NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062138

Metagenome / Metatranscriptome Family F062138

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062138
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 48 residues
Representative Sequence KFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Number of Associated Samples 117
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.05 %
% of genes near scaffold ends (potentially truncated) 96.18 %
% of genes from short scaffolds (< 2000 bps) 89.31 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.473 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.718 % of family members)
Environment Ontology (ENVO) Unclassified
(31.298 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.672 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.33%    β-sheet: 0.00%    Coil/Unstructured: 70.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF00005ABC_tran 85.50
PF00528BPD_transp_1 7.63
PF03401TctC 0.76
PF01326PPDK_N 0.76
PF09423PhoD 0.76
PF00903Glyoxalase 0.76
PF07519Tannase 0.76
PF13476AAA_23 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.76
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.47 %
UnclassifiedrootN/A1.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000580|AF_2010_repII_A01DRAFT_1039424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium733Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1046225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria671Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10002988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum3796Open in IMG/M
3300000956|JGI10216J12902_104139929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300002908|JGI25382J43887_10464074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria536Open in IMG/M
3300002910|JGI25615J43890_1080238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300004479|Ga0062595_100325235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1054Open in IMG/M
3300004633|Ga0066395_10123280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1281Open in IMG/M
3300005332|Ga0066388_100234996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2467Open in IMG/M
3300005332|Ga0066388_105263102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales656Open in IMG/M
3300005363|Ga0008090_10158574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2067Open in IMG/M
3300005437|Ga0070710_11053590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300005540|Ga0066697_10237524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1081Open in IMG/M
3300005554|Ga0066661_10403761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales837Open in IMG/M
3300005561|Ga0066699_10575785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales808Open in IMG/M
3300005610|Ga0070763_10109525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1402Open in IMG/M
3300005610|Ga0070763_10704133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300005713|Ga0066905_100012917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales4095Open in IMG/M
3300005713|Ga0066905_101163543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales688Open in IMG/M
3300006058|Ga0075432_10487030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales547Open in IMG/M
3300006172|Ga0075018_10079173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1423Open in IMG/M
3300006578|Ga0074059_12107101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales919Open in IMG/M
3300006854|Ga0075425_100389451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1605Open in IMG/M
3300009143|Ga0099792_10128219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum indicum1372Open in IMG/M
3300009700|Ga0116217_10843837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300009792|Ga0126374_11261045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium595Open in IMG/M
3300010046|Ga0126384_10357512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum indicum1219Open in IMG/M
3300010047|Ga0126382_10367422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1109Open in IMG/M
3300010048|Ga0126373_11385693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria769Open in IMG/M
3300010358|Ga0126370_10694198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium893Open in IMG/M
3300010359|Ga0126376_10674261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium990Open in IMG/M
3300010362|Ga0126377_11516196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria744Open in IMG/M
3300010375|Ga0105239_11803409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium709Open in IMG/M
3300010376|Ga0126381_102451326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300010376|Ga0126381_103883540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300010376|Ga0126381_104491117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300010379|Ga0136449_102112530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium826Open in IMG/M
3300010398|Ga0126383_10945199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium949Open in IMG/M
3300010400|Ga0134122_10337543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum indicum1308Open in IMG/M
3300010401|Ga0134121_12435398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300010403|Ga0134123_13430144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300010868|Ga0124844_1057843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1388Open in IMG/M
3300010868|Ga0124844_1202058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium727Open in IMG/M
3300012492|Ga0157335_1047524Not Available503Open in IMG/M
3300012961|Ga0164302_11646041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300012971|Ga0126369_11697947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium721Open in IMG/M
3300012972|Ga0134077_10369666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300012988|Ga0164306_10443976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium985Open in IMG/M
3300014162|Ga0181538_10274025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria923Open in IMG/M
3300015357|Ga0134072_10216126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300015372|Ga0132256_100445696All Organisms → cellular organisms → Bacteria → Proteobacteria1401Open in IMG/M
3300016294|Ga0182041_12289864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300016319|Ga0182033_12132467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300016357|Ga0182032_11994619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300016371|Ga0182034_12009392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300016445|Ga0182038_10732372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium863Open in IMG/M
3300017930|Ga0187825_10313799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300017970|Ga0187783_10968721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium613Open in IMG/M
3300017970|Ga0187783_11182874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300017972|Ga0187781_10766942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300018057|Ga0187858_10429226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium817Open in IMG/M
3300018089|Ga0187774_10946339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300018482|Ga0066669_10861218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium807Open in IMG/M
3300020581|Ga0210399_10601940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium909Open in IMG/M
3300021372|Ga0213877_10002501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4075Open in IMG/M
3300021478|Ga0210402_10084217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2833Open in IMG/M
3300021479|Ga0210410_10276689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum pacificum1506Open in IMG/M
3300021560|Ga0126371_12931958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium578Open in IMG/M
3300021860|Ga0213851_1315301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium780Open in IMG/M
3300024176|Ga0224565_1042031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300025906|Ga0207699_10721671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium730Open in IMG/M
3300025910|Ga0207684_10774554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium812Open in IMG/M
3300025919|Ga0207657_10648003Not Available822Open in IMG/M
3300025928|Ga0207700_10332949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1318Open in IMG/M
3300025986|Ga0207658_10155255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1870Open in IMG/M
3300026324|Ga0209470_1086364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1428Open in IMG/M
3300026529|Ga0209806_1043782All Organisms → cellular organisms → Bacteria2143Open in IMG/M
3300026552|Ga0209577_10184842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1613Open in IMG/M
3300026867|Ga0207475_1016068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300027835|Ga0209515_10076555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2363Open in IMG/M
3300027869|Ga0209579_10667461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300027884|Ga0209275_10781147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300027907|Ga0207428_10792914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium673Open in IMG/M
3300027986|Ga0209168_10497029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300031543|Ga0318516_10257316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1009Open in IMG/M
3300031545|Ga0318541_10067672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1866Open in IMG/M
3300031545|Ga0318541_10849008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300031561|Ga0318528_10087272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum pacificum1624Open in IMG/M
3300031563|Ga0307436_1156301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300031572|Ga0318515_10493726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium653Open in IMG/M
3300031640|Ga0318555_10513001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300031719|Ga0306917_10008135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales5871Open in IMG/M
3300031720|Ga0307469_11625178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium621Open in IMG/M
3300031747|Ga0318502_10013133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3820Open in IMG/M
3300031748|Ga0318492_10718633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300031768|Ga0318509_10063190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1924Open in IMG/M
3300031770|Ga0318521_10788761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300031771|Ga0318546_10136185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum pacificum1644Open in IMG/M
3300031794|Ga0318503_10281557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300031795|Ga0318557_10235856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium837Open in IMG/M
3300031795|Ga0318557_10241648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium827Open in IMG/M
3300031831|Ga0318564_10024631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae2525Open in IMG/M
3300031831|Ga0318564_10061653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum1644Open in IMG/M
3300031845|Ga0318511_10614584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300031846|Ga0318512_10118797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1256Open in IMG/M
3300031859|Ga0318527_10089986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1250Open in IMG/M
3300031880|Ga0318544_10422492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300031910|Ga0306923_10363925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum pacificum1648Open in IMG/M
3300031910|Ga0306923_11916572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300031912|Ga0306921_12452844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300031941|Ga0310912_10866132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300031947|Ga0310909_10400425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum1152Open in IMG/M
3300031947|Ga0310909_11309716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300031959|Ga0318530_10098476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1160Open in IMG/M
3300031959|Ga0318530_10190918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium839Open in IMG/M
3300031981|Ga0318531_10138087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1088Open in IMG/M
3300032002|Ga0307416_103873284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300032035|Ga0310911_10093604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum pacificum1638Open in IMG/M
3300032042|Ga0318545_10072192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1188Open in IMG/M
3300032054|Ga0318570_10103017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum1247Open in IMG/M
3300032094|Ga0318540_10107640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum1315Open in IMG/M
3300032160|Ga0311301_11516480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium824Open in IMG/M
3300032770|Ga0335085_10898145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium966Open in IMG/M
3300032805|Ga0335078_10479379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum1605Open in IMG/M
3300032828|Ga0335080_10347708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum1600Open in IMG/M
3300032892|Ga0335081_10314297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2065Open in IMG/M
3300032954|Ga0335083_10089471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales3072Open in IMG/M
3300033134|Ga0335073_10663480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1149Open in IMG/M
3300033158|Ga0335077_10128652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2933Open in IMG/M
3300033289|Ga0310914_11589275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300033290|Ga0318519_10540997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium704Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.34%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.34%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.05%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.05%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.29%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.29%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.29%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.53%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.53%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.76%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.76%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.76%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.76%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.76%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.76%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012492Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610Host-AssociatedOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026867Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027835Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031563Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A01DRAFT_103942423300000580Forest SoilMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR*
AF_2010_repII_A01DRAFT_104622523300000580Forest SoilLLENTVRAMKGVGMLEKDVDLKKIVDSSLLPADLQK*
AF_2010_repII_A001DRAFT_1000298853300000793Forest SoilEPLPAKDVGLMVKELVDAKFWTEGRIEMPLLENTVRAMKGVGMLEKDVDLKKIVDSSLLPADLQK*
JGI10216J12902_10413992923300000956SoilLVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQKDVDLKKIVDSSFLPADLQK*
JGI25382J43887_1046407423300002908Grasslands SoilDVGIMVKELVEAKFWTEGRIEMPLLXQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK*
JGI25615J43890_108023813300002910Grasslands SoilTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR*
Ga0062595_10032523513300004479SoilDLVDAKFWSEGKIEMPLLEQTVHAMKGVGMLDKDVDLKSIVDSSFLPADLQK*
Ga0066395_1012328033300004633Tropical Forest SoilDVGIMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR*
Ga0066388_10023499643300005332Tropical Forest SoilEGRIEMPLLEQTVHAMKGVGMLQKDVDLKKIVDTSFLPADLQ*
Ga0066388_10526310213300005332Tropical Forest SoilTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK*
Ga0008090_1015857413300005363Tropical Rainforest SoilEAKFWTEGRIEMPLLEQTVHAMKGVGMVQNDVDLKKIVDGSFLPPDLQK*
Ga0070710_1105359013300005437Corn, Switchgrass And Miscanthus RhizosphereKFWSEGRIEMPLLEHTVRAMKGVGMLDKDIDLKTVVDGSLLPAELQK*
Ga0066697_1023752443300005540SoilMPLLEQTVHAMKGVGMLQKDVDLSKVVDSSFLPPDLQK*
Ga0066661_1040376113300005554SoilFWSEGRIEMPLLENTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR*
Ga0066699_1057578523300005561SoilEGRIEMPLLEQTVHAMKGVGMLQKDVDLTKIVDSSFLPPDLQK*
Ga0070763_1010952533300005610SoilYSEGQIEMPLLVNTVRAMKYVGMIDKDPDLSKMIDASFLPSDLQK*
Ga0070763_1070413313300005610SoilFWSEGKMEMDLLQTTERAMKYVGMIDKPLDLDKMVDTSFLPSDQK*
Ga0066905_10001291773300005713Tropical Forest SoilGRIEMPLLEQTVHAMKGVGMLQKDVDLTKIVDSSFLPSDLQK*
Ga0066905_10116354323300005713Tropical Forest SoilIEMPLLEQTVHAMKGVGMLQKDVDLSKVVDNSFLPPDLQK*
Ga0075432_1048703023300006058Populus RhizosphereLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR*
Ga0075018_1007917333300006172WatershedsVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR*
Ga0074059_1210710123300006578SoilRIEMPLLENTVHAMKGVGMLEKDVDLSKMVDSSFLPPDLQK*
Ga0075425_10038945133300006854Populus RhizosphereYAPLPPSEVGIMVKQLVEAKFWSEGRIEMPLLAQTVHAMKGVGMLQKDVDLKKVVDSSFLPPDLQK*
Ga0099792_1012821913300009143Vadose Zone SoilEQTVHAMKGVGMLQKDVDLTKIVDSSFLPPDLQK*
Ga0116217_1084383723300009700Peatlands SoilFYSEGQIEMPLLVNTVKAMKYVGMIDKDPDLSKMIDASFLPSDLQQVK*
Ga0126374_1126104523300009792Tropical Forest SoilTEGRIEMPLLEQTVHAMKGVGMLQKDVDLKKVVDSSFLPPDLQK*
Ga0126384_1035751213300010046Tropical Forest SoilIEMPLLEQTVHAMKGVGMLQKDVDLSKVVDSSFLPPDLQK*
Ga0126382_1036742233300010047Tropical Forest SoilEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKVVEGSFLPPDLQK*
Ga0126373_1138569323300010048Tropical Forest SoilLQQTVHAMKGVGMLQKDVDLKGVVDSSLLPADLLK*
Ga0126370_1069419823300010358Tropical Forest SoilEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR*
Ga0126376_1067426123300010359Tropical Forest SoilMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK*
Ga0126377_1151619623300010362Tropical Forest SoilVDAKFWSEGRIEMPLLEQTVHAMKGVGMLQKDVDLKSVVDSSLLPADLQK*
Ga0105239_1180340923300010375Corn RhizosphereVEAKFWSEGRIEMPLLAQTVHAMIGVGMLQKDVDLKKMVDSSFLPPDLQK*
Ga0126381_10245132613300010376Tropical Forest SoilRIEMPLLEQTVHAMKGVGMLQNDVDLKKVVDGSFLPPDLQK*
Ga0126381_10388354023300010376Tropical Forest SoilVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQR*
Ga0126381_10449111713300010376Tropical Forest SoilIMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR*
Ga0136449_10211253013300010379Peatlands SoilAKFYSEGQIEMPLLVNTVKAMKYVGMIDKDPDLSKMIDASFLPSDLQQVK*
Ga0126383_1094519913300010398Tropical Forest SoilPLPPKDVGIMVKELAEAKFWTEGRIEMSLLEQTVRAMKGVGMLQNGVDLKKIVDGSFLPPDLQK*
Ga0134122_1033754313300010400Terrestrial SoilKFWSEGRIEMPLLAQTVHAMKGVGMLQKDVDLKKVVDSSFLPPDLQK*
Ga0134121_1243539823300010401Terrestrial SoilMVKELVEAKFWSEGRIEMPLLAQTVHAMKGVGMLQKDVDLKKVVDSSFLPPDLQK*
Ga0134123_1343014413300010403Terrestrial SoilIEMPLLAQTVHAMKGVGMLQKDVDLKKVVDSSFLPPDLQK*
Ga0124844_105784333300010868Tropical Forest SoilMPLLEQTVHAMKGVGMLQNDVGLKKIVDGSFLPPDLQK*
Ga0124844_120205813300010868Tropical Forest SoilLDRGSKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR*
Ga0157335_104752413300012492Arabidopsis RhizosphereWTEGRIEMPLLEQTVHAMKGVGMLQKDVDLKKIVDSSFLPADLQK*
Ga0164302_1164604123300012961SoilLPPKDVGIMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKQIGDASFLPPDLQR*
Ga0126369_1169794713300012971Tropical Forest SoilMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMVQNDVDLKKIVDGSFLPPDLQK*
Ga0134077_1036966623300012972Grasslands SoilRIEMPLLEQTVHAMKGVGMLQKDVDLTKIVDSSFLPPDLQK*
Ga0164306_1044397623300012988SoilVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQKDVDLKKIVDSSFLPADLQK*
Ga0181538_1027402513300014162BogQGRIEMPLLQTTAHVMRVVGMLDKDVDLSKMIDPSFLPPDLQK*
Ga0134072_1021612613300015357Grasslands SoilKFWSEGRIEMPLLEQTVHAMKGVGMLQKDVDLTKIVDSSFLPPDLQK*
Ga0132256_10044569623300015372Arabidopsis RhizosphereMVKELADAKFWTEGRIEMPLLEQTVHAMKGVGMLQKDVDLKKIVDTSFLPADLQ*
Ga0182041_1228986423300016294SoilMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0182033_1213246713300016319SoilIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0182032_1199461923300016357SoilGVMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0182034_1200939223300016371SoilGIMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0182038_1073237223300016445SoilLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0187825_1031379913300017930Freshwater SedimentIEMPLLQNTVHAMKGVGMLDKDVDLTKIVDSSFLPADLQK
Ga0187783_1096872113300017970Tropical PeatlandSDGGIEMPLLETTMRAMKYVGMLDKDVDLTKFYDASFLPADLQK
Ga0187783_1118287413300017970Tropical PeatlandAKFYSEGRIEMPLLQATAHVMRVVGMLDHDVDLDKMIDPSFLPSDLQK
Ga0187781_1076694213300017972Tropical PeatlandLLETTAHAMKFVGMLDKDVDLSKMVDASFLPSDLQK
Ga0187858_1042922613300018057PeatlandNFYSEGRIEMPLLQNAVRAMKYVGMLDKDVDLTKMVDASFLPSDLQK
Ga0187774_1094633923300018089Tropical PeatlandVDAKFWTEGRIEMPLIENTIKAMVEIGMLDKPVDAKTIVDSSFLPPQLQK
Ga0066669_1086121813300018482Grasslands SoilKIYEPLPGAHVAGMAKQLVDAKLWTEGRIEMPLLEQTVHGVQGVGMLEKNVDLTKIVDSSFLPPDLQK
Ga0210399_1060194023300020581SoilEMPLLERTVHAMKGVGMLQKDVDLKKVVDSSFLPPDLQK
Ga0213877_1000250163300021372Bulk SoilVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIIDASFLPPDLQR
Ga0210402_1008421753300021478SoilRIEMPLLENTVRAMKGVGMLEKDVDLTKMVDSSFLPPDLQK
Ga0210410_1027668913300021479SoilEMPLLENTVRAMKGVGMLEKDVDLTKMVDSSFLPPDLQK
Ga0126371_1293195823300021560Tropical Forest SoilEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0213851_131530123300021860WatershedsEGQIEMPLLVNTVKAMKYVGMIDKDPDLSKMIDASFLPPDLQQVK
Ga0224565_104203113300024176Plant LitterRIEMPLLQTTAHVMRLVGMLDKDVDLTKMIDPSFLPADLQK
Ga0207699_1072167123300025906Corn, Switchgrass And Miscanthus RhizosphereSEGRIEMPLLVNTVKAMKYVGMIDKDPDLSKMIDTSFLPADLQK
Ga0207684_1077455413300025910Corn, Switchgrass And Miscanthus RhizosphereVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0207657_1064800323300025919Corn RhizosphereISREFPDVTWVKELVDAKFWTEGRIEMPLLETTVHAMKGVGMLTRDVDLKTMVDSSFLPPDLQK
Ga0207700_1033294933300025928Corn, Switchgrass And Miscanthus RhizosphereWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0207658_1015525513300025986Switchgrass RhizosphereRIEMPLLEQTVHAMKGVGMLQKDVDLKKIVDSSFLPADLQK
Ga0209470_108636413300026324SoilMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLR
Ga0209806_104378213300026529SoilEGRIEMPLLEQTVHAMQGVGMLEKNVDLTKIVDSSFLPPDLQK
Ga0209577_1018484213300026552SoilKFWSEGRIEMPLLAQTVHAMIGVGMLQKDVDLKKMVDSSFLPPDLQK
Ga0207475_101606813300026867SoilVDAKFWTEGRIEMPLIENTIKAMREIGMLEKDIDAKSIVDSSFLPPDLQK
Ga0209515_1007655513300027835GroundwaterKELVAAKFWTEGRIEMPLLENTVRAMKYVKMIEKDVDLKKMIDSSLLPPDLQK
Ga0209579_1066746113300027869Surface SoilDAKFYSEGRIEMPLLVNTVKAMKYVGMIDKDPDLSKMIDTSFLPADLQK
Ga0209275_1078114713300027884SoilLLENTVRAMKGVGMLEKDVDLSKMVDSSFLPPDLQK
Ga0207428_1079291413300027907Populus RhizosphereRIEMPLLEQTVHAMKGVGMLQKDVDLKKIVDTSFLPADLQ
Ga0209168_1049702913300027986Surface SoilKDVDTMMHDLVAAKFYSEGRIEMPLLQTTAHVMKVVGMLENDVDLTKMVDSSFLPADLQK
Ga0318516_1025731613300031543SoilIMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0318541_1006767213300031545SoilFYNDGRIEKPLLETTVRAMKYVGMLDKDIDLSKFYDASFLPPDLQK
Ga0318541_1084900823300031545SoilGIMVKELVEAKFWTEGRIEMPLLEQTVHAMRGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0318528_1008727233300031561SoilIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0307436_115630123300031563Salt MarshKGNIEMPLLELSERAMFDVGMLKKKVDLNKMVDTSFLPSDLQKITQ
Ga0318515_1049372623300031572SoilEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0318555_1051300113300031640SoilLPAKDVAVMIKELVAVKFWTEGRIEMPLLENTVHAMKGVGMLEKDVDLKKMVDASFLPADLQ
Ga0306917_1000813573300031719SoilEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0307469_1162517813300031720Hardwood Forest SoilRVYAPLPPSEVGIMVKQLVEAKFWSEGRIEMPLLAQTVHAMKGVGMLQKDVDLKKVVDSSFLPPDLQK
Ga0318502_1001313363300031747SoilTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0318492_1071863323300031748SoilLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0318509_1006319043300031768SoilFWTEGRIEMPLLENTVRAMKGVGMLEKDVDLKKIVDSSLLPADLQK
Ga0318521_1078876113300031770SoilVGLMVKELVDAKFWTEGRIEMPLLENTVRAMKGVGMLEKDVDLKKIVDSSFLPADLQK
Ga0318546_1013618533300031771SoilFWTEGPIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0318503_1028155713300031794SoilEPLPAKDVGLMVKELVDAKFWTEGRIEMPLLENTVRAMKGVGMLEKDVDLKKIVDSSLLPADLQK
Ga0318557_1023585623300031795SoilVEAKFWTEGPIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0318557_1024164813300031795SoilVGLMTKEMVDAKFWTEGRIEMPLLENTVRAMKGVGMLEKDVDLKKIVDSSLLPADLQK
Ga0318564_1002463163300031831SoilVKELVDAKFYNDGRIEKPLLETTVRAMKYVGMLDKDIDLSKFYDASFLPPDLQK
Ga0318564_1006165313300031831SoilIMVKELVEAKFWTEGRIEMPLLEQTVRAMKGVGMLQNGVDLKKIVDGSFLPPDLQK
Ga0318511_1061458413300031845SoilLLETTVRAMKYVGMLDKDIDLSKFYDASFLPPDLQK
Ga0318512_1011879733300031846SoilEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0318527_1008998643300031859SoilEMPLLENTVHAMKGVGMLEKDVDLTKIVDSSFLPHDLQK
Ga0318544_1042249213300031880SoilVDAKFYNDGRIEKPLLETTVRAMKYVGMLDKDIDLSKFYDASFLPPDLQK
Ga0306923_1036392533300031910SoilKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0306923_1191657213300031910SoilDVGIMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0306921_1245284413300031912SoilVGVMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0310912_1086613223300031941SoilAKDVGLMTKEMVDAKFWTEGRIEMPLLENTVRAMKGVGMLEKDVDLKKIVDSSFLPADLQ
Ga0310909_1040042513300031947SoilEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0310909_1130971623300031947SoilGLMTKEMVDAKFWTEGRIEMPLLENTVRAMKGVGMLEKDVDLKKIVDSSFLPADLQK
Ga0318530_1009847633300031959SoilFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0318530_1019091813300031959SoilFWSEGRIEMPLLEQTVHAMKGVGMLQKDVDLSKVVDNSFLPPDLQK
Ga0318531_1013808713300031981SoilEMPLLENTVRAMKGVGMLEKDVDLKKIVDSSLLPADLQK
Ga0307416_10387328423300032002RhizosphereGRIEMPLLETTVRAMKGVGMLENDVDLKKMVDTSFLPSDLQK
Ga0310911_1009360433300032035SoilTEGPIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0318545_1007219213300032042SoilELVDAKFWTEGRIEMPLLENTVRAMKGVGMLEKDVDLKKIVDSSLLPADLQK
Ga0318570_1010301713300032054SoilVMVKELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0318540_1010764013300032094SoilAKFWTEGPIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDGSFLPPDLQK
Ga0311301_1151648023300032160Peatlands SoilSEGQIEMPLLVNTVKAMKYVGMIDKDPDLSKMIDASFLPSDLQQVK
Ga0335085_1089814523300032770SoilTLMQQLVDAKFYSEGRIEMPLLQNTVKAMKYVGMLDKDVDLTKMIDASFLPADLQK
Ga0335078_1047937933300032805SoilIEMPLLQTTAHVMRAVGMLDKDVDLNKMIDTSFLPADLQK
Ga0335080_1034770833300032828SoilVAAKFWTEGRIEMSLLEATVHAMKGVGMLEKDVDLKTIVDSSLLPADLQK
Ga0335081_1031429743300032892SoilKFYSEGRIEMPLLQTTAHVMRAVGMLDKDVDLNKMIDTSFLPADLQK
Ga0335083_1008947163300032954SoilLSEKDVGIMIKELVAAKFWTEGRIEMSLLEATVHAMKGVGMLEKDVDLKTIVDSSLLPADLQK
Ga0335073_1066348033300033134SoilIEMPLLQTTAHVMRAVGMLDKDVDLSKMIDPSFLPADLQK
Ga0335077_1012865213300033158SoilAKFYSEGKIEMPLLETTMRAMKYVGMINKDIDLTKAIDPSFLPSDLQK
Ga0310914_1158927523300033289SoilELVEAKFWTEGRIEMPLLEQTVHAMKGVGMLQNDVDLKKIVDASFLPPDLQR
Ga0318519_1054099713300033290SoilKELVDAKFYNDGRIEKPLLETTVRAMKYVGMLDKDIDLSKFYDASFLPPDLQK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.