%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.76%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.76%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.76%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.76%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.76%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.76%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.76%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.76%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.76%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.76%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.76%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2067725002	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300004016	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz	Host-Associated	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005159	Soil and rhizosphere microbial communities from Laval, Canada - mgLPB	Environmental	Open in IMG/M
3300005168	Soil and rhizosphere microbial communities from Laval, Canada - mgLPC	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006169	Termite nest microbial communities from Madurai, India	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017789	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300020016	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1	Environmental	Open in IMG/M
3300020202	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025223	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028590	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30	Environmental	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300030499	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)	Host-Associated	Open in IMG/M
3300031477	Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031492	Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_N_R5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F062141

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPICC_00269950	2067725002	Soil	ILVILLLVAGIYFLSQSADQVPVQTIESDVTANAATN
INPhiseqgaiiFebDRAFT_1045501622	3300000364	Soil	MPRGLIVLIIILILLVGGLFLLSKSADEVPVQNIEANVTANAATN*
JGI10216J12902_1043380912	3300000956	Soil	MPRGLIFLILVILLLVAGVYFLSQSADEVPVQTIESDVTANAAAN*
JGI10216J12902_1094727021	3300000956	Soil	MPRGLIFLILVILLLVAGVYFLSQSADEVPVQTIESDVTANAATN*
F14TB_1002864254	3300001431	Soil	MPRGLIFLVVAILLIVGGIFLLSKSADEVPVKAIETDVTGNAAAN*
Ga0058689_101589432	3300004016	Agave	MPRGLIFLVLLIVILIGGVYLLSRSADEVPVKTIETDVTSNAAAN*
Ga0062593_1023904661	3300004114	Soil	MPRGLIFLIIVIVLLVGGLFFLSKNADEVPVQTIEANVSSNAAAN*
Ga0062593_1025808832	3300004114	Soil	MPRGLIILVVAILLILGGIFLLSRSADEVPVKAIETDVTSNA
Ga0062593_1028143102	3300004114	Soil	MPRGLIFLVLFVIILIGGIVLLSRSADEVPVKVIETDVTSNAAAN*
Ga0062589_1009855112	3300004156	Soil	MPRGLIFLILVILLLVAGIYFLSQSADEVPVQTIESDVTANAATN*
