Basic Information | |
---|---|
Family ID | F061853 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 131 |
Average Sequence Length | 45 residues |
Representative Sequence | MNKKTIGLLSLGLALAAIAYVTYNSLSQLKDIDYDLFDIEEDEDD |
Number of Associated Samples | 65 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 61.07 % |
% of genes near scaffold ends (potentially truncated) | 20.61 % |
% of genes from short scaffolds (< 2000 bps) | 80.15 % |
Associated GOLD sequencing projects | 57 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (36.641 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (22.901 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.038 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.542 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.47% β-sheet: 0.00% Coil/Unstructured: 57.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF00166 | Cpn10 | 28.24 |
PF04973 | NMN_transporter | 16.03 |
PF01923 | Cob_adeno_trans | 11.45 |
PF02675 | AdoMet_dc | 3.05 |
PF02075 | RuvC | 0.76 |
PF09458 | H_lectin | 0.76 |
PF13640 | 2OG-FeII_Oxy_3 | 0.76 |
PF13385 | Laminin_G_3 | 0.76 |
PF00085 | Thioredoxin | 0.76 |
PF06067 | DUF932 | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 28.24 |
COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 16.03 |
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 3.05 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.36 % |
Unclassified | root | N/A | 36.64 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002161|JGI24766J26685_10000155 | All Organisms → cellular organisms → Bacteria | 17524 | Open in IMG/M |
3300003499|JGI25930J51415_1021988 | Not Available | 1193 | Open in IMG/M |
3300004112|Ga0065166_10015057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2176 | Open in IMG/M |
3300004112|Ga0065166_10060263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
3300004112|Ga0065166_10298446 | Not Available | 657 | Open in IMG/M |
3300004240|Ga0007787_10416380 | Not Available | 670 | Open in IMG/M |
3300004240|Ga0007787_10469346 | Not Available | 629 | Open in IMG/M |
3300005527|Ga0068876_10022864 | All Organisms → Viruses → Predicted Viral | 3938 | Open in IMG/M |
3300005527|Ga0068876_10044852 | Not Available | 2711 | Open in IMG/M |
3300005527|Ga0068876_10099642 | All Organisms → Viruses → Predicted Viral | 1734 | Open in IMG/M |
3300005527|Ga0068876_10155499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1342 | Open in IMG/M |
3300005527|Ga0068876_10158428 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300005527|Ga0068876_10176158 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
3300005527|Ga0068876_10307791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300005527|Ga0068876_10363796 | Not Available | 811 | Open in IMG/M |
3300005527|Ga0068876_10366740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300005527|Ga0068876_10368124 | Not Available | 805 | Open in IMG/M |
3300005527|Ga0068876_10651501 | Not Available | 566 | Open in IMG/M |
3300005528|Ga0068872_10637824 | Not Available | 562 | Open in IMG/M |
3300005582|Ga0049080_10150826 | Not Available | 779 | Open in IMG/M |
3300005662|Ga0078894_10156492 | All Organisms → Viruses → Predicted Viral | 2050 | Open in IMG/M |
3300005662|Ga0078894_10162526 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
3300005662|Ga0078894_10179084 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1914 | Open in IMG/M |
