Basic Information | |
---|---|
Family ID | F061695 |
Family Type | Metagenome |
Number of Sequences | 131 |
Average Sequence Length | 40 residues |
Representative Sequence | YPQTRPGADGTRVNFFLVSAPDAGKVLIELYEPPPRLD |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 94.66 % |
% of genes from short scaffolds (< 2000 bps) | 80.92 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.229 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.794 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.878 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.328 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.55% β-sheet: 31.82% Coil/Unstructured: 63.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF06202 | GDE_C | 63.36 |
PF12439 | GDE_N | 7.63 |
PF03200 | Glyco_hydro_63 | 5.34 |
PF13561 | adh_short_C2 | 3.05 |
PF00583 | Acetyltransf_1 | 3.05 |
PF00106 | adh_short | 1.53 |
PF04255 | DUF433 | 1.53 |
PF01850 | PIN | 1.53 |
PF13506 | Glyco_transf_21 | 0.76 |
PF13365 | Trypsin_2 | 0.76 |
PF07077 | DUF1345 | 0.76 |
PF00171 | Aldedh | 0.76 |
PF03544 | TonB_C | 0.76 |
PF01381 | HTH_3 | 0.76 |
PF12697 | Abhydrolase_6 | 0.76 |
PF03938 | OmpH | 0.76 |
PF00398 | RrnaAD | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 63.36 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.53 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.76 |
COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.76 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.76 |
COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.76 |
COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.23 % |
Unclassified | root | N/A | 29.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001089|JGI12683J13190_1008078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1055 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101725961 | Not Available | 526 | Open in IMG/M |
3300004080|Ga0062385_10388386 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300004092|Ga0062389_101307762 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300004152|Ga0062386_100690213 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300005167|Ga0066672_10262666 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300005174|Ga0066680_10316119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 997 | Open in IMG/M |
3300005179|Ga0066684_10155757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1452 | Open in IMG/M |
3300005179|Ga0066684_10856694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
3300005332|Ga0066388_108679533 | Not Available | 505 | Open in IMG/M |
3300005541|Ga0070733_10156723 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
3300005549|Ga0070704_100005225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 7556 | Open in IMG/M |
3300005552|Ga0066701_10862741 | Not Available | 537 | Open in IMG/M |
3300005591|Ga0070761_10270028 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300005764|Ga0066903_100054154 | All Organisms → cellular organisms → Bacteria | 4927 | Open in IMG/M |
3300005764|Ga0066903_102756857 | Not Available | 953 | Open in IMG/M |
3300005921|Ga0070766_10085352 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
3300005983|Ga0081540_1145603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 943 | Open in IMG/M |
3300006041|Ga0075023_100153930 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300006050|Ga0075028_100905813 | Not Available | 543 | Open in IMG/M |
3300006052|Ga0075029_100028916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3138 | Open in IMG/M |
3300006102|Ga0075015_100293940 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300006162|Ga0075030_100934835 | Not Available | 683 | Open in IMG/M |
3300007258|Ga0099793_10038435 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
3300009088|Ga0099830_10000927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14147 | Open in IMG/M |
3300009090|Ga0099827_10168741 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
3300009090|Ga0099827_11228240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 652 | Open in IMG/M |
3300009444|Ga0114945_10900755 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 546 | Open in IMG/M |
3300010048|Ga0126373_11586539 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300010339|Ga0074046_10173529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1366 | Open in IMG/M |
3300010360|Ga0126372_11714348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300010360|Ga0126372_12958191 | Not Available | 527 | Open in IMG/M |
3300010361|Ga0126378_10006025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9475 | Open in IMG/M |
3300010371|Ga0134125_12060800 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300010376|Ga0126381_100874324 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300010376|Ga0126381_101903237 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300010398|Ga0126383_11898031 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300011271|Ga0137393_10834858 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300012189|Ga0137388_10024839 | All Organisms → cellular organisms → Bacteria | 4574 | Open in IMG/M |
3300012203|Ga0137399_10956798 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300012205|Ga0137362_10052261 | All Organisms → cellular organisms → Bacteria | 3335 | Open in IMG/M |
3300012207|Ga0137381_11787635 | Not Available | 504 | Open in IMG/M |
3300012361|Ga0137360_10571835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
3300012362|Ga0137361_10927698 | Not Available | 789 | Open in IMG/M |
3300012582|Ga0137358_10237299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1242 | Open in IMG/M |
3300012922|Ga0137394_10660639 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300012927|Ga0137416_10286293 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300012930|Ga0137407_10694360 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300012984|Ga0164309_10339762 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300014201|Ga0181537_10388880 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300015053|Ga0137405_1343732 | Not Available | 6425 | Open in IMG/M |
3300015371|Ga0132258_10653472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2644 | Open in IMG/M |
3300017822|Ga0187802_10194667 | Not Available | 779 | Open in IMG/M |
3300017928|Ga0187806_1088335 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300017932|Ga0187814_10201484 | Not Available | 748 | Open in IMG/M |
3300017934|Ga0187803_10432461 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300017994|Ga0187822_10100670 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300018019|Ga0187874_10050800 | Not Available | 1925 | Open in IMG/M |
3300020170|Ga0179594_10319504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium SW_9_47_5 | 588 | Open in IMG/M |
3300020579|Ga0210407_10155600 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
3300020581|Ga0210399_10051029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3323 | Open in IMG/M |
3300020581|Ga0210399_10287894 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300020581|Ga0210399_10572279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 936 | Open in IMG/M |