Ga0063356_1002146454	3300004463	Arabidopsis Thaliana Rhizosphere	MPRGLFFLILIVLLLVAGVYFLSQSADQVPVQTIETDVTANAATN*
Ga0063356_1002308972	3300004463	Arabidopsis Thaliana Rhizosphere	MPRGLIFLVVLILLLTGGVFLLSRSADEVPVKTIETDVTSNAATN*
Ga0063356_1004464052	3300004463	Arabidopsis Thaliana Rhizosphere	MPRGLFFLILVILLLVAGVYFLSQSADEVPVQTIESDVTANAATN*
Ga0063356_1012317372	3300004463	Arabidopsis Thaliana Rhizosphere	MPRGLIFLLLIILLLVAGIYFLSQSADEVPVQTIESDVTANAAAN*
Ga0063356_1053801532	3300004463	Arabidopsis Thaliana Rhizosphere	GVTMPRGLIFLILVILLLVAGIYFLSQSADQVPVQTIESDVTANAATN*
Ga0062595_1007160482	3300004479	Soil	MPRGLIILVVAILLILGGIFLLSRSADEVPVKAIETDVTSNASAN*
Ga0062592_1019748821	3300004480	Soil	MPRGLFFLILVVLLLVAGVYFLSQSADEVPVQTIESDVTANAATN*
Ga0062594_1024431111	3300005093	Soil	MPRGLIFLVVLILLLVGGIYLLSRSADEVPVKTIETDVTSNAAAN*
Ga0066808_10344262	3300005159	Soil	MPRGLIFLVVAILLIVGGIFLLSRSADEVPVKTIETDVTSNAAAN*
Ga0066809_100307212	3300005168	Soil	MPRGLIFLIIILILLVGGLFLLSKSADEVPVQNIEANVTANAATN*
Ga0065712_104882161	3300005290	Miscanthus Rhizosphere	MPRGLIFLVLLILILVGGMFLLSKSADEVPVKTIETDVTSNAAAN*
Ga0065715_110425242	3300005293	Miscanthus Rhizosphere	MPRSVIFLILVILVLVGGLFLLSRSAREVPVQTIEANVTSNVAAN*
Ga0065707_101641503	3300005295	Switchgrass Rhizosphere	MPRGLIFLVIVILLLLGGIFLLSRSADEVPVKTIESDVTSNAATN*
Ga0065707_104378352	3300005295	Switchgrass Rhizosphere	MPRGLIFLVIVILLLVGGIYLLSRNAGEVPVKTIESDVTSNAATN*
Ga0070670_1000257384	3300005331	Switchgrass Rhizosphere	MPRGLIFLVVAILLIVGGTFLLSRSADEVPVKNIETDVTSNAAAN*
Ga0070670_1016127792	3300005331	Switchgrass Rhizosphere	MPRGLIFLIVVVLLLIGGVFLLSRSAQEVPVQTIEGNVTANAATN*
Ga0070668_1002125483	3300005347	Switchgrass Rhizosphere	MPRGLIFLVLLILMLVGGLFLLSKSAEEVPVKTIESGVTSNAAAN*
Ga0070668_1010549021	3300005347	Switchgrass Rhizosphere	MPRGLIFLVLVVLLLVGGIFFLSKSADEVPVKTIESDVTSNAATN*
Ga0070668_1014350902	3300005347	Switchgrass Rhizosphere	MPRGLIFLIIVIVLLAGGLFLLSKSADEVPVQTIEANVSSNAAAN*
Ga0070669_1016339872	3300005353	Switchgrass Rhizosphere	FLVLFVIILIGGIVLLSRSADEVPVKVIETDVTSNAAAN*
Ga0070667_1000461192	3300005367	Switchgrass Rhizosphere	MPRGLIILVVAILLILGGIFLLSRSADEVPVKAIETDVTSNAAAN*
Ga0070663_1016282332	3300005455	Corn Rhizosphere	MPRGLIFLIVVILILIGGMFLLSRSANEVPVQTIEGNVAGNAAAN*
Ga0070678_1020283071	3300005456	Miscanthus Rhizosphere	TMPRGLIFLVVLILLLVGGIYLLSRSADEVPVKTIETDVTSNAAAN*
Ga0070699_1002256083	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MPRGLIFLILVILILVAGLFFLSRSAEEVPVQTIEANVTANATN*
Ga0066693_104493382	3300005566	Soil	MPRGLIFLVVAILLILGGIFLLSRSADEVPVKTIETDVTSNAAAN*
Ga0068861_1023371321	3300005719	Switchgrass Rhizosphere	PSVSGVTMPRGLIFLILVILLLVAGIYFLSQSADQVPVQTIESDVTANAATN*
Ga0068862_1007244651	3300005844	Switchgrass Rhizosphere	MPRGLIILIIILILLVGGLFLLSKSADEVPVQNIEANVTANAATN*
Ga0068862_1008733022	3300005844	Switchgrass Rhizosphere	MPRGLIFLVIVILLLVGGIFLLSRSADEVPVKTIESDVTSNAATN*