3300005662|Ga0078894_10186458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1875 | Open in IMG/M |
3300005662|Ga0078894_10282876 | All Organisms → Viruses → Predicted Viral | 1505 | Open in IMG/M |
3300005662|Ga0078894_10713105 | Not Available | 884 | Open in IMG/M |
3300005805|Ga0079957_1022709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4329 | Open in IMG/M |
3300005805|Ga0079957_1093938 | All Organisms → Viruses → Predicted Viral | 1654 | Open in IMG/M |
3300006484|Ga0070744_10022218 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
3300006484|Ga0070744_10033506 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
3300006484|Ga0070744_10168049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300006639|Ga0079301_1044043 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
3300006639|Ga0079301_1151138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300006641|Ga0075471_10631736 | Not Available | 524 | Open in IMG/M |
3300008055|Ga0108970_10302778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. FW510-R10 | 879 | Open in IMG/M |
3300008055|Ga0108970_11791491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300008107|Ga0114340_1031715 | All Organisms → Viruses → Predicted Viral | 2417 | Open in IMG/M |
3300008107|Ga0114340_1047410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1896 | Open in IMG/M |
3300008107|Ga0114340_1049152 | All Organisms → Viruses → Predicted Viral | 1852 | Open in IMG/M |
3300008107|Ga0114340_1094340 | Not Available | 1208 | Open in IMG/M |
3300008107|Ga0114340_1099858 | Not Available | 1162 | Open in IMG/M |
3300008107|Ga0114340_1103497 | Not Available | 1134 | Open in IMG/M |
3300008107|Ga0114340_1166643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300008107|Ga0114340_1179333 | Not Available | 742 | Open in IMG/M |
3300008107|Ga0114340_1220568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300008107|Ga0114340_1229843 | Not Available | 586 | Open in IMG/M |
3300008107|Ga0114340_1241175 | Not Available | 561 | Open in IMG/M |
3300008107|Ga0114340_1267138 | Not Available | 511 | Open in IMG/M |
3300008107|Ga0114340_1267794 | Not Available | 510 | Open in IMG/M |
3300008110|Ga0114343_1039721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1892 | Open in IMG/M |
3300008110|Ga0114343_1162664 | Not Available | 696 | Open in IMG/M |
3300008110|Ga0114343_1194518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300008110|Ga0114343_1227414 | Not Available | 517 | Open in IMG/M |
3300008113|Ga0114346_1062110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1818 | Open in IMG/M |
3300008113|Ga0114346_1142356 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
3300008113|Ga0114346_1280131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300008113|Ga0114346_1300557 | Not Available | 553 | Open in IMG/M |
3300008116|Ga0114350_1046777 | All Organisms → Viruses → Predicted Viral | 1599 | Open in IMG/M |
3300008116|Ga0114350_1062372 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
3300008259|Ga0114841_1035747 | Not Available | 2515 | Open in IMG/M |
3300008261|Ga0114336_1219384 | Not Available | 784 | Open in IMG/M |
3300008262|Ga0114337_1208870 | Not Available | 787 | Open in IMG/M |
3300008263|Ga0114349_1095830 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
3300008264|Ga0114353_1144379 | All Organisms → Viruses → Predicted Viral | 2636 | Open in IMG/M |
3300008266|Ga0114363_1014441 | All Organisms → Viruses → Predicted Viral | 4441 | Open in IMG/M |
3300008266|Ga0114363_1072387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1306 | Open in IMG/M |
3300008448|Ga0114876_1132081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300008953|Ga0104241_1010983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300008962|Ga0104242_1044971 | Not Available | 747 | Open in IMG/M |
3300009419|Ga0114982_1006610 | All Organisms → Viruses → Predicted Viral | 4330 | Open in IMG/M |
3300010354|Ga0129333_10194248 | All Organisms → Viruses → Predicted Viral | 1848 | Open in IMG/M |
3300010354|Ga0129333_10858888 | Not Available | 770 | Open in IMG/M |
3300010354|Ga0129333_10988465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300010354|Ga0129333_11147467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. FW510-R10 | 647 | Open in IMG/M |
3300013004|Ga0164293_10264523 | All Organisms → Viruses → Predicted Viral | 1208 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10103593 | All Organisms → Viruses → Predicted Viral | 1995 | Open in IMG/M |
3300020048|Ga0207193_1225265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1448 | Open in IMG/M |
3300020141|Ga0211732_1441649 | Not Available | 798 | Open in IMG/M |
3300020151|Ga0211736_10354012 | All Organisms → Viruses → Predicted Viral | 3095 | Open in IMG/M |
3300020172|Ga0211729_10338628 | Not Available | 521 | Open in IMG/M |
3300020172|Ga0211729_11292709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300020498|Ga0208050_1009851 | Not Available | 1086 | Open in IMG/M |
3300020519|Ga0208223_1009676 | All Organisms → Viruses → Predicted Viral | 1561 | Open in IMG/M |
3300021961|Ga0222714_10005018 | Not Available | 12727 | Open in IMG/M |
3300021961|Ga0222714_10101021 | All Organisms → Viruses → Predicted Viral | 1825 | Open in IMG/M |
3300021961|Ga0222714_10130884 | All Organisms → Viruses → Predicted Viral | 1534 | Open in IMG/M |
3300021962|Ga0222713_10155702 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
3300021963|Ga0222712_10683696 | Not Available | 580 | Open in IMG/M |
3300021963|Ga0222712_10717895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300024346|Ga0244775_10103393 | All Organisms → Viruses → Predicted Viral | 2421 | Open in IMG/M |
3300024346|Ga0244775_10117363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2256 | Open in IMG/M |
3300024346|Ga0244775_10703664 | Not Available | 814 | Open in IMG/M |
3300024346|Ga0244775_10736414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300024346|Ga0244775_10789110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300027114|Ga0208009_1009800 | All Organisms → Viruses → Predicted Viral | 2397 | Open in IMG/M |
3300027131|Ga0255066_1011916 | All Organisms → Viruses → Predicted Viral | 1318 | Open in IMG/M |
3300027131|Ga0255066_1030179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300027499|Ga0208788_1090739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300027631|Ga0208133_1052421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
3300027631|Ga0208133_1101775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300027644|Ga0209356_1109525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300027697|Ga0209033_1015960 | All Organisms → Viruses → Predicted Viral | 3171 | Open in IMG/M |
3300027710|Ga0209599_10013105 | All Organisms → Viruses → Predicted Viral | 2471 | Open in IMG/M |
3300027769|Ga0209770_10407592 | Not Available | 502 | Open in IMG/M |
3300027793|Ga0209972_10172374 | Not Available | 1021 | Open in IMG/M |
3300027804|Ga0209358_10213708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
3300027804|Ga0209358_10319049 | Not Available | 757 | Open in IMG/M |
3300027805|Ga0209229_10000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 91329 | Open in IMG/M |
3300028025|Ga0247723_1000052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 65465 | Open in IMG/M |
3300028025|Ga0247723_1007072 | All Organisms → Viruses → Predicted Viral | 4804 | Open in IMG/M |
3300028025|Ga0247723_1014961 | All Organisms → Viruses → Predicted Viral | 2805 | Open in IMG/M |
3300028025|Ga0247723_1040918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
3300028025|Ga0247723_1158625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300031784|Ga0315899_11788157 | Not Available | 501 | Open in IMG/M |
3300031787|Ga0315900_10498078 | Not Available | 924 | Open in IMG/M |
3300031787|Ga0315900_10617217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300031787|Ga0315900_10732994 | Not Available | 694 | Open in IMG/M |
3300031787|Ga0315900_10978083 | Not Available | 559 | Open in IMG/M |
3300031857|Ga0315909_10376786 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300031857|Ga0315909_10917643 | Not Available | 538 | Open in IMG/M |
3300032050|Ga0315906_11042782 | Not Available | 610 | Open in IMG/M |
3300034012|Ga0334986_0460363 | Not Available | 633 | Open in IMG/M |
3300034061|Ga0334987_0257408 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
3300034062|Ga0334995_0106739 | All Organisms → Viruses → Predicted Viral | 2110 | Open in IMG/M |
3300034063|Ga0335000_0294817 | Not Available | 1001 | Open in IMG/M |
3300034066|Ga0335019_0000065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 60076 | Open in IMG/M |
3300034066|Ga0335019_0007002 | Not Available | 7666 | Open in IMG/M |
3300034071|Ga0335028_0282854 | Not Available | 990 | Open in IMG/M |
3300034093|Ga0335012_0352150 | Not Available | 733 | Open in IMG/M |
3300034118|Ga0335053_0112086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1875 | Open in IMG/M |
3300034166|Ga0335016_0257306 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.90% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 22.90% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.16% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 7.63% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.11% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.58% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.58% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.58% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.82% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.05% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.53% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.53% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.53% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.53% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.53% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.76% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.76% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.76% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24766J26685_1000015529 | 3300002161 | Freshwater And Sediment | MNKKTITLIGLLVALVAVAFAAYNSFSQLKDIDYDLFETEDEDDD* |
JGI25930J51415_10219884 | 3300003499 | Freshwater Lake | MNKKTITLLSLGLALAAIAYVTYNSLSQLKDIDYDLFEEDIDDIDE* |
Ga0065166_100150571 | 3300004112 | Freshwater Lake | MNKKTITLVALGLALAAITYVTYNSLSQLNDIDYDLFGADEEEDD* |
Ga0065166_100602633 | 3300004112 | Freshwater Lake | MNKKTITLIGLVVALAAVALAIYNSFSQLKDVDYDLFGTEDDEDY* |
Ga0065166_102984463 | 3300004112 | Freshwater Lake | MNKKTITLIGLGLSLAAIAYVTYNSFSQLKDVDYDLFDTEEDEDD* |
Ga0007787_104163801 | 3300004240 | Freshwater Lake | MNKKVVGLLSLGISLAAIAYVTYNSLAQLKDIDYDLFDIEEDIDTEE* |
Ga0007787_104693462 | 3300004240 | Freshwater Lake | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKGIDYDLFDTEEDEDD* |
Ga0068876_100228643 | 3300005527 | Freshwater Lake | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDMFDEESEDEDF* |
Ga0068876_1004485211 | 3300005527 | Freshwater Lake | MNKKTITFIGLIVALAAVAFAAYNSLSQLKDIDYDLFDTEEDEDD* |
Ga0068876_100996426 | 3300005527 | Freshwater Lake | MNKKTITVVSLGLALAAIAYVTYSSLSQLKDIDYDTFDEESEDEDF* |
Ga0068876_101554994 | 3300005527 | Freshwater Lake | MNKKTITLLSLGLALAAIAYVAYNTLTQLKDIDYDLFDIEEDIDHE* |
Ga0068876_101584282 | 3300005527 | Freshwater Lake | MNKKTITLIGLLVALAAVAYATYNSLSQLKDIDYDLFDTEEDEDD* |
Ga0068876_101761584 | 3300005527 | Freshwater Lake | MNKKAITIVSLGLALVAIAYVAYNTLSQLKDIDYDLFDIEEDIDHE* |
Ga0068876_103077911 | 3300005527 | Freshwater Lake | MNKKTITLIGLLVALVAVAFAAYNSFSQLKDIDYDLFDTEEDEDD* |
Ga0068876_103637963 | 3300005527 | Freshwater Lake | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDIDTEE* |
Ga0068876_103667403 | 3300005527 | Freshwater Lake | MNKKAITLVSLGLALAAIAYVAYNTLTQLKDIDYDLFDIEEDIDHE* |
Ga0068876_103681242 | 3300005527 | Freshwater Lake | MNKKTITLVSLGLALAAIAYVTYNSLAQLKDIDYDLFDLEEDIDTEE* |
Ga0068876_106515013 | 3300005527 | Freshwater Lake | TITLIGLGLSLAAIAYVTYNSLSQLKDIDYDLFDIEEDIDHE* |
Ga0068872_106378242 | 3300005528 | Freshwater Lake | MNKKMITLVSLSLSLAAIAFVAYNAISKLKDIDYDLFDIEEDIDLDHE* |
Ga0049080_101508263 | 3300005582 | Freshwater Lentic | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDFFDLEEDIDTEE* |
Ga0078894_101564925 | 3300005662 | Freshwater Lake | MNKKTITLIGLIVALAAVAYATYNSLSQLKDIDYDLFDTEEDEDD* |
Ga0078894_101625264 | 3300005662 | Freshwater Lake | MNKKTITLIGLLVALVAVAYATYNSLSQLKDIDYDLFDTEEDEDD* |
Ga0078894_101790844 | 3300005662 | Freshwater Lake | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDLFDIEEDIDHE* |
Ga0078894_101864585 | 3300005662 | Freshwater Lake | MNKKTITLLSLGLALAAIAYVTYNSLSQLKDIDYDLFTTDEDEDD* |
Ga0078894_102828766 | 3300005662 | Freshwater Lake | MNKKTITLVGLLVALAAVAYATYNSLSQLKDIDYDLFDTEEDEDD* |
Ga0078894_107131052 | 3300005662 | Freshwater Lake | MNKKIIGLVSLGLSLAAIAYVTYNSLAQLKDVDYDLFDIEEDEND* |
Ga0079957_10227094 | 3300005805 | Lake | MNKKTVGLISLGLALAAIAYVTYNSLTQLKDIDYDLFDIEEDIDSEE* |
Ga0079957_10939383 | 3300005805 | Lake | MNKKTIGLLSLGLSLAAIAYVTYNSFAQLKDIDYDLFDIEEDIDTEE* |
Ga0070744_100222188 | 3300006484 | Estuarine | MNKKTITLLGLMVALAAVAIATYNSFSQLKDVDYDLFDTEEDEDD* |
Ga0070744_100335065 | 3300006484 | Estuarine | MNKKTITLVGLLVALVAVAFAVYNSFSQLKDIDYDLFETDEEDDD* |
Ga0070744_101680493 | 3300006484 | Estuarine | MNKKTITLVGLLVALVAVAFAAYNSFSQLKDIDYDLFDTEEDENED* |
Ga0079301_10440434 | 3300006639 | Deep Subsurface | MNKKMITLVSLALSLAAIAFIAYNAISKLKDIDYDLFDIEEDIDLDHE* |
Ga0079301_11511382 | 3300006639 | Deep Subsurface | MNKKTITLLGLVVALAAVALATYNSFNQLKDVDYDPFGTEDDEDY* |
Ga0075471_106317363 | 3300006641 | Aqueous | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDIDIEE* |
Ga0108970_103027784 | 3300008055 | Estuary | MNKKTITLVALGLALAAITYVTYNSLSQLNDIDYDLFGSDEEEDD* |
Ga0108970_117914912 | 3300008055 | Estuary | MNKKTITLLGLIIALAAIAIATYNSFSQLKDVDYDLFDTEEDKDD* |
Ga0114340_10317158 | 3300008107 | Freshwater, Plankton | MNKKTVTLVSLGLALAAIAYVTYNSLSNLKDIDYDMFDIEEDIDHE* |
Ga0114340_10474103 | 3300008107 | Freshwater, Plankton | MNKKTITLLSLGLALAAISYVVYNTLTQLKDIDYDLFDIEEDIDHE* |
Ga0114340_10491522 | 3300008107 | Freshwater, Plankton | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDLFATDEDEDD* |
Ga0114340_10943404 | 3300008107 | Freshwater, Plankton | MNKKTIGLLSLVIAFAAIGLAAYNSFSQLKDIDYDLFETDEEDDD* |
Ga0114340_10998585 | 3300008107 | Freshwater, Plankton | MNKKTITLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDIDTEE* |
Ga0114340_11034972 | 3300008107 | Freshwater, Plankton | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIEYDLFDIEEDIEEN* |
Ga0114340_11666431 | 3300008107 | Freshwater, Plankton | MNKKTITLVALGLALAAITYVTYNSLSQLKDIDYDMFAEDIDDIDE* |
Ga0114340_11793332 | 3300008107 | Freshwater, Plankton | MNKKTITLIGLSLSLAAIAYVTYNSLSQLKDIDYDMFDEESEDEDF* |
Ga0114340_12205682 | 3300008107 | Freshwater, Plankton | MNKKAITIVSLGLALVAMAYVAYNTLSQLKDIDYDAFEEDLEDKID* |
Ga0114340_12298433 | 3300008107 | Freshwater, Plankton | MNKKTITVISLGLALAAIAYVTYNSLSQLKDIDYDMFDEDSEDQDF* |
Ga0114340_12411753 | 3300008107 | Freshwater, Plankton | MNKKTIGLLSLALAFTAIVFAIYNSFSQLKDIDYDLFETD |
Ga0114340_12671382 | 3300008107 | Freshwater, Plankton | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYD |
Ga0114340_12677943 | 3300008107 | Freshwater, Plankton | MNKKTITVISLGLALAAIAYVTYNSLSQLKDIDYDMFAEDIDDIDE* |
Ga0114343_10397213 | 3300008110 | Freshwater, Plankton | MNKKTIGLLSLVIAFAAIGFAAYNSFSQLKDIDYDLFETDEEDDD* |
Ga0114343_11626641 | 3300008110 | Freshwater, Plankton | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDI |
Ga0114343_11945182 | 3300008110 | Freshwater, Plankton | MNKKTITLIGLLVALAAVAYATYNSLSQLKDIDYDFFGAEEEEDND* |
Ga0114343_12274142 | 3300008110 | Freshwater, Plankton | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDLFSTDEEEDD* |
Ga0114346_10621104 | 3300008113 | Freshwater, Plankton | MNKKTMTLLGLMVALAAVAIAIYNSFSQLKDVDYDLFDTEEDEDD* |
Ga0114346_11423564 | 3300008113 | Freshwater, Plankton | MNKKTITLIGLIVALVAVAYATYNSISQLKDIDYDPFNTEDDEDD* |
Ga0114346_12801313 | 3300008113 | Freshwater, Plankton | MNKKTITLVGLLVALAAVAYATYNSLSQLKDIDYDLFDTEEDE |
Ga0114346_13005571 | 3300008113 | Freshwater, Plankton | HTTMNKKTITLIGLLVALAAVAYATYNSLSQLKDIDYDLFDTEEDEDD* |
Ga0114350_10467773 | 3300008116 | Freshwater, Plankton | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFTNDEEEFND* |
Ga0114350_10623725 | 3300008116 | Freshwater, Plankton | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDLEEDIDSDD* |
Ga0114841_10357471 | 3300008259 | Freshwater, Plankton | MNKKNIGLLSLVLALAAIAFATYNSFSQLKDIDYDLFDLEEDIDTEE* |
Ga0114336_12193842 | 3300008261 | Freshwater, Plankton | MNKKNIGLLSLVLALAAIAFATYNSFSQLKDIDYDLLETDDEEDDD* |
Ga0114337_12088703 | 3300008262 | Freshwater, Plankton | IGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDIDTEE* |
Ga0114349_10958301 | 3300008263 | Freshwater, Plankton | MNKKTITLIGLSLSLAAIAYVTYNSLSQLKDIDYDMFDEDSEDQD |
Ga0114353_11443795 | 3300008264 | Freshwater, Plankton | MNKKNIGLLSLILALAAIAYVTYNSLAQLKDIDYDLFDIEEDIDTEE* |
Ga0114363_10144413 | 3300008266 | Freshwater, Plankton | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDMFKTFNVYSFN* |
Ga0114363_10723875 | 3300008266 | Freshwater, Plankton | KTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDIDIEE* |
Ga0114876_11320814 | 3300008448 | Freshwater Lake | MNKKTITLIGLLVALAAVAYATYNSLSQLKDIDYDLFDTEED |
Ga0104241_10109833 | 3300008953 | Freshwater | MNKKTITLLSLGLALAAISYVAYNTITQLKDIDYDLFDIEEDIDLDHE* |
Ga0104242_10449712 | 3300008962 | Freshwater | MNKKTVTLIALGLALAAITYVTYNSLSQLNDIDYDLFATDEDEDD* |
Ga0114982_10066109 | 3300009419 | Deep Subsurface | MDMNKKAMALVGLIVALVAVAYATYNSLSQLKDIDYDLFDTEEDEDD* |
Ga0129333_101942486 | 3300010354 | Freshwater To Marine Saline Gradient | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDMFDEDSEDQDF* |
Ga0129333_108588882 | 3300010354 | Freshwater To Marine Saline Gradient | MNKKTITVISLGLALAAISYVTYNSLSQLKDIDYDMFDEDSEDQDF* |
Ga0129333_109884653 | 3300010354 | Freshwater To Marine Saline Gradient | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDMFDEDIDDIDE* |
Ga0129333_111474672 | 3300010354 | Freshwater To Marine Saline Gradient | MNKKTITLVALGLALAAITYVTYNSLSQLNDIDYDLFINDEEEDD* |
Ga0164293_102645231 | 3300013004 | Freshwater | MNKKVVGLVSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDEDD* |
(restricted) Ga0172367_101035933 | 3300013126 | Freshwater | MNKKTIGLLSLGLALAAIAYVTYNSLSQLKDIDYDLFDIEEDEDD* |
Ga0207193_12252654 | 3300020048 | Freshwater Lake Sediment | MNKKTITLVGLLVALAAVAFAVYNSFSQLKDIDYDLFETDEEDDD |
Ga0211732_14416491 | 3300020141 | Freshwater | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDLEEDIDSDD |
Ga0211736_103540128 | 3300020151 | Freshwater | MNKKTITLFGLLIALAAVAFAAYNSLSQLKDTDYDLFDTEEDEDD |
Ga0211729_103386283 | 3300020172 | Freshwater | MNKKTIGLLSLSLALAAIAYVTYNSLAQLKDIDYDLFDLEEDI |
Ga0211729_112927092 | 3300020172 | Freshwater | MNKKTITLVGLLVALAAVAYATYNSLSQLKDIDYDLFDTEEDEDD |
Ga0208050_10098514 | 3300020498 | Freshwater | IQGARMNKKVVGLVSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDEND |
Ga0208223_10096766 | 3300020519 | Freshwater | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDMFDEESEDEDF |
Ga0222714_100050184 | 3300021961 | Estuarine Water | MNKKTITLLSLGLALAAISYVVYNTLTQLKDIDYDLFDIEEDIDHE |
Ga0222714_101010213 | 3300021961 | Estuarine Water | MNKKTISLLGLLVALLAVAYATYTSFSQLKDIDYDIFEADEDEDD |
Ga0222714_101308844 | 3300021961 | Estuarine Water | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDIDIEE |
Ga0222713_101557026 | 3300021962 | Estuarine Water | MNKKTITLVGLIVALVAVAYATYNSFSQLKDIDYDLFNTEEDEDD |
Ga0222712_106836963 | 3300021963 | Estuarine Water | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDIDREE |
Ga0222712_107178951 | 3300021963 | Estuarine Water | TIVSLGLALVAISYVAYNTLSQLKDIDYDLFDIEEDIEDEID |
Ga0244775_101033932 | 3300024346 | Estuarine | MNKKTITLLGLMVALAAVAIATYNSFSQLKDVDYDLFDTEEDEDD |
Ga0244775_101173632 | 3300024346 | Estuarine | MNKKTVTLIGLLVALAAVAIATYNSFSQLKDVDYDLFGTEDDDD |
Ga0244775_107036641 | 3300024346 | Estuarine | MNKKTITLVALGLALAAITYVTYNSLSQLNDIDYDLFG |
Ga0244775_107364143 | 3300024346 | Estuarine | MNKKTITLVGLLVALVAVAFAAYNSFSQLKDIDYDLFDTEEDENED |
Ga0244775_107891103 | 3300024346 | Estuarine | MNKKTITLVGLLVALVAVAFAVYNSFSQLKDIDYDLFETDEEDDD |
Ga0208009_10098005 | 3300027114 | Deep Subsurface | MNKKMITLVSLALSLAAIAFIAYNAISKLKDIDYDLFDIEEDIDLDHE |
Ga0255066_10119162 | 3300027131 | Freshwater | MNKKTITLVALGLALAAITYVTYNSLSQLNDIDYDLFGADEEEDD |
Ga0255066_10301793 | 3300027131 | Freshwater | MNKKAITIVSLGLALAAIVYVAYNTLSQLKDIDYDLFDIEEDIDHE |
Ga0208788_10907393 | 3300027499 | Deep Subsurface | MNKKTITLLGLVVALAAVALATYNSFNQLKDVDYDPFGTEDDEDY |
Ga0208133_10524214 | 3300027631 | Estuarine | MNKKTITLLGLLVALAAVALATYNSFNQLKDVDYDPFGTEDDEDY |
Ga0208133_11017752 | 3300027631 | Estuarine | MNKKTITLVGLLVALVAVAFAAYNSFSQLKDIDYDLFETDEEENDD |
Ga0209356_11095251 | 3300027644 | Freshwater Lake | MNKKAITIVSLGLALVAIAYVAYNTLSQLKDIDYD |
Ga0209033_10159609 | 3300027697 | Freshwater Lake | MNKKTITLLSLGLALAAIAYVTYNSLSQLKDIDYDLFEEDIDDIDE |
Ga0209599_100131058 | 3300027710 | Deep Subsurface | METRGIKRSMDMNKKAMALVGLIVALVAVAYATYNSLSQLKDIDYDLFDTEEDEDD |
Ga0209770_104075922 | 3300027769 | Freshwater Lake | MNKKTITLIGLIVALAAVAYATYNSLSQLKDIDYDLFDTEEDEDD |
Ga0209972_101723743 | 3300027793 | Freshwater Lake | KTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDMFDEESEDEDF |
Ga0209358_102137082 | 3300027804 | Freshwater Lake | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKGIDYDLFDTEEDEDD |
Ga0209358_103190492 | 3300027804 | Freshwater Lake | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDLFDIEEDIDHE |
Ga0209229_10000004141 | 3300027805 | Freshwater And Sediment | MNKKTITLIGLLVALVAVAFAAYNSFSQLKDIDYDLFETEDEDDD |
Ga0247723_100005228 | 3300028025 | Deep Subsurface Sediment | MNKKAMALVGLIVALVAVAYATYNSLSQLKDIDYDLFDTEEDEDD |
Ga0247723_10070723 | 3300028025 | Deep Subsurface Sediment | MNKKTVTLLGLLVALAAVALATYNSFNQLKDVDYDPFGTEDDEDY |
Ga0247723_10149617 | 3300028025 | Deep Subsurface Sediment | MNKKTITLIGLGLSLAAIAYVTYNSLSQLKDIDYDLFTTDEDEDD |
Ga0247723_10409186 | 3300028025 | Deep Subsurface Sediment | MNKKTITLIGLLVALVAVAYATYNSLSQLKDIDYDLFDTEEDEDD |
Ga0247723_11586253 | 3300028025 | Deep Subsurface Sediment | MNKKAITIVSLGLALVAIVYVAYNTLSQLKDIDYDTFDEESEDEDF |
Ga0315899_117881572 | 3300031784 | Freshwater | MNKKTVTLVSLGLALAAIAYVTYNSLSNLKDIDYDMFDIEEDIDHE |
Ga0315900_104980783 | 3300031787 | Freshwater | LIGLGLSLAAIAYVTYNSLSQLKDIDYDMFDEESEDEDF |
Ga0315900_106172171 | 3300031787 | Freshwater | MNKKAITLVSLGLALAAIAYVAYNTLTQLKDIDYDLFDIEEDID |
Ga0315900_107329942 | 3300031787 | Freshwater | MNKKTITVVSLGLALAAIAYVTYNSLSQLKDIDYDMFDEDSEDQDF |
Ga0315900_109780833 | 3300031787 | Freshwater | NKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDIDTEE |
Ga0315909_103767861 | 3300031857 | Freshwater | MNKKAITLVSLGLALAAIAYVAYNTLTQLKDIDYDLFDIEED |
Ga0315909_109176432 | 3300031857 | Freshwater | MNKKNIGLLSLVLALAAIAFAAYNSFSQLKDIDYDLFETDDEEDED |
Ga0315906_110427821 | 3300032050 | Freshwater | MNKKTIGLLSLGLALAAIAYVTYNSLAQLKDIDYDLFTNDEEEFND |
Ga0334986_0460363_502_633 | 3300034012 | Freshwater | KKIIGLVSLGLSLAAIAYVTYNSLAQLKDVDYDLFDIEEDEND |
Ga0334987_0257408_306_443 | 3300034061 | Freshwater | MNKKVVGLLSLGISLAAIAYVTYNSLAQLKDIDYDLFDIEEDEDD |
Ga0334995_0106739_147_284 | 3300034062 | Freshwater | MNKKVVGLVSLGLALAAIAYVTYNSLAQLKDIDYDLFDIEEDEND |
Ga0335000_0294817_2_112 | 3300034063 | Freshwater | MNKKIIGLVSLGLSLAAIAYVTYNSLAQLKDVDYDLF |
Ga0335019_0000065_13224_13361 | 3300034066 | Freshwater | MNKKTITLVGLLIALAAVAFAAYNSLSQLKDIDYDLFDTEEDEDD |
Ga0335019_0007002_7546_7665 | 3300034066 | Freshwater | TLIGLLIALVAVAFAAYNSFSQLKDIDYDLFDTEEDEDD |
Ga0335028_0282854_2_121 | 3300034071 | Freshwater | MNKKNIGLLSLVLALAAIAFATYNSFSQLKDIDYDLFETD |
Ga0335012_0352150_555_692 | 3300034093 | Freshwater | MNKKIIGLVSLGLSLAAIAYVTYNSLAQLKDIDYDLFDIEEDEDD |
Ga0335053_0112086_532_669 | 3300034118 | Freshwater | MNKKVVGLVSLGLALAAIAYVTYNSLAQLKDVDYDLFDIEEDEND |
Ga0335016_0257306_529_681 | 3300034166 | Freshwater | MQGAKMNKKIIGLVSLGLSLAAIAYVTYNSLAQLKDVDYDLFDIEEDEND |
⦗Top⦘ |