3300020581|Ga0210399_10833748 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300020581|Ga0210399_10902066 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300020583|Ga0210401_10718638 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300021168|Ga0210406_10450849 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300021170|Ga0210400_10476005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1031 | Open in IMG/M |
3300021420|Ga0210394_10417828 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300021432|Ga0210384_10825906 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 825 | Open in IMG/M |
3300021479|Ga0210410_10689417 | Not Available | 903 | Open in IMG/M |
3300021560|Ga0126371_10442157 | Not Available | 1445 | Open in IMG/M |
3300021560|Ga0126371_12168920 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300021560|Ga0126371_13020179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300023075|Ga0224520_1089222 | Not Available | 688 | Open in IMG/M |
3300024271|Ga0224564_1033453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 971 | Open in IMG/M |
3300025906|Ga0207699_10717245 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300025922|Ga0207646_11767164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300026310|Ga0209239_1032316 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
3300026316|Ga0209155_1224546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300026548|Ga0209161_10311110 | Not Available | 746 | Open in IMG/M |
3300026552|Ga0209577_10157347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1781 | Open in IMG/M |
3300026895|Ga0207758_1006561 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300027381|Ga0208983_1057066 | Not Available | 749 | Open in IMG/M |
3300027590|Ga0209116_1079910 | Not Available | 716 | Open in IMG/M |
3300027643|Ga0209076_1174552 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300027765|Ga0209073_10285137 | Not Available | 651 | Open in IMG/M |
3300027783|Ga0209448_10269780 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300027824|Ga0209040_10251757 | Not Available | 885 | Open in IMG/M |
3300027829|Ga0209773_10418540 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300027846|Ga0209180_10192771 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300027857|Ga0209166_10390152 | Not Available | 724 | Open in IMG/M |
3300027869|Ga0209579_10044805 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
3300027889|Ga0209380_10005224 | All Organisms → cellular organisms → Bacteria | 7874 | Open in IMG/M |
3300027910|Ga0209583_10059540 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300027910|Ga0209583_10126378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1018 | Open in IMG/M |
3300028536|Ga0137415_11243402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium SW_9_47_5 | 561 | Open in IMG/M |
3300031128|Ga0170823_11873133 | Not Available | 854 | Open in IMG/M |
3300031231|Ga0170824_105916347 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300031549|Ga0318571_10282530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300031564|Ga0318573_10395094 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300031679|Ga0318561_10216301 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300031718|Ga0307474_10835506 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300031718|Ga0307474_11239109 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300031720|Ga0307469_10033876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3008 | Open in IMG/M |
3300031744|Ga0306918_10013195 | All Organisms → cellular organisms → Bacteria | 4770 | Open in IMG/M |
3300031744|Ga0306918_10386058 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300031753|Ga0307477_10041757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3150 | Open in IMG/M |