Ga0066652_1004616892	3300006046	Soil	MPRSVIFLILVILVLVGGLFLLSRSVREVPVQTIEANVTSNAAAN*
Ga0082029_13588152	3300006169	Termite Nest	MPRGLLFLIVVIILVVGGIFLLSRSVEEVPVQTIEANVAGNAVAN*
Ga0075428_1015751922	3300006844	Populus Rhizosphere	MPRGLIFLVILILLLAGGLFLLSRNADEVPVKTIETDVTSNAAAN*
Ga0075434_1023124372	3300006871	Populus Rhizosphere	AILLILGGIFLLSRSADEVPVKAIETDVTSNASAN*
Ga0075429_1018445532	3300006880	Populus Rhizosphere	MPRGLIFLVLIILLLIGGIFLLSKSADEVPVKTIETDVTSNAAAN*
Ga0068865_1007403092	3300006881	Miscanthus Rhizosphere	MPRGLIILVVAILLIFGGIFLLSRSADEVPVKAIETDVTSNASAN*
Ga0079216_118673291	3300006918	Agricultural Soil	DGAEMPRGLIILVVAVLLIVGGIFLLSRSAEEVPVQTIEGNVTANAASN*
Ga0111539_100106327	3300009094	Populus Rhizosphere	MPRGLIILVVAILLILGGIFLLSRNADEVPVKAIETDVTSNASAN*
Ga0111539_134643312	3300009094	Populus Rhizosphere	MPRGLIVLIIILILLVGGLFLLSRSADEVPVQNIEANVTANAATN*
Ga0075418_115529622	3300009100	Populus Rhizosphere	RGLIFLVVVIVLLIGGIFLLSRSAEEVPVQTIEANVSSNAAAN*
Ga0115026_118442921	3300009111	Wetland	MPRGLIFLIAVVLLLVGGIFLLSRSAEEVPVQTMEADVSSNATAN*
Ga0111538_105248382	3300009156	Populus Rhizosphere	LVVAILLILGGIFLLSRSADEVPVKAIETDVTSNASAN*
Ga0111538_108638012	3300009156	Populus Rhizosphere	MPRGLIVLIIIIILLVGGLFLLSKSADEVPVQNIEANVTANAATN*
Ga0105104_103014052	3300009168	Freshwater Sediment	MPRGLIFLVLLILILIGGIYLLSRSADEVPVKSIETDVTSNAAAN*
Ga0134066_100636352	3300010364	Grasslands Soil	MPRGLIFLIIVIVLLVGGLFLLSRNADEVPVQTIEANVSSNAAAN*
Ga0134124_123210552	3300010397	Terrestrial Soil	MPRGLIFLVILILLLIGGIFLLSRSANEVPVKNIESDVTSNAAAN*
Ga0134124_129419982	3300010397	Terrestrial Soil	MPRGLIFLVLLILILVGGMFLLSKSADEVPVKTIETD
Ga0134123_130270772	3300010403	Terrestrial Soil	LIFLVVLILLLVGGIYLLSRSADVVQVETIETDVTSNAAAN*
Ga0157373_111188191	3300013100	Corn Rhizosphere	MPRGLIFLVVVLLLLVGGIFLLSRSADEVPVKTIESDVTSNAAAN*
Ga0157380_101655522	3300014326	Switchgrass Rhizosphere	MPRGLIFLILVILLLVAGIYFLSQSADQVPVQTIESDVTANAATN*
Ga0157380_106065152	3300014326	Switchgrass Rhizosphere	GATMPRGLIFLVLLILILIGGIYLLSRSADEVPVKSIETDVTSNAAAN*
Ga0132258_103322022	3300015371	Arabidopsis Rhizosphere	MPRGLIFLVLLILVLIGGMFLLSKSADEVPVKTIETDVSSNAAAN*
Ga0132258_105852582	3300015371	Arabidopsis Rhizosphere	MPRGLIILVVALILLVGGLFLLSRSAEEVPVQTIESNVTANAATN*
Ga0132258_106441253	3300015371	Arabidopsis Rhizosphere	MPRGLIILVVVLILLVGGLFLLSRSAEQVPVQTIETNVTANAATN*
Ga0132258_108633473	3300015371	Arabidopsis Rhizosphere	MPRGLIFLVVAILLIVGGIFLLSKSADEVPVKNIETDVTSNAAAN*
Ga0132256_1000670513	3300015372	Arabidopsis Rhizosphere	MPRGLIFLVVAILLIVGGAFLLSRSADEVPVKNIETDVTSNAAAN*
Ga0132257_1030960512	3300015373	Arabidopsis Rhizosphere	MPRGLIILVVVLILLVGGLFLLSRSAKDVPVQTIESNVTANAATN*
Ga0136617_107406532	3300017789	Polar Desert Sand	MRGPVILIVILILLIAGVFLLSRSAGDVPVTTIETDVAGNGTTN
Ga0163161_107665342	3300017792	Switchgrass Rhizosphere	GVTMPRGLIILIIILILLVGGLFLLSKSADEVPVQNIEANVTANAATN
Ga0163161_116005162	3300017792	Switchgrass Rhizosphere	MPRSVIFLILVILVLVGGLFLLSRSAREVPVQTIEANVT
Ga0184625_102084392	3300018081	Groundwater Sediment	MPRGLIFLILVILLLVAGIYFLSQSADQVPVQTIESDVTANAATN
Ga0190270_123227232	3300018469	Soil	MPRGLIFLFLLIILLAGGIFLLSRSADEVPVKTIESDVTSNAAAN
Ga0190274_100787141	3300018476	Soil	MPRGLFFLILVILLLAGGIYLLSSSADEVPVQTVEGDVTANASAN
Ga0190271_101663742	3300018481	Soil	MPRGLIFLILVILLLVAGIYFLSQSADEVPVQTIESDVTANAATN
Ga0173481_106565852	3300019356	Soil	MPRGLIILVVAILLILGGIFLLSRSADEVPVKAIETDVT
Ga0193696_11156202	3300020016	Soil	MPRGLIFLILVILLLVAGIYFLSQSADQVPVQTIES
Ga0196964_105180542	3300020202	Soil	IFLILIILIIVGGLFLLSNSAKEVPVQTIEADVTANATN
Ga0222622_100251164	3300022756	Groundwater Sediment	MPRGLIFLIIVIVLLVGGLFFLSKNADEVPVQTIEANVSSNAAAN
Ga0207672_10095661	3300025223	Corn, Switchgrass And Miscanthus Rhizosphere	MPRGLIILVVAILLILGGIFLLSRSADEVPVKAIETDVTSNASAN
Ga0207645_100026029	3300025907	Miscanthus Rhizosphere	MPRGLIILVVAILLILGGIFLLSRSADEVPVKAIETDVTSNAAAN
Ga0207649_112949242	3300025920	Corn Rhizosphere	MPRGLIILVVAILLILGGIFLLSRSADEVPVKAIETDVTS
Ga0207681_103763712	3300025923	Switchgrass Rhizosphere	MPRGLIILIIILILLVGGLFLLSKSADEVPVQNIEANVTANAATN
Ga0207650_100040804	3300025925	Switchgrass Rhizosphere	MPRGLIFLVVAILLIVGGTFLLSRSADEVPVKNIETDVTSNAAAN
Ga0207659_106086922	3300025926	Miscanthus Rhizosphere	MPRGLFFLILVVLLLVAGVYFLSQSADEVPVQTIESDVTANAATN
Ga0207644_117143302	3300025931	Switchgrass Rhizosphere	MPRGLIFLVVVVLLLIGGVYFLSRNAKEVPVQSIE
Ga0207704_109988002	3300025938	Miscanthus Rhizosphere	MPRGLIILVVAILLIFGGIFLLSRSADEVPVKAIETDVTSNASAN
Ga0207691_110891001	3300025940	Miscanthus Rhizosphere	PRVSGVTMPRGLIFLILVILLLVAGIYFLSQSADQVPVQTIESDVTANAATN
Ga0207668_106052722	3300025972	Switchgrass Rhizosphere	MPRGLIFLIIVIVLLAGGLFLLSKSADEVPVQTIEANVSSNAAAN
Ga0207668_107568662	3300025972	Switchgrass Rhizosphere	MPRGLIFLVVLIFLLAGGIFLLSRSADEVPVKTIESDVTSNAAAN
Ga0207658_112560372	3300025986	Switchgrass Rhizosphere	MPRGLIFLVIVILLLVGGIFLLSRSADEVPVKTIESDVTSNAATN
Ga0207678_103062472	3300026067	Corn Rhizosphere	MPRGLIFLIVVILILIGGMFLLSRSANEVPVQTIEGNVAGNAAAN
Ga0207428_109681952	3300027907	Populus Rhizosphere	MPRGLIVLIIILILLVGGLFLLSKSADEVPVQNIEANVTANAATN
Ga0268265_100204682	3300028380	Switchgrass Rhizosphere	MPRGLIFLVLVVLLLVGGIFFLSKSADEVPVKTIESDVTSNATTN
Ga0268265_100747523	3300028380	Switchgrass Rhizosphere	PRGLIFLVIVILLLVGGIFLLSRSADEVPVKTIESDVTSNAAAN
Ga0268265_107835292	3300028380	Switchgrass Rhizosphere	MPRGLIFLVLLILILVGGMFLLSKSADEVPVKTIETDVTSNAAAN
Ga0247828_100075282	3300028587	Soil	MPRGLIFLILVILLLVAGVYFLSQSADEVPVQTIESDVTANAAAN
Ga0247828_104688812	3300028587	Soil	MPRGLIFLILVILLLVAGIYFLSQSADQVPVQTIESDVTANA
Ga0247828_105916741	3300028587	Soil	MPRGLFFLILVILLLVAGVYFLSQSADEVPVQTIESDVTANAATN
Ga0247823_105922221	3300028590	Soil	MSRGLIFLILVILLLVAGVYFLSQSADEVPVQTIESDVTANAATN
Ga0247827_109388202	3300028889	Soil	MPRSLLFLIVVVLLLIGGLVILSRSVDEVPVQTIETDVAGNAAAS
Ga0268259_100773112	3300030499	Agave	MPRGLIFLVLLIVILIGGVYLLSRSADEVPVKTIETDVTSNAAAN
Ga0314812_1011521	3300031477	Soil	VTMPRGLIFLILVILLLVAGVYFLSQSADEVPVQTIESDITANAATN
Ga0314808_1004041	3300031492	Soil	MPRGLIFLILVILLLVAGVYFLSQSADEVPVQTIESDITANAATN
Ga0310888_100036034	3300031538	Soil	MPRGLIFLLILILLLVGGLFLLSRSADEVPVKTIETDVTSNAAAN
Ga0310888_105191332	3300031538	Soil	MPRGLIFLVVAILLIVGGIFLLSKSADEVPVKTIETDVTSNAAAN
Ga0307408_1004133932	3300031548	Rhizosphere	MPRGLIFLVVLILLLTGGVFLLSRSADEVPVKTIETDVTSNAATN
Ga0307408_1010872862	3300031548	Rhizosphere	MQSGATMPRGLIFLVVLILLLIGGIFLLSRSADEMPVKTIESDVASNAAAN
Ga0310886_105828041	3300031562	Soil	PMRSGATMPRGLIFLVVLILLLVGGIYLLSRSADEVPVKTIETDVTSNAAAN
Ga0310886_110523751	3300031562	Soil	MPRGLIFLILVILLLVAGIYFLSQSADEVPVQTIESD
Ga0307405_100592552	3300031731	Rhizosphere	MPRGLIILVIAVLLLAGGIFLLSRSADEVPVKTIESDVSSHAPAN
Ga0307405_115349072	3300031731	Rhizosphere	MPRGLIFLVVLILLLIGGIFLLSRSADEMPVKTIESDVASNAAAN
Ga0307405_120087392	3300031731	Rhizosphere	MPRGLIFLIVVILLLVGGMFMLSRSAEEVPVRTIETDVAGNAAAN
Ga0307413_101228032	3300031824	Rhizosphere	MPRGLLFLIVVILLLIGGIFLLSRSAGEVPVQTIEANVAGNATSN
Ga0307410_108520842	3300031852	Rhizosphere	LILLILIVIGGLFLLSNSAEEVPVQTIEADVTANAAN
Ga0307410_111290681	3300031852	Rhizosphere	MEPTLPRGLFFLILVVVLIIGGLFLLSRNAEEVPVQTIEADVSGNAAAN
Ga0310892_106527852	3300031858	Soil	RDLIFLVLFVIILIGGIVLLSRSADEVPVKVIETDVTSNAAAN
Ga0307406_119395472	3300031901	Rhizosphere	IFLIVVILLLVGGLFLLSRSVEEVPVQTIEADVAGNAAAN
Ga0307407_112911222	3300031903	Rhizosphere	MPRGLIFLIVVILLLVGGIFLLSRSADEVPVQTIEA
Ga0310900_102075331	3300031908	Soil	LILVILLLVAGIYFLSQSADQVPVQTIESDVTANAATN
Ga0310900_107057432	3300031908	Soil	MPRGLIFLVVLIFLLAGGIFLLSRSADEVPVKAIESDVTSNAAAN
Ga0307412_100538714	3300031911	Rhizosphere	MPRGLLFLIVVILLLIGGIFLLSRNAGEVPVQTIEANVAGNATAN
Ga0307412_102283911	3300031911	Rhizosphere	MPRGLIFLIVVILLLVGGLFLLSRSVEEVPVQTIE
Ga0310891_100005397	3300031913	Soil	MPRGLIILVVAILLILGGIFLLSRNADEVPVKAIETDVTSNASAN
Ga0307409_1004683822	3300031995	Rhizosphere	MPRGLLFIILVLILLIGGIYFLSSSAEQVPVQKIETDVTANAAAN
Ga0310903_101095951	3300032000	Soil	NRRPGGVTMPRGLIILIIILILLVGGLFLLSKSADEVPVQNIEANVTANAATN
Ga0310903_102978662	3300032000	Soil	MPRGLIFLLILILLLVGGLFLLSRSADEVPVKTIETDVTSN
Ga0307416_1007723022	3300032002	Rhizosphere	MPRGLIFLVVLILLLAGGIFLLSRSADEVPVKTIESDVTSNAAAN
Ga0307414_100381542	3300032004	Rhizosphere	MPQGLLFLIVVILLLIGGIFLLSRSAGEVPVQTIEANVAGNATSN
Ga0307414_108504602	3300032004	Rhizosphere	MPRGLIFLIVVILILIGGMFLLSRSANEVPVQTIEGDVAGNAAAN
Ga0310906_104846172	3300032013	Soil	MPRGLIFLVLFVIILIGGIVLLSRSADEVPVKVIETDVTSNAAAN
Ga0310890_104881032	3300032075	Soil	MPRGLIFLIVAILLIVGGIFLLSKSADEVPVKAIETDVTSNAAAN
Ga0307415_1004397721	3300032126	Rhizosphere	LIVVILLLVGGLFLLSRSAEEVPVQTIEADVASNAAAN
Ga0307471_1038059171	3300032180	Hardwood Forest Soil	MPRGLIFLVVAILLIIGGIFLLSRSADEVPVKTIETDVTSNAAAN

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign