NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F061695

Metagenome Family F061695

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061695
Family Type Metagenome
Number of Sequences 131
Average Sequence Length 40 residues
Representative Sequence YPQTRPGADGTRVNFFLVSAPDAGKVLIELYEPPPRLD
Number of Associated Samples 111
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 94.66 %
% of genes from short scaffolds (< 2000 bps) 80.92 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.229 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.794 % of family members)
Environment Ontology (ENVO) Unclassified
(35.878 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.328 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.55%    β-sheet: 31.82%    Coil/Unstructured: 63.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF06202GDE_C 63.36
PF12439GDE_N 7.63
PF03200Glyco_hydro_63 5.34
PF13561adh_short_C2 3.05
PF00583Acetyltransf_1 3.05
PF00106adh_short 1.53
PF04255DUF433 1.53
PF01850PIN 1.53
PF13506Glyco_transf_21 0.76
PF13365Trypsin_2 0.76
PF07077DUF1345 0.76
PF00171Aldedh 0.76
PF03544TonB_C 0.76
PF01381HTH_3 0.76
PF12697Abhydrolase_6 0.76
PF03938OmpH 0.76
PF00398RrnaAD 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG3408Glycogen debranching enzyme (alpha-1,6-glucosidase)Carbohydrate transport and metabolism [G] 63.36
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 1.53
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.76
COG003016S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)Translation, ribosomal structure and biogenesis [J] 0.76
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.76
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.76
COG2825Periplasmic chaperone for outer membrane proteins, Skp familyCell wall/membrane/envelope biogenesis [M] 0.76
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.76
COG4291Uncharacterized membrane proteinFunction unknown [S] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.23 %
UnclassifiedrootN/A29.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001089|JGI12683J13190_1008078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1055Open in IMG/M
3300002245|JGIcombinedJ26739_101725961Not Available526Open in IMG/M
3300004080|Ga0062385_10388386All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300004092|Ga0062389_101307762All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300004152|Ga0062386_100690213All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005167|Ga0066672_10262666All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300005174|Ga0066680_10316119All Organisms → cellular organisms → Bacteria → Terrabacteria group997Open in IMG/M
3300005179|Ga0066684_10155757All Organisms → cellular organisms → Bacteria → Acidobacteria1452Open in IMG/M
3300005179|Ga0066684_10856694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300005332|Ga0066388_108679533Not Available505Open in IMG/M
3300005541|Ga0070733_10156723All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300005549|Ga0070704_100005225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7556Open in IMG/M
3300005552|Ga0066701_10862741Not Available537Open in IMG/M
3300005591|Ga0070761_10270028All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300005764|Ga0066903_100054154All Organisms → cellular organisms → Bacteria4927Open in IMG/M
3300005764|Ga0066903_102756857Not Available953Open in IMG/M
3300005921|Ga0070766_10085352All Organisms → cellular organisms → Bacteria1844Open in IMG/M
3300005983|Ga0081540_1145603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria943Open in IMG/M
3300006041|Ga0075023_100153930All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300006050|Ga0075028_100905813Not Available543Open in IMG/M
3300006052|Ga0075029_100028916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3138Open in IMG/M
3300006102|Ga0075015_100293940All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300006162|Ga0075030_100934835Not Available683Open in IMG/M
3300007258|Ga0099793_10038435All Organisms → cellular organisms → Bacteria2069Open in IMG/M
3300009088|Ga0099830_10000927All Organisms → cellular organisms → Bacteria → Proteobacteria14147Open in IMG/M
3300009090|Ga0099827_10168741All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300009090|Ga0099827_11228240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria652Open in IMG/M
3300009444|Ga0114945_10900755All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium546Open in IMG/M
3300010048|Ga0126373_11586539All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300010339|Ga0074046_10173529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium1366Open in IMG/M
3300010360|Ga0126372_11714348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300010360|Ga0126372_12958191Not Available527Open in IMG/M
3300010361|Ga0126378_10006025All Organisms → cellular organisms → Bacteria → Proteobacteria9475Open in IMG/M
3300010371|Ga0134125_12060800All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300010376|Ga0126381_100874324All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300010376|Ga0126381_101903237All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300010398|Ga0126383_11898031All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300011271|Ga0137393_10834858All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300012189|Ga0137388_10024839All Organisms → cellular organisms → Bacteria4574Open in IMG/M
3300012203|Ga0137399_10956798All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300012205|Ga0137362_10052261All Organisms → cellular organisms → Bacteria3335Open in IMG/M
3300012207|Ga0137381_11787635Not Available504Open in IMG/M
3300012361|Ga0137360_10571835All Organisms → cellular organisms → Bacteria → Acidobacteria966Open in IMG/M
3300012362|Ga0137361_10927698Not Available789Open in IMG/M
3300012582|Ga0137358_10237299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1242Open in IMG/M
3300012922|Ga0137394_10660639All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300012927|Ga0137416_10286293All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300012930|Ga0137407_10694360All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300012984|Ga0164309_10339762All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300014201|Ga0181537_10388880All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300015053|Ga0137405_1343732Not Available6425Open in IMG/M
3300015371|Ga0132258_10653472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2644Open in IMG/M
3300017822|Ga0187802_10194667Not Available779Open in IMG/M
3300017928|Ga0187806_1088335All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300017932|Ga0187814_10201484Not Available748Open in IMG/M
3300017934|Ga0187803_10432461All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300017994|Ga0187822_10100670All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300018019|Ga0187874_10050800Not Available1925Open in IMG/M
3300020170|Ga0179594_10319504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium SW_9_47_5588Open in IMG/M
3300020579|Ga0210407_10155600All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300020581|Ga0210399_10051029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3323Open in IMG/M
3300020581|Ga0210399_10287894All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300020581|Ga0210399_10572279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria936Open in IMG/M
3300020581|Ga0210399_10833748All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300020581|Ga0210399_10902066All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300020583|Ga0210401_10718638All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300021168|Ga0210406_10450849All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300021170|Ga0210400_10476005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1031Open in IMG/M
3300021420|Ga0210394_10417828All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300021432|Ga0210384_10825906All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514825Open in IMG/M
3300021479|Ga0210410_10689417Not Available903Open in IMG/M
3300021560|Ga0126371_10442157Not Available1445Open in IMG/M
3300021560|Ga0126371_12168920All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300021560|Ga0126371_13020179All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300023075|Ga0224520_1089222Not Available688Open in IMG/M
3300024271|Ga0224564_1033453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria971Open in IMG/M
3300025906|Ga0207699_10717245All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300025922|Ga0207646_11767164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300026310|Ga0209239_1032316All Organisms → cellular organisms → Bacteria2479Open in IMG/M
3300026316|Ga0209155_1224546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300026548|Ga0209161_10311110Not Available746Open in IMG/M
3300026552|Ga0209577_10157347All Organisms → cellular organisms → Bacteria → Acidobacteria1781Open in IMG/M
3300026895|Ga0207758_1006561All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300027381|Ga0208983_1057066Not Available749Open in IMG/M
3300027590|Ga0209116_1079910Not Available716Open in IMG/M
3300027643|Ga0209076_1174552All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300027765|Ga0209073_10285137Not Available651Open in IMG/M
3300027783|Ga0209448_10269780All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300027824|Ga0209040_10251757Not Available885Open in IMG/M
3300027829|Ga0209773_10418540All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300027846|Ga0209180_10192771All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300027857|Ga0209166_10390152Not Available724Open in IMG/M
3300027869|Ga0209579_10044805All Organisms → cellular organisms → Bacteria2369Open in IMG/M
3300027889|Ga0209380_10005224All Organisms → cellular organisms → Bacteria7874Open in IMG/M
3300027910|Ga0209583_10059540All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300027910|Ga0209583_10126378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1018Open in IMG/M
3300028536|Ga0137415_11243402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium SW_9_47_5561Open in IMG/M
3300031128|Ga0170823_11873133Not Available854Open in IMG/M
3300031231|Ga0170824_105916347All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031549|Ga0318571_10282530All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300031564|Ga0318573_10395094All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300031679|Ga0318561_10216301All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300031718|Ga0307474_10835506All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300031718|Ga0307474_11239109All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031720|Ga0307469_10033876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3008Open in IMG/M
3300031744|Ga0306918_10013195All Organisms → cellular organisms → Bacteria4770Open in IMG/M
3300031744|Ga0306918_10386058All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300031753|Ga0307477_10041757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3150Open in IMG/M
3300031753|Ga0307477_10511710Not Available815Open in IMG/M
3300031754|Ga0307475_10015930All Organisms → cellular organisms → Bacteria5157Open in IMG/M
3300031754|Ga0307475_10512198All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300031777|Ga0318543_10537999Not Available523Open in IMG/M
3300031795|Ga0318557_10281992Not Available762Open in IMG/M
3300031833|Ga0310917_10098090Not Available1883Open in IMG/M
3300031942|Ga0310916_10211584All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300031962|Ga0307479_11552836Not Available618Open in IMG/M
3300031962|Ga0307479_11727814All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031962|Ga0307479_11852542Not Available554Open in IMG/M
3300031981|Ga0318531_10030441Not Available2214Open in IMG/M
3300032035|Ga0310911_10146370All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300032039|Ga0318559_10126302All Organisms → cellular organisms → Bacteria → Terrabacteria group1150Open in IMG/M
3300032174|Ga0307470_11840363Not Available513Open in IMG/M
3300032180|Ga0307471_102517864Not Available651Open in IMG/M
3300032205|Ga0307472_100248754Not Available1392Open in IMG/M
3300033158|Ga0335077_10728957All Organisms → cellular organisms → Bacteria1017Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.03%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil10.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.11%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.34%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.58%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.05%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.05%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.53%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.53%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.53%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.76%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.76%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.76%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.76%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001089Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026895Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes)EnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12683J13190_100807823300001089Forest SoilATRHGADGTRVNFFLVASPDGGRVLIELYELQSRG*
JGIcombinedJ26739_10172596113300002245Forest SoilPIYPQTRPGADNTRINFFLARTPDGAKVLIELYEK*
Ga0062385_1038838613300004080Bog Forest SoilGVTPIYPEARPGADGTRVNFFLAPTSAGGKVLIELYEIP*
Ga0062389_10130776213300004092Bog Forest SoilVYPETRPGADGTRVNFFLMPVPGGSKVLIELYESAAKLHQK*
Ga0062386_10069021313300004152Bog Forest SoilIAPVFPATRTGADGTRINFFLVSAPSANKVLIELYEPAPRMD*
Ga0066672_1026266623300005167SoilVAPVYPATRPGADGTRINFFLVVSPDGGKVLIELYESQSGR*
Ga0066680_1031611923300005174SoilVYPETRPGANATRVNFFLMPAADGKKVLIELYEAPARQP*
Ga0066684_1015575733300005179SoilIAPVYPATRPGADGTRVNFFLVASPDGGKVLIELYQPASRAQS*
Ga0066684_1085669423300005179SoilIAPVYPATRPGADGTRVNFFLVASPDGGKVLIELYQPASKAQS*
Ga0066388_10867953313300005332Tropical Forest SoilDRFDLLAVYPETRNGADGTRVNFFLASTPEHQKVLIELYEK*
Ga0070733_1015672313300005541Surface SoilRPGADGTRVNFFLIPSADSGKVLIELYEKTGGNKSH*
Ga0070704_10000522513300005549Corn, Switchgrass And Miscanthus RhizosphereYQETRAGADRTRVNFFLVPVPSGGKILIEFYESNSKDDKK*
Ga0066701_1086274113300005552SoilKRFGVTAVYPETREGADGTRVNFFLVTTPEEEKVLIELYEKKS*
Ga0070761_1027002823300005591SoilPGADGTRVNFFLMPVPGGGKVLIELYESAAKPRQK*
Ga0066903_10005415433300005764Tropical Forest SoilALKPVYPATRSGADETRVNFFLLSAPGANKILIELYEPAQRLE*
Ga0066903_10275685723300005764Tropical Forest SoilPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID*
Ga0070766_1008535213300005921SoilAIYPETRPGADGTRVNFFLVAAPDAAKVLIELYEPAPRLD*
Ga0081540_114560313300005983Tabebuia Heterophylla RhizosphereESIYSKKRTGADGAQVNFFLVPGADGKKVLIELYEAPAIRF*
Ga0075023_10015393013300006041WatershedsQTRPGADDTKVNFFLVPQPSSGKVLVELYERGNGV*
Ga0075028_10090581323300006050WatershedsSVYPETRAGADGTRVNFFLIKSPDGGKVLIELYELPSRG*
Ga0075029_10002891643300006052WatershedsVYPETRAGADGTRVNFFLAKSPDGGKALIELYELPSRS*
Ga0075015_10029394023300006102WatershedsTRAGADGTRVNFFLIKSPDGGKVLIELYELPSRG*
Ga0075030_10093483513300006162WatershedsKFNLPAVYPATRPGADGTRVNFFLVSAPDAGKVLIELYEPAPRLD*
Ga0066659_1002440313300006797SoilQILKDKFGVVPVYPATRPGADGTRINFFLVVSPDGGKVLIELYESQSGR*
Ga0099793_1003843513300007258Vadose Zone SoilENFGVQPIYPQTRAGAGDTRVNFFLVSSPNSAKVLIELYET*
Ga0099830_1000092793300009088Vadose Zone SoilIYPEARPGADGTRVNFFLADSADGEKVLIELYELAAIRLE*
Ga0099827_1016874123300009090Vadose Zone SoilYPATRPGADGTRVQFFLVPSPGTGKVLIELYESPAATQA*
Ga0099827_1122824013300009090Vadose Zone SoilDKFGVTSVYPATRHGSDGTRVNFFLVTSPDGGKVLIELYELQSRG*
Ga0114945_1090075513300009444Thermal SpringsPGAGGTRVNFFLVALPEGGKVLIELFEPAPRKPD*
Ga0126373_1041362113300010048Tropical Forest SoilGKFKVGSIYPATRAGADGTRVNFFLVASPDGGKVLVELYELKPHA*
Ga0126373_1158653913300010048Tropical Forest SoilATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID*
Ga0074046_1017352913300010339Bog Forest SoilTRTGADGTRVNFFLVSAPGASKVLIELYEPAPRMD*
Ga0126372_1171434813300010360Tropical Forest SoilDKFGIRAVYPQTRPGADGTRVNFFLLSLPRTSKVLVELYQRLEGLG*
Ga0126372_1295819123300010360Tropical Forest SoilKPVYPATRSGADETRVNFFLLSAPGANKILIELYEPAQRLE*
Ga0126378_1000602593300010361Tropical Forest SoilLQERFKIAPVYTETRPGADGTRVNFFLVASPDGGRVLIELYEAASKAPS*
Ga0134125_1206080013300010371Terrestrial SoilIYAQTRRGADNTRVNFFLVPSPVSGKVLIELFELPRSH*
Ga0126381_10087432413300010376Tropical Forest SoilVYAAKRPGADGTAVNFFLVAGRDGKKVLIELYETAG*
Ga0126381_10190323723300010376Tropical Forest SoilYPQTRPGADGTRVNFFLVSAPDAGKVLIELYEPPPRLD*
Ga0126383_1189803123300010398Tropical Forest SoilRPGADGARVNFFLVSAPKANKVLIELYEPAPHID*
Ga0137393_1083485823300011271Vadose Zone SoilKEKFQIQSIYPQTRPGADNTWVNFFLVSLPAGGKVLIELYQRNVSR*
Ga0137388_1002483933300012189Vadose Zone SoilVYAAARAGADGTRVNFFLVDAPGAGKVLIELYEEAARME*
Ga0137399_1095679813300012203Vadose Zone SoilAIYPETRPGADGARVNFFLVSATDSAKVLIELYEAAPRLD*
Ga0137362_1005226153300012205Vadose Zone SoilAVYPETRPGADGTRVNFFLVSATDSAKVLIELYEPAPRLD*
Ga0137381_1178763523300012207Vadose Zone SoilPVYPAIRNGTDATRVNFFLVASPDGGKVLIELYELQSRG*
Ga0137384_1035793113300012357Vadose Zone SoilLKDKFGVAPVYPATRPGADGTRINFFLVVSPDGGKVLIELYESQSGT*
Ga0137360_1057183513300012361Vadose Zone SoilYPATRAGADGTRVNFFLVASPDGGKVLIELYETQSRG*
Ga0137361_1092769823300012362Vadose Zone SoilREARPGADGTRVNFFLAGTADGKKVLIELYEPAAIRFE*
Ga0137358_1023729923300012582Vadose Zone SoilYPETRPGANATRVNFFLMPGADGKKVLIELYEAGALPP*
Ga0137394_1066063913300012922Vadose Zone SoilEKFRVAPVYSETRNGADGTRVNFFLVPSPDGGKVLIELYEMQSRG*
Ga0137416_1028629323300012927Vadose Zone SoilVYPAMRHGADGTRVNFFLVVSPDGGKVLIELYESPSRG*
Ga0137407_1069436013300012930Vadose Zone SoilFNVSAVYPETRPGADGTRVNFFLVSATDSAKVLIELYEAAPRLD*
Ga0164309_1033976213300012984SoilPSIQPGADGTRINFFLVAGADGKKVLVELYEPELPG*
Ga0181537_1038888023300014201BogAVEPIYPQTRPGADNTRINFFLARTSDGAKVLIELYEK*
Ga0137405_1343732103300015053Vadose Zone SoilMSDSEVTAIYPETRAGADGTRVNFFLVTTHDNEