Basic Information | |
---|---|
Family ID | F061931 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 131 |
Average Sequence Length | 42 residues |
Representative Sequence | MKEMTANDDFERFRTGAAKYAAYLETPEGQLRLDLAFANL |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.92 % |
% of genes near scaffold ends (potentially truncated) | 99.24 % |
% of genes from short scaffolds (< 2000 bps) | 91.60 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.130 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.977 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.427 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.779 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF01841 | Transglut_core | 6.11 |
PF07944 | Glyco_hydro_127 | 6.11 |
PF00528 | BPD_transp_1 | 5.34 |
PF14559 | TPR_19 | 2.29 |
PF00561 | Abhydrolase_1 | 1.53 |
PF00005 | ABC_tran | 1.53 |
PF08439 | Peptidase_M3_N | 1.53 |
PF00152 | tRNA-synt_2 | 1.53 |
PF07992 | Pyr_redox_2 | 1.53 |
PF07228 | SpoIIE | 1.53 |
PF07969 | Amidohydro_3 | 0.76 |
PF13495 | Phage_int_SAM_4 | 0.76 |
PF01400 | Astacin | 0.76 |
PF13641 | Glyco_tranf_2_3 | 0.76 |
PF14871 | GHL6 | 0.76 |
PF07676 | PD40 | 0.76 |
PF01914 | MarC | 0.76 |
PF12840 | HTH_20 | 0.76 |
PF00069 | Pkinase | 0.76 |
PF02574 | S-methyl_trans | 0.76 |
PF05711 | TylF | 0.76 |
PF07730 | HisKA_3 | 0.76 |
PF12697 | Abhydrolase_6 | 0.76 |
PF04185 | Phosphoesterase | 0.76 |
PF13365 | Trypsin_2 | 0.76 |
PF13185 | GAF_2 | 0.76 |
PF13545 | HTH_Crp_2 | 0.76 |
PF00294 | PfkB | 0.76 |
PF00196 | GerE | 0.76 |
PF16757 | Fucosidase_C | 0.76 |
PF04055 | Radical_SAM | 0.76 |
PF13776 | DUF4172 | 0.76 |
PF00400 | WD40 | 0.76 |
PF00578 | AhpC-TSA | 0.76 |
PF13602 | ADH_zinc_N_2 | 0.76 |
PF05694 | SBP56 | 0.76 |
PF04261 | Dyp_perox | 0.76 |
PF04454 | Linocin_M18 | 0.76 |
PF00665 | rve | 0.76 |
PF07722 | Peptidase_C26 | 0.76 |
PF04986 | Y2_Tnp | 0.76 |
PF07715 | Plug | 0.76 |
PF13590 | DUF4136 | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 6.11 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.05 |
COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.53 |
COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.53 |
COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 1.53 |
COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 1.53 |
COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 1.53 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.76 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.76 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.76 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.76 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.76 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.76 |
COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.76 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.76 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.76 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.76 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.76 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.13 % |
Unclassified | root | N/A | 6.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100122767 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
3300002562|JGI25382J37095_10280239 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300002910|JGI25615J43890_1056105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300004080|Ga0062385_10438576 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300004479|Ga0062595_100188864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
3300004479|Ga0062595_101949031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300005176|Ga0066679_10022951 | All Organisms → cellular organisms → Bacteria | 3335 | Open in IMG/M |
3300005330|Ga0070690_100192546 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300005451|Ga0066681_10627207 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300005542|Ga0070732_10542251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
3300005553|Ga0066695_10137398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1516 | Open in IMG/M |
3300005563|Ga0068855_102160215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300005569|Ga0066705_10252660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1117 | Open in IMG/M |
3300005842|Ga0068858_101715312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300005921|Ga0070766_10218870 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300006237|Ga0097621_101105376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
3300006796|Ga0066665_10536613 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300006893|Ga0073928_10859452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
3300007258|Ga0099793_10240327 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 873 | Open in IMG/M |
3300009011|Ga0105251_10209297 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300009088|Ga0099830_11883230 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300009089|Ga0099828_11027729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
3300009137|Ga0066709_104409445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300010048|Ga0126373_10093746 | All Organisms → cellular organisms → Bacteria | 2763 | Open in IMG/M |
3300010048|Ga0126373_10307630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1583 | Open in IMG/M |
3300010048|Ga0126373_11426202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
3300010301|Ga0134070_10002618 | All Organisms → cellular organisms → Bacteria | 5357 | Open in IMG/M |
3300010303|Ga0134082_10009715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3460 | Open in IMG/M |
3300010366|Ga0126379_12677771 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010376|Ga0126381_102792730 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300011120|Ga0150983_10382781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300011120|Ga0150983_10812737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300011269|Ga0137392_10695434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 842 | Open in IMG/M |
3300011270|Ga0137391_10527351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
3300011270|Ga0137391_10796711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300011271|Ga0137393_10250534 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300012202|Ga0137363_11478660 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300012203|Ga0137399_10753693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 820 | Open in IMG/M |
3300012205|Ga0137362_10492365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
3300012205|Ga0137362_11367611 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300012205|Ga0137362_11440347 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300012212|Ga0150985_122111259 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300012361|Ga0137360_11407015 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300012362|Ga0137361_10196230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1824 | Open in IMG/M |
3300012362|Ga0137361_11004728 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300012469|Ga0150984_115228730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300012971|Ga0126369_10608465 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300012984|Ga0164309_10054597 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
3300013297|Ga0157378_10245926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1711 | Open in IMG/M |
3300015206|Ga0167644_1081750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
3300015245|Ga0137409_10117183 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
3300015372|Ga0132256_100350368 | Not Available | 1570 | Open in IMG/M |
3300015373|Ga0132257_100668578 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300016341|Ga0182035_11603466 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300016371|Ga0182034_11407486 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300017823|Ga0187818_10567047 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
3300017932|Ga0187814_10041307 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
3300017943|Ga0187819_10036438 | All Organisms → cellular organisms → Bacteria | 2908 | Open in IMG/M |
3300017947|Ga0187785_10440806 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300017955|Ga0187817_10185236 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300017955|Ga0187817_10988704 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300017970|Ga0187783_10298072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1176 | Open in IMG/M |
3300017972|Ga0187781_11486946 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300017975|Ga0187782_11551096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300017994|Ga0187822_10063487 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300018090|Ga0187770_10719772 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300018433|Ga0066667_12080382 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300018468|Ga0066662_11059280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300020579|Ga0210407_10827824 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300020579|Ga0210407_11010163 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300020582|Ga0210395_10452399 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300020582|Ga0210395_10518906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 896 | Open in IMG/M |
3300020583|Ga0210401_10964566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 711 | Open in IMG/M |
3300021046|Ga0215015_10732400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
3300021171|Ga0210405_10131668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1978 | Open in IMG/M |
3300021401|Ga0210393_10294612 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
3300021404|Ga0210389_10543603 | Not Available | 914 | Open in IMG/M |
3300021406|Ga0210386_11772545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 509 | Open in IMG/M |
3300021407|Ga0210383_11311769 | Not Available | 605 | Open in IMG/M |
3300021420|Ga0210394_10383565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
3300021433|Ga0210391_11041667 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300021439|Ga0213879_10043980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1164 | Open in IMG/M |
3300021477|Ga0210398_11060172 | Not Available | 645 | Open in IMG/M |
3300021560|Ga0126371_12556482 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300022528|Ga0242669_1040993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300023259|Ga0224551_1008102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1750 | Open in IMG/M |
3300024246|Ga0247680_1019940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
3300024249|Ga0247676_1074143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300025899|Ga0207642_10330352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300025903|Ga0207680_10795241 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300025907|Ga0207645_10263387 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300025919|Ga0207657_10291135 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300025937|Ga0207669_11343815 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300026004|Ga0208416_1015181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300026022|Ga0208649_1021618 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300026323|Ga0209472_1267607 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300026515|Ga0257158_1101976 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 567 | Open in IMG/M |
3300026538|Ga0209056_10044971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4004 | Open in IMG/M |
3300026547|Ga0209156_10201568 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300026557|Ga0179587_10161949 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300026990|Ga0207824_1033715 | Not Available | 544 | Open in IMG/M |
3300027172|Ga0208098_1018928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300027497|Ga0208199_1125042 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300027570|Ga0208043_1060905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
3300027576|Ga0209003_1105723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
3300027629|Ga0209422_1128597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 576 | Open in IMG/M |
3300027654|Ga0209799_1136216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300027654|Ga0209799_1154059 | Not Available | 523 | Open in IMG/M |
3300027680|Ga0207826_1178647 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300027698|Ga0209446_1042733 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300027783|Ga0209448_10284561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300027889|Ga0209380_10195570 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
3300027905|Ga0209415_10263456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1533 | Open in IMG/M |
3300027986|Ga0209168_10144380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
3300028016|Ga0265354_1006307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
3300029944|Ga0311352_10900067 | Not Available | 686 | Open in IMG/M |
3300031231|Ga0170824_104071953 | Not Available | 768 | Open in IMG/M |
3300031236|Ga0302324_100027666 | All Organisms → cellular organisms → Bacteria | 10796 | Open in IMG/M |
3300031474|Ga0170818_108822102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
3300031708|Ga0310686_100375573 | Not Available | 1867 | Open in IMG/M |
3300031740|Ga0307468_102572102 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300031754|Ga0307475_10499781 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300031754|Ga0307475_11539714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300031823|Ga0307478_11338569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300031954|Ga0306926_11663051 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300031962|Ga0307479_11726111 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300032076|Ga0306924_11289564 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300032261|Ga0306920_100083031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4715 | Open in IMG/M |
3300032898|Ga0335072_10259625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1988 | Open in IMG/M |
3300033134|Ga0335073_12145971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300033402|Ga0326728_11170696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.11% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.34% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.58% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.58% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.82% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.05% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.29% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.53% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.53% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.53% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.53% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.53% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.76% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.76% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.76% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.76% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026004 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 (SPAdes) | Environmental | Open in IMG/M |
3300026022 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1001227673 | 3300002245 | Forest Soil | MQKIAKAGSEHFQSGADKYAAYLETPEGRLRSDLAFAHLQEFLPLPRTR |
JGI25382J37095_102802392 | 3300002562 | Grasslands Soil | MQMTAKADSGCFQSGADKYAAYLETPEGRLRCDLVFANLQDFLPLPQTKLSLR |
JGI25615J43890_10561051 | 3300002910 | Grasslands Soil | MKTSAKPDTGFRSDAGKYAAYLATPEGRLRLDLAFANLQE |
Ga0062385_104385761 | 3300004080 | Bog Forest Soil | MTIASNDERFQHGAQDYAAYLQSPEGRWRADLALANLQDF |
Ga0062595_1001888641 | 3300004479 | Soil | MTANSNSDSNDDLERFQTGAPKYAAYLETPEGRLRLDLAFA |
Ga0062595_1019490311 | 3300004479 | Soil | MEMTATTDIERFRAGATQYAAYLETPEGRLRLDLAFDTLQEFLPQATQSSH |
Ga0066679_100229511 | 3300005176 | Soil | MKEMTVNDDFERFRTGAAKYAAYLETPEGRLRLDLAFSNLQDFLPQATRSLLA |
Ga0070690_1001925461 | 3300005330 | Switchgrass Rhizosphere | MKEMTANDDCERFRTGAAKYAAYLETPEGRLRLDLALANLQDFLPRAT |
Ga0066681_106272071 | 3300005451 | Soil | MQMTAKPASEGFQSGADKYAAYLEILEGRLRCGLVFANLQDFLVLPQSRRSLR |
Ga0070732_105422512 | 3300005542 | Surface Soil | MKKLTANADREHFQSEADKYATYLETPEGRLRLDLPFSNLQEFLALPQGKA |
Ga0066695_101373983 | 3300005553 | Soil | MKKMTADGERFRTGAAKYAAYLETPEGQLRLDLAFANL |
Ga0068855_1021602151 | 3300005563 | Corn Rhizosphere | MMQMTAANDDFERFRTGAAKYAAYLETPEGRLRLDL |
Ga0066705_102526603 | 3300005569 | Soil | MKEMTADDDFERFRTGTAKYAGYLETPEGRLRLDLAFA |
Ga0068858_1017153122 | 3300005842 | Switchgrass Rhizosphere | MLREKMSTHTDSERFLSGAGKYAAYLETPEGRLRLDLA |
Ga0070766_102188701 | 3300005921 | Soil | MNTANDDPERFQREAHEYAAYLETPEGRLRLDLPFANLQESLPL |
Ga0097621_1011053762 | 3300006237 | Miscanthus Rhizosphere | MIINAADERFLSDAARYAAYLETPEGRLRLDIAFANLQ |
Ga0066665_105366131 | 3300006796 | Soil | MQMTAKADSGCFQSGADKYAAYLETPEGRLRCDLVFANLQDF |
Ga0073928_108594522 | 3300006893 | Iron-Sulfur Acid Spring | MKVPAKAASERFQGGAHDYAAYLETPEGRLRSDLTLANLQDFLPLLQAKG |
Ga0099793_102403272 | 3300007258 | Vadose Zone Soil | MKMTAEADSERFQSGANQYAVYLETPEGRLRSDLAF |
Ga0105251_102092971 | 3300009011 | Switchgrass Rhizosphere | MKEMTANDDCERFRTGAAKYAAYLETPEGQLRLDLALAN |
Ga0099830_118832301 | 3300009088 | Vadose Zone Soil | MTAKADSGRFQSGADKYAAYLETPEGRLRCDLSFANLQDFLPLPQTKL |
Ga0099828_110277291 | 3300009089 | Vadose Zone Soil | MKTSAQTDSERFQSGADKYAAYLETPEGRLRLDLAF |
Ga0066709_1044094451 | 3300009137 | Grasslands Soil | LPEWRKKEMIANDDFERFRSGAAKYAAYLETPEGQLRLDLAF |
Ga0126373_100937464 | 3300010048 | Tropical Forest Soil | MNMMAKADRNRFQTDAGKYAAYLETPEGRLRLDLAFANLQ |
Ga0126373_103076302 | 3300010048 | Tropical Forest Soil | VKASAKTDRRFQSDAGKYAAYLETPEGRLRLDLTFAN |
Ga0126373_114262022 | 3300010048 | Tropical Forest Soil | MTITTNSDDERFRAGAEKYASYLETREGRLRMDLTFLNLQEFLPVK |
Ga0134070_100026186 | 3300010301 | Grasslands Soil | MKEMTADDDFERFRTGAAKYAGYLETPEGRLRLDLAFAN |
Ga0134082_100097151 | 3300010303 | Grasslands Soil | MKEMTANDDFERFRTGAAKYAAYLETPEGQLRLDLAFANL |
Ga0126379_126777712 | 3300010366 | Tropical Forest Soil | MKRIAPNAGHERFQSGAEKYAAYLETPEGRLRLDLTFANLRESLPKSAQ |
Ga0126381_1027927302 | 3300010376 | Tropical Forest Soil | MNVKEDFERFGNGAEKYAAYLETPEGRLRLDLPLA |
Ga0150983_103827811 | 3300011120 | Forest Soil | MTTSPECDRFQSGADKYAAYLDTPDGRLHLDLTLANLQEFLPQAT |
Ga0150983_108127371 | 3300011120 | Forest Soil | MKKLTANADREHFQSEADKYATYLETPEGRLRLDLPFSNLQEF |
Ga0137392_106954342 | 3300011269 | Vadose Zone Soil | MKMIAKADSGRFQSGADKYAAYLETPEGRLRCDLTFANLQDFLPLPQT |
Ga0137391_105273512 | 3300011270 | Vadose Zone Soil | MTANDDFERFRTGAAKYAAYLETPEGQLRLDLAFANLQ |
Ga0137391_107967111 | 3300011270 | Vadose Zone Soil | MKEMTANDDFERFRTGAAKYAAYLETPEGQLRLDLAFA |
Ga0137393_102505342 | 3300011271 | Vadose Zone Soil | MMMTAEAESERFQSGASKYAVYLETPEGRLRSDLAFADLQDFLLLPAKASLCAL |
Ga0137363_114786601 | 3300012202 | Vadose Zone Soil | MKEMIANDDFERFRTGAAKYAPYLETPEGQLRLDLAVANLQDFFP |
Ga0137399_107536932 | 3300012203 | Vadose Zone Soil | MPLTAKPDGDRFQNGADKYAAYLETPEGRLRCGLAF |
Ga0137362_104923651 | 3300012205 | Vadose Zone Soil | MQMTAKPDSDRFQSGADKYAAYLETPEGRLRCGLA |
Ga0137362_113676112 | 3300012205 | Vadose Zone Soil | MKEMIVNDDFERFRTGAAKYAAYLETPEGQLRLDLAFAN |
Ga0137362_114403471 | 3300012205 | Vadose Zone Soil | MTANDDLERFRTGAAKYAAYLETPDGQLRLDLAFANLQ |
Ga0150985_1221112591 | 3300012212 | Avena Fatua Rhizosphere | MTCNDTLERFRTGAAKYSMYLGTPEGRLRIDLALANLQDFLPQDPR |
Ga0137360_114070152 | 3300012361 | Vadose Zone Soil | MQMTAKPDSDRFQSGADKYAAYLETPEGRLRCGLAFAN |
Ga0137361_101962303 | 3300012362 | Vadose Zone Soil | MKEMTAHDDFERFRTGAAKYAAYLETPEGQLRLDL |
Ga0137361_110047281 | 3300012362 | Vadose Zone Soil | MKEMIANDDFERFRTGAAKYAAYLDTPEGRLRLDLAFANL |
Ga0150984_1152287301 | 3300012469 | Avena Fatua Rhizosphere | MKIMAGNAEDERFQTGAARYATYLETPEGRLRIDLA |
Ga0126369_106084652 | 3300012971 | Tropical Forest Soil | MSTTVRSDSERFRSDAQKYAAYLETPEGRLRLDLA |
Ga0164309_100545971 | 3300012984 | Soil | MKEMTANDDCERFRTGAAKYAAYLETPEGQLRLDLALANLQDFLP |
Ga0157378_102459262 | 3300013297 | Miscanthus Rhizosphere | MEMTATTDIERFRAGATQYAAYLETPEGRLRLDLAFDTLQEFLP |
Ga0167644_10817502 | 3300015206 | Glacier Forefield Soil | LKIPTNADGERFQSDANKYAAYLETPDGRLRSGLALANLLDFLPLQ |
Ga0137409_101171832 | 3300015245 | Vadose Zone Soil | MMAETDINRFQSDANKYAAYLETPEGRLRADLSP* |
Ga0132256_1003503681 | 3300015372 | Arabidopsis Rhizosphere | MKELTADADFERFRTGAAKYAASLGTPEGRLRLDLALA |
Ga0132257_1006685781 | 3300015373 | Arabidopsis Rhizosphere | MKELTADADFERFRTGAAKYAAYLGTPEGRLRLDL |
Ga0182035_116034662 | 3300016341 | Soil | MSTTARSDSERFRSDAQKYAAYLETPEGRLRLDLALANVREFLPVPAAN |
Ga0182034_114074861 | 3300016371 | Soil | MTTTSDAERFRAEAAKYAAYLETPEGRLRIDLAIANLQEFLPR |
Ga0187818_105670471 | 3300017823 | Freshwater Sediment | MQMTAKVDSEHFQSGADKYAAYLETPEGRLRSDLAF |
Ga0187814_100413074 | 3300017932 | Freshwater Sediment | MKKVASNADRQRFQSGADKYAAYLKTPEGRLRLDLAFASLQEFLPP |
Ga0187819_100364382 | 3300017943 | Freshwater Sediment | MKKIASKADSQRFQSGADKYAAYLKTPEGRLRLDLAFA |
Ga0187785_104408062 | 3300017947 | Tropical Peatland | MNRIVANTECERFQSGVEKYAAYLKTSEGRLRLDLTFANMQEFLP |
Ga0187817_101852362 | 3300017955 | Freshwater Sediment | MQMTAKADSEGFQSGASKYAVYLETPEGRLRSDLAFTNLQDFLPQ |
Ga0187817_109887041 | 3300017955 | Freshwater Sediment | MKKVASNADRQRFQSGADKYAAYLKTPEGRLRLDLAFASLQEFLPPP |
Ga0187783_102980723 | 3300017970 | Tropical Peatland | MKKMTANADRERFRSGADKYAAYLETPEGRLRLDLAFAYLQEFLPQATGSLRA |
Ga0187781_114869461 | 3300017972 | Tropical Peatland | MKKMGTNPDAERFQREADKYASYLETPEGRLRIDLAFAN |
Ga0187782_115510961 | 3300017975 | Tropical Peatland | MKKMSTNADAERFQREADKYATYLGTPEGRLRIDLAFAN |
Ga0187822_100634871 | 3300017994 | Freshwater Sediment | MKETTADDLERFRSGAAKYAAYLETPLGRLRLDLSFANLQDFLPPATRPLSA |
Ga0187770_107197721 | 3300018090 | Tropical Peatland | MKKMTANADGERFQSGADKYAAYLETPEGRLRLDLTFANLQEF |
Ga0066667_120803821 | 3300018433 | Grasslands Soil | MKEITANDDFERFRTGAAKYAAYLETPEGQLRLDLAFAN |
Ga0066662_110592801 | 3300018468 | Grasslands Soil | MKKLTANADSEHFQSEADKYATYLETPEGRLRLGLPFSNLQELLPLPQ |
Ga0210407_108278242 | 3300020579 | Soil | MKMTAKADSERFQSGANEYAVYLDTPEGRLRSDLAFRNL |
Ga0210407_110101631 | 3300020579 | Soil | MQLTAKPDSNRFQSDADKYAAYLETPEGRLRCGLAFANVQDFLVLPRSGRALRGL |
Ga0210395_104523991 | 3300020582 | Soil | MKETTANDEDDFERFRTGAAKYAAYLETPEGRLRL |
Ga0210395_105189062 | 3300020582 | Soil | MQMTAKADSEGFQSGANKYADYLETPEGRLRSDLA |
Ga0210401_109645662 | 3300020583 | Soil | MKEITANHDLERFRAGAAKYAAYLETPEGRLRVDLAFANLR |
Ga0215015_107324001 | 3300021046 | Soil | MKMTAKADSERFQSGADKYAAYLETPEGRLRSDVAFANLQDFLPLEAKPSLCALD |
Ga0210405_101316681 | 3300021171 | Soil | MKMTAKADAERFHSGANQYGAYLETPEGRLRSDLAFTNLQDFLPKRP |
Ga0210393_102946121 | 3300021401 | Soil | MQKIAKAGSEHFQSGADKYAAYLETPEGRLRSDLA |
Ga0210389_105436031 | 3300021404 | Soil | MAVNADRERFQNDADKYAAYLETAEGRLRLDLSFANLQESLPHK |
Ga0210386_117725451 | 3300021406 | Soil | MKETTANDDLERFRTGVAKFAAYLETPEGKLRLNLAFA |
Ga0210383_113117691 | 3300021407 | Soil | MTAKADSERFQSGADKYAAYLVGTPEGRLRSDLAFA |
Ga0210394_103835651 | 3300021420 | Soil | MKEMTANNNDDFDRFRTGAAKYAAYLETPEGRLRLDLAF |
Ga0210391_110416671 | 3300021433 | Soil | MKETNVSDDDDFERFRTGADQYAAYLETPEGRLRLDLAFA |
Ga0213879_100439801 | 3300021439 | Bulk Soil | MIANPDSERFRSGAEKYAAYLETTEGRLRLDLTFANVQEFLPKT |
Ga0210398_110601721 | 3300021477 | Soil | MQMTAKADSEGFQSGANKYADYLETPEGRLRSDLAFTNL |
Ga0126371_125564822 | 3300021560 | Tropical Forest Soil | MKIGAQADNRFQADAGKYAAYLQTPEGRLRLDLAFAN |
Ga0242669_10409932 | 3300022528 | Soil | MKGRTANADFERFLTGAAKYAAYLETPEGRLRLDLAF |
Ga0224551_10081023 | 3300023259 | Soil | MKEMTANDDFERFRTGAAKYAAYLETPEGKLRLDLTFANLQ |
Ga0247680_10199401 | 3300024246 | Soil | MKEMTANDDCERFRTGAAKYAAYLETPEGQLRLDLAFA |
Ga0247676_10741432 | 3300024249 | Soil | MTTNSSGERFLTGAAQYAAYLETPEGRLRLDLTFANV |
Ga0207642_103303521 | 3300025899 | Miscanthus Rhizosphere | MKEMTANDDCERFRTGAAKYAAYLETPEGQLRLDLALANLQDFLPG |
Ga0207680_107952411 | 3300025903 | Switchgrass Rhizosphere | MKEMTANDDCERFRTGAAKYAAYLETPEGRLRLDLALANLQDFLPRATRS |
Ga0207645_102633871 | 3300025907 | Miscanthus Rhizosphere | MKEMTANDDCERFRTGAAKYAAYLETPEGQLRLDLALANLQDFLPRATRSLR |
Ga0207657_102911351 | 3300025919 | Corn Rhizosphere | MKEMTANDDCERFRTGAAKYAAYLETPEGQLRLDLAL |
Ga0207669_113438151 | 3300025937 | Miscanthus Rhizosphere | MKEMTANDDCERFRTGAAKYAAYLETPEGRLRLDLALANLQDF |
Ga0208416_10151812 | 3300026004 | Rice Paddy Soil | MNKVTANADRDRFQSEADKYAAYLETAEGRLRLDLPLANLQEFLQLPRDES |
Ga0208649_10216181 | 3300026022 | Rice Paddy Soil | MKNGSANADSERFQSEADKYAAYLETPEGGLRLDLAFVNLQEFLPQDTASLRAL |
Ga0209472_12676071 | 3300026323 | Soil | MQMTAKPASEGFQSGADKYAAYLEILEGRLRCGLVFANLQDFLVLPQSRRSL |
Ga0257158_11019761 | 3300026515 | Soil | MKMTAKADSERFQSGANEYAVYLDTPEGRLRSDLAF |
Ga0209056_100449711 | 3300026538 | Soil | MQMTAKPASEGFQSGADKYAAYLEILEGRLRCGLVF |
Ga0209156_102015681 | 3300026547 | Soil | MNKMTASADSECFLSGSEKYAAYLETPEGRLRLDLAF |
Ga0179587_101619491 | 3300026557 | Vadose Zone Soil | MQMTAKPDSDRFQSGADKYAAYLETPEGRLRCGLAFAYLQDFLVLPQSRRSLRG |
Ga0207824_10337151 | 3300026990 | Tropical Forest Soil | MVTKSDDERFQSGAQDYALYLKTPEGRLRVDLLFT |
Ga0208098_10189282 | 3300027172 | Forest Soil | MVAHTDSERFQSDAEKYAAYLETPEGRLRIDLAFAN |
Ga0208199_11250421 | 3300027497 | Peatlands Soil | MKMSAKADSERFQSDANKYAVYLETPEGRLRSDLA |
Ga0208043_10609052 | 3300027570 | Peatlands Soil | MSECGMKMKMTANVDKERFQSGSEKYAAYLETPEG |
Ga0209003_11057231 | 3300027576 | Forest Soil | MQMTAKADSGRFQSGAGKYAAYLETPEGRLRSDLALANLQDFLPLPQTEL |
Ga0209422_11285972 | 3300027629 | Forest Soil | MKMTAKADSERFQSGANEYAVYLDTPEGRLRSDLAFRNLQDFLPQQDEK |
Ga0209799_11362161 | 3300027654 | Tropical Forest Soil | MNMMAKADRNRFQTDAGKYAAYLETPEGRLRLDLAIANLQEFLT |
Ga0209799_11540591 | 3300027654 | Tropical Forest Soil | MKTSSQTDNRFQHDAGKYAAYLESPEGRLRLDLAF |
Ga0207826_11786471 | 3300027680 | Tropical Forest Soil | MSSNLDTERFRSGVEKYAAFLETFEGRLRFDLTLATLQEFLPQVSRPLC |
Ga0209446_10427334 | 3300027698 | Bog Forest Soil | MTIASNDERFQHGAQDYAAYLQSPEGRWRADLALANLQDFLPIPQA |
Ga0209448_102845611 | 3300027783 | Bog Forest Soil | MFASGDSERFQRGANKYASYLETPEGRLRSDLALANL |
Ga0209380_101955702 | 3300027889 | Soil | MNTANDDPERFQREAHEYAAYLETPEGRLRLDLPFAN |
Ga0209415_102634562 | 3300027905 | Peatlands Soil | MSECGMKMKMTANVDKERFQSGSEKYAAYLETPEGRLRLDLAF |
Ga0209168_101443801 | 3300027986 | Surface Soil | MKPTTGNTGAERFQSGADKYAAYLDTTEGRLRLDLSLANLQEF |
Ga0265354_10063072 | 3300028016 | Rhizosphere | MKEMTANDDADFERFRTGAAKYAAYLETPEGRLRLDLAFAN |
Ga0311352_109000671 | 3300029944 | Palsa | MSAGPGSERFQSGANKYAAYLKTPGGRLRSDLAFAN |
Ga0170824_1040719531 | 3300031231 | Forest Soil | MKKMITADRERFQRGAQAYAAYLEKPEGRLRLDLA |
Ga0302324_10002766615 | 3300031236 | Palsa | MNMSAGDGSERFQSGANKYAAYLETPGGRLRSDLAFAN |
Ga0170818_1088221022 | 3300031474 | Forest Soil | MKEISSSNDLERFRGGAAKYAAYLETPEGRLRLDLAFVNLQ |
Ga0310686_1003755731 | 3300031708 | Soil | MKQMTANDDFERFRTGVAKYAAYLETPEGRLRLDLA |
Ga0307468_1025721021 | 3300031740 | Hardwood Forest Soil | MKEMTANDDFERFRTGAAKYAAYLETPEGRLRLDLAFAYLQDFLPQATRS |
Ga0307475_104997811 | 3300031754 | Hardwood Forest Soil | MQMTAKPDSDRFQSGADKYAAYLETPEGRLRCGQAFANLQDFLVLPRSRRS |
Ga0307475_115397141 | 3300031754 | Hardwood Forest Soil | MKKLTANADSERFQSEADKYATYLETPEGRLRLDLPFSNLQEFLA |
Ga0307478_113385692 | 3300031823 | Hardwood Forest Soil | MKETTANADFERFQTGASKYAAYLETPEGRLRLDLGLANLQEFLPQA |
Ga0306926_116630513 | 3300031954 | Soil | MSTIPRSDSERFRSDAQKYAAYLETPEGRLRLDLALANVR |
Ga0307479_117261113 | 3300031962 | Hardwood Forest Soil | MKEITANDDFERFRTGAAKYAAYLETPEGQLRLDLAFANLQ |
Ga0306924_112895642 | 3300032076 | Soil | MTATADNERFRSGADKYAAYLESSEGRLRLDLTFANLQ |
Ga0306920_1000830318 | 3300032261 | Soil | MKEITADDDFERFRTGAAKYAAYLATPEGRLRSDLAFAN |
Ga0335072_102596251 | 3300032898 | Soil | MKKTTHLDADRFRRDAEKYAEYLKTPEGRLRLELAFVNLQ |
Ga0335073_121459711 | 3300033134 | Soil | MEKTTTHSEETFQSGADKYAAYLETPEGRLRVDLGFANLQEFL |
Ga0326728_111706962 | 3300033402 | Peat Soil | MKMNANTDREPFRSGAHDYAAYLETPEGRLRSDLAL |
⦗Top⦘ |