3300031753|Ga0307477_10511710 | Not Available | 815 | Open in IMG/M |
3300031754|Ga0307475_10015930 | All Organisms → cellular organisms → Bacteria | 5157 | Open in IMG/M |
3300031754|Ga0307475_10512198 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300031777|Ga0318543_10537999 | Not Available | 523 | Open in IMG/M |
3300031795|Ga0318557_10281992 | Not Available | 762 | Open in IMG/M |
3300031833|Ga0310917_10098090 | Not Available | 1883 | Open in IMG/M |
3300031942|Ga0310916_10211584 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
3300031962|Ga0307479_11552836 | Not Available | 618 | Open in IMG/M |
3300031962|Ga0307479_11727814 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300031962|Ga0307479_11852542 | Not Available | 554 | Open in IMG/M |
3300031981|Ga0318531_10030441 | Not Available | 2214 | Open in IMG/M |
3300032035|Ga0310911_10146370 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300032039|Ga0318559_10126302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1150 | Open in IMG/M |
3300032174|Ga0307470_11840363 | Not Available | 513 | Open in IMG/M |
3300032180|Ga0307471_102517864 | Not Available | 651 | Open in IMG/M |
3300032205|Ga0307472_100248754 | Not Available | 1392 | Open in IMG/M |
3300033158|Ga0335077_10728957 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.79% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.03% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.11% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.34% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.58% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.05% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.05% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.29% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.53% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.53% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.76% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.76% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300023075 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25 | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12683J13190_10080782 | 3300001089 | Forest Soil | ATRHGADGTRVNFFLVASPDGGRVLIELYELQSRG* |
JGIcombinedJ26739_1017259611 | 3300002245 | Forest Soil | PIYPQTRPGADNTRINFFLARTPDGAKVLIELYEK* |
Ga0062385_103883861 | 3300004080 | Bog Forest Soil | GVTPIYPEARPGADGTRVNFFLAPTSAGGKVLIELYEIP* |
Ga0062389_1013077621 | 3300004092 | Bog Forest Soil | VYPETRPGADGTRVNFFLMPVPGGSKVLIELYESAAKLHQK* |
Ga0062386_1006902131 | 3300004152 | Bog Forest Soil | IAPVFPATRTGADGTRINFFLVSAPSANKVLIELYEPAPRMD* |
Ga0066672_102626662 | 3300005167 | Soil | VAPVYPATRPGADGTRINFFLVVSPDGGKVLIELYESQSGR* |
Ga0066680_103161192 | 3300005174 | Soil | VYPETRPGANATRVNFFLMPAADGKKVLIELYEAPARQP* |
Ga0066684_101557573 | 3300005179 | Soil | IAPVYPATRPGADGTRVNFFLVASPDGGKVLIELYQPASRAQS* |
Ga0066684_108566942 | 3300005179 | Soil | IAPVYPATRPGADGTRVNFFLVASPDGGKVLIELYQPASKAQS* |
Ga0066388_1086795331 | 3300005332 | Tropical Forest Soil | DRFDLLAVYPETRNGADGTRVNFFLASTPEHQKVLIELYEK* |
Ga0070733_101567231 | 3300005541 | Surface Soil | RPGADGTRVNFFLIPSADSGKVLIELYEKTGGNKSH* |
Ga0070704_1000052251 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | YQETRAGADRTRVNFFLVPVPSGGKILIEFYESNSKDDKK* |
Ga0066701_108627411 | 3300005552 | Soil | KRFGVTAVYPETREGADGTRVNFFLVTTPEEEKVLIELYEKKS* |
Ga0070761_102700282 | 3300005591 | Soil | PGADGTRVNFFLMPVPGGGKVLIELYESAAKPRQK* |
Ga0066903_1000541543 | 3300005764 | Tropical Forest Soil | ALKPVYPATRSGADETRVNFFLLSAPGANKILIELYEPAQRLE* |
Ga0066903_1027568572 | 3300005764 | Tropical Forest Soil | PATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID* |
Ga0070766_100853521 | 3300005921 | Soil | AIYPETRPGADGTRVNFFLVAAPDAAKVLIELYEPAPRLD* |
Ga0081540_11456031 | 3300005983 | Tabebuia Heterophylla Rhizosphere | ESIYSKKRTGADGAQVNFFLVPGADGKKVLIELYEAPAIRF* |
Ga0075023_1001539301 | 3300006041 | Watersheds | QTRPGADDTKVNFFLVPQPSSGKVLVELYERGNGV* |
Ga0075028_1009058132 | 3300006050 | Watersheds | SVYPETRAGADGTRVNFFLIKSPDGGKVLIELYELPSRG* |
Ga0075029_1000289164 | 3300006052 | Watersheds | VYPETRAGADGTRVNFFLAKSPDGGKALIELYELPSRS* |
Ga0075015_1002939402 | 3300006102 | Watersheds | TRAGADGTRVNFFLIKSPDGGKVLIELYELPSRG* |
Ga0075030_1009348351 | 3300006162 | Watersheds | KFNLPAVYPATRPGADGTRVNFFLVSAPDAGKVLIELYEPAPRLD* |
Ga0066659_100244031 | 3300006797 | Soil | QILKDKFGVVPVYPATRPGADGTRINFFLVVSPDGGKVLIELYESQSGR* |
Ga0099793_100384351 | 3300007258 | Vadose Zone Soil | ENFGVQPIYPQTRAGAGDTRVNFFLVSSPNSAKVLIELYET* |
Ga0099830_100009279 | 3300009088 | Vadose Zone Soil | IYPEARPGADGTRVNFFLADSADGEKVLIELYELAAIRLE* |
Ga0099827_101687412 | 3300009090 | Vadose Zone Soil | YPATRPGADGTRVQFFLVPSPGTGKVLIELYESPAATQA* |
Ga0099827_112282401 | 3300009090 | Vadose Zone Soil | DKFGVTSVYPATRHGSDGTRVNFFLVTSPDGGKVLIELYELQSRG* |
Ga0114945_109007551 | 3300009444 | Thermal Springs | PGAGGTRVNFFLVALPEGGKVLIELFEPAPRKPD* |
Ga0126373_104136211 | 3300010048 | Tropical Forest Soil | GKFKVGSIYPATRAGADGTRVNFFLVASPDGGKVLVELYELKPHA* |
Ga0126373_115865391 | 3300010048 | Tropical Forest Soil | ATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID* |
Ga0074046_101735291 | 3300010339 | Bog Forest Soil | TRTGADGTRVNFFLVSAPGASKVLIELYEPAPRMD* |
Ga0126372_117143481 | 3300010360 | Tropical Forest Soil | DKFGIRAVYPQTRPGADGTRVNFFLLSLPRTSKVLVELYQRLEGLG* |
Ga0126372_129581912 | 3300010360 | Tropical Forest Soil | KPVYPATRSGADETRVNFFLLSAPGANKILIELYEPAQRLE* |
Ga0126378_100060259 | 3300010361 | Tropical Forest Soil | LQERFKIAPVYTETRPGADGTRVNFFLVASPDGGRVLIELYEAASKAPS* |
Ga0134125_120608001 | 3300010371 | Terrestrial Soil | IYAQTRRGADNTRVNFFLVPSPVSGKVLIELFELPRSH* |
Ga0126381_1008743241 | 3300010376 | Tropical Forest Soil | VYAAKRPGADGTAVNFFLVAGRDGKKVLIELYETAG* |
Ga0126381_1019032372 | 3300010376 | Tropical Forest Soil | YPQTRPGADGTRVNFFLVSAPDAGKVLIELYEPPPRLD* |
Ga0126383_118980312 | 3300010398 | Tropical Forest Soil | RPGADGARVNFFLVSAPKANKVLIELYEPAPHID* |
Ga0137393_108348582 | 3300011271 | Vadose Zone Soil | KEKFQIQSIYPQTRPGADNTWVNFFLVSLPAGGKVLIELYQRNVSR* |
Ga0137388_100248393 | 3300012189 | Vadose Zone Soil | VYAAARAGADGTRVNFFLVDAPGAGKVLIELYEEAARME* |
Ga0137399_109567981 | 3300012203 | Vadose Zone Soil | AIYPETRPGADGARVNFFLVSATDSAKVLIELYEAAPRLD* |
Ga0137362_100522615 | 3300012205 | Vadose Zone Soil | AVYPETRPGADGTRVNFFLVSATDSAKVLIELYEPAPRLD* |
Ga0137381_117876352 | 3300012207 | Vadose Zone Soil | PVYPAIRNGTDATRVNFFLVASPDGGKVLIELYELQSRG* |
Ga0137384_103579311 | 3300012357 | Vadose Zone Soil | LKDKFGVAPVYPATRPGADGTRINFFLVVSPDGGKVLIELYESQSGT* |
Ga0137360_105718351 | 3300012361 | Vadose Zone Soil | YPATRAGADGTRVNFFLVASPDGGKVLIELYETQSRG* |
Ga0137361_109276982 | 3300012362 | Vadose Zone Soil | REARPGADGTRVNFFLAGTADGKKVLIELYEPAAIRFE* |
Ga0137358_102372992 | 3300012582 | Vadose Zone Soil | YPETRPGANATRVNFFLMPGADGKKVLIELYEAGALPP* |
Ga0137394_106606391 | 3300012922 | Vadose Zone Soil | EKFRVAPVYSETRNGADGTRVNFFLVPSPDGGKVLIELYEMQSRG* |
Ga0137416_102862932 | 3300012927 | Vadose Zone Soil | VYPAMRHGADGTRVNFFLVVSPDGGKVLIELYESPSRG* |
Ga0137407_106943601 | 3300012930 | Vadose Zone Soil | FNVSAVYPETRPGADGTRVNFFLVSATDSAKVLIELYEAAPRLD* |
Ga0164309_103397621 | 3300012984 | Soil | PSIQPGADGTRINFFLVAGADGKKVLVELYEPELPG* |
Ga0181537_103888802 | 3300014201 | Bog | AVEPIYPQTRPGADNTRINFFLARTSDGAKVLIELYEK* |
Ga0137405_134373210 | 3300015053 | Vadose Zone Soil | MSDSEVTAIYPETRAGADGTRVNFFLVTTHDNEKVLIELYEKRA* |
Ga0132258_106534721 | 3300015371 | Arabidopsis Rhizosphere | HSRPGADGTRINFFLVAASGGGKILIELYEAPKS* |
Ga0187802_101946672 | 3300017822 | Freshwater Sediment | TRPGADGTRINFFLLSAPSANKVLIELYEPAPRLD |
Ga0187806_10883351 | 3300017928 | Freshwater Sediment | FSLQPIYPATRPGADGTRVNFFLLSAPGASKVLIELYEPAPRLD |
Ga0187814_102014842 | 3300017932 | Freshwater Sediment | PIYPATRPGADGTRVNFFLLSAPDANKVLIELYEPAPRLD |
Ga0187803_104324611 | 3300017934 | Freshwater Sediment | PVFPATRTGADGTRINFFLVSAPSASKVLIELYEPAPRID |
Ga0187822_101006703 | 3300017994 | Freshwater Sediment | GQASIYPEKRPGANHTQVNFFLASAPDSSKVLIELYE |
Ga0187874_100508002 | 3300018019 | Peatland | GIAPAYPATRAGADGTRINFFLVSAPIASKVLIELYEPAPRLD |
Ga0066669_104576391 | 3300018482 | Grasslands Soil | ILKDKFGVAPVYPASRPGADGTRINFFLVVSPDGGKVLIELYESPSSR |
Ga0179594_103195042 | 3300020170 | Vadose Zone Soil | KFKVASIYPATRAGADGTRVNFFLVASPDGGKVLIELYEAQSRG |
Ga0210407_101556002 | 3300020579 | Soil | LKPVYPATRPGADETRVNFFLLSAPGANKVLIELYEPAQRLE |
Ga0210399_100510291 | 3300020581 | Soil | QAVYPDTRQGADGTRVNFFLVPAPDAGKVLIELYEPAPRLD |
Ga0210399_102878942 | 3300020581 | Soil | PDTRAGADGTRVNFFLVKSPDGGKVLIELYELPSRA |
Ga0210399_105722791 | 3300020581 | Soil | RPGADGTRVNFFLVSTPGAGKVLIELYELPSAAQTPTKK |
Ga0210399_108337481 | 3300020581 | Soil | ATRPGADGTRVNFFLVSTPGVGKVLIELYELPPGAPRT |
Ga0210399_109020661 | 3300020581 | Soil | YPGTRPGADGARVNFFLVAAPGVNKVLIELYEHVPNLE |
Ga0210401_107186382 | 3300020583 | Soil | IYPEARPGADGTRVNFFLAPTSAGGKVLIELYEIPANQS |
Ga0210406_104508492 | 3300021168 | Soil | AFGVQAVYPQTRPGANNTRVNFFLIPSPKSGRVLIELYEL |
Ga0210400_104760051 | 3300021170 | Soil | IYPETRAGADNTRVNFFLVPSPVSGKVLIELYQRDGGV |
Ga0210394_104178282 | 3300021420 | Soil | VYPETRAGSDGTRINFFLAVAPGGGKVLIELYERK |
Ga0210384_108259061 | 3300021432 | Soil | FAITSVYPATRPGADGTRVNFFLVSTPDSGKVLIEFYEPAARPS |
Ga0210410_106894172 | 3300021479 | Soil | FSVQPIYPQTRPGAGDTRVNFFLVPSSNSGKILIELYET |
Ga0126371_104421571 | 3300021560 | Tropical Forest Soil | RFGLSPVYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID |
Ga0126371_121689202 | 3300021560 | Tropical Forest Soil | YPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID |
Ga0126371_130201792 | 3300021560 | Tropical Forest Soil | YPEARPGADGTRVNFFLLASPDGGKVLVELYEAKSGG |
Ga0224520_10892222 | 3300023075 | Soil | FGIAPVFPATRTGADGTRINFFLVSAPGASKVLIELYEPAPRID |
Ga0224564_10334533 | 3300024271 | Soil | VAAVYPETRAGTDGTRINFFLVVAPGGGKVLIELYERK |
Ga0207699_107172451 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AHPGADGTRVNFFLTSNADGKKVLIELYEPAAIRFE |
Ga0207646_117671641 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VYPATRPGADGTRVNFFLVVSPDGGKVLIELYQATSKAPS |
Ga0209239_10323163 | 3300026310 | Grasslands Soil | QFKIAPVYPATRPGADGTRVNFFLVASPDGGKVLIELYQPASKAQS |
Ga0209155_12245461 | 3300026316 | Soil | RPGADGTRVNFFLVASPDGGKVLIELYQPASRAQS |
Ga0209161_103111101 | 3300026548 | Soil | GILAVYPETRPGANATRVNFFLMPAADGKKVLIELYEAPAPQP |
Ga0209577_101573471 | 3300026552 | Soil | VYPATRPGADGTRVNFFLVASPDGGKVLIELYQTASKA |
Ga0207758_10065612 | 3300026895 | Tropical Forest Soil | LSPVYPATRPGADGTRINFFLVSAPKANKVLIELYESAPHID |
Ga0208983_10570662 | 3300027381 | Forest Soil | ATRHGADGTRVNFFLVASPDGGKVLIELYELQSRG |
Ga0209116_10799102 | 3300027590 | Forest Soil | AVEPIYPQTRPGADGTRINFFLARTFDGGKVLIELYEK |
Ga0209076_11745521 | 3300027643 | Vadose Zone Soil | ILKENFGVQPIYPQTRAGAGDTRVNFFLVSSPNSAKVLIELYET |
Ga0209073_102851372 | 3300027765 | Agricultural Soil | VREGADGARVNFFLVSAQDGSKLLIELAEEPPARS |
Ga0209448_102697802 | 3300027783 | Bog Forest Soil | EKFGVAAIYPETRPGSDGTRVNFFLVPLPDKGKVLIELYERMATKS |
Ga0209040_102517571 | 3300027824 | Bog Forest Soil | TRPGADGTRVNFFLVSAPGANKVLIELYEPAQRLD |
Ga0209773_104185401 | 3300027829 | Bog Forest Soil | PQTRPGADGTRVNFFLVPAPDAGKVLIELYEVAGVSR |
Ga0209180_101927712 | 3300027846 | Vadose Zone Soil | KFKVASVYPAARAGADGTRVNFFLVASPDGGKVLIELYETQSRG |
Ga0209166_103901521 | 3300027857 | Surface Soil | YPETRNGADGTRVNFFLATTPEHEKVLIELYEKKI |
Ga0209579_100448054 | 3300027869 | Surface Soil | TSIYPEKRPGANHTQVNFFLASAPDSSKVLIELYE |
Ga0209380_100052241 | 3300027889 | Soil | GVAAVYPETRAGADGTRINFFLVVAPGGGKVLIELYERK |
Ga0209583_100595401 | 3300027910 | Watersheds | PIYPQTRAGAGGTRVNFFLVGSPNSDKVLIELYET |
Ga0209583_101263782 | 3300027910 | Watersheds | QTRPGADDTKVNFFLVPQPSSGKVLVELYERGNGV |
Ga0137415_112434022 | 3300028536 | Vadose Zone Soil | VYPAMRHGADGTRVNFFLVVSPDGGKVLIELYESPSRG |
Ga0170823_118731332 | 3300031128 | Forest Soil | EARPGADGTRVNFFLASNADGKKVLIELYQPAAIRFA |
Ga0170824_1059163471 | 3300031231 | Forest Soil | PVYPEGRPGADGTLVNFFLAGAADGKKVLIELYEPGAIRFE |
Ga0318571_102825302 | 3300031549 | Soil | KMAPVYPATRPGADGTRVNFFLVASPDGGKVLIELYQAATKVPS |
Ga0318573_103950941 | 3300031564 | Soil | GLSPVYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHMD |
Ga0318561_102163012 | 3300031679 | Soil | PATRPGADGTRINFFLVAAPKANKVLIELYEPVPHID |
Ga0307474_108355062 | 3300031718 | Hardwood Forest Soil | PETRPGAEGTRVNFFLVPVPGGGKVLIELYEAAAKSHQK |
Ga0307474_112391092 | 3300031718 | Hardwood Forest Soil | ARLGADGTRVNFFLAPTSAGGKVLIELYEIPGNQS |
Ga0307469_100338761 | 3300031720 | Hardwood Forest Soil | KTKFDLSAVYPETRPGADGTRVNFFLVSAPDAAKVLIELYEPAPTLD |
Ga0307469_101377571 | 3300031720 | Hardwood Forest Soil | EKLGITAVYEATRPGADGTRINFFLVTDTEGGKVLVELYEAAITSGD |
Ga0306918_100131951 | 3300031744 | Soil | APVYPATRPGADGTRVNFFLVASPDGGKVLIELYQAATKVPS |
Ga0306918_103860581 | 3300031744 | Soil | FGLSPVYPTTRPGADGTRINFFLVSAPKANKVLIELYEPAPHIE |
Ga0307477_100417571 | 3300031753 | Hardwood Forest Soil | PIYPEKRAGADGTQVNFFLAAGPDGKKVLIELYETAEAQR |
Ga0307477_105117101 | 3300031753 | Hardwood Forest Soil | QASIYPEKRPGANHTQVNFFLASAPDSTKVLIELYE |
Ga0307475_100159301 | 3300031754 | Hardwood Forest Soil | KEHFAVQAIYPQPRAGADNARVNFFLVPSPTSGKVLIELYQPTGDR |
Ga0307475_105121981 | 3300031754 | Hardwood Forest Soil | PETRAGADGTRVNFFLVKSPDGGHVLIELYELPSRA |
Ga0318543_105379992 | 3300031777 | Soil | GLSPIYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHMD |
Ga0318557_102819922 | 3300031795 | Soil | SPIYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID |
Ga0310917_100980901 | 3300031833 | Soil | LSPVYPATRPGADGTRINFFLVAAPKANKVLIELYEPVPHID |
Ga0310916_102115842 | 3300031942 | Soil | LRERFGLSPVYPTTRPGADGTRINFFLVSAPKANKVLIELYEPAPHID |
Ga0307479_115528362 | 3300031962 | Hardwood Forest Soil | APVYPQKRAGADGTQVNFFLTAAPDGSKVLVELYEPAGTKR |
Ga0307479_117278142 | 3300031962 | Hardwood Forest Soil | ETRLGADGTRVNFFLVAGPDGKKVLIELYEPPLIRF |
Ga0307479_118525421 | 3300031962 | Hardwood Forest Soil | AVYPETRAGADRTRVNFFLVTTPDKEKVLIELYEKLKP |
Ga0318531_100304411 | 3300031981 | Soil | IYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID |
Ga0310911_101463702 | 3300032035 | Soil | LSPVYPTTRPGADGTRINFFLVSAPKANKVLIELYEPAPHID |
Ga0318559_101263021 | 3300032039 | Soil | PVYPATRPGADDARVNFFLVSAPKANKVLIELYEPAPHMD |
Ga0307470_118403631 | 3300032174 | Hardwood Forest Soil | ETRPGADGTRVNFFLVSATDSAKVLIELYEPAPRLD |
Ga0307471_1025178642 | 3300032180 | Hardwood Forest Soil | RVPPVYPETRNGADGTRVNFFLVPSPDGGKVLIELYEMQSRG |
Ga0307472_1002487542 | 3300032205 | Hardwood Forest Soil | ETRPGANATRVNFFLMPVADGKKVLIELYEAPVPQP |
Ga0335072_108026682 | 3300032898 | Soil | ILRAKMGVSPVYPATRPGADGTRVNFILVPATDGQKVLIELVEDPAAR |
Ga0335077_107289571 | 3300033158 | Soil | TRPGADGTRVNFYLLSAPGASKVLVELYEPAPHMD |
⦗Top⦘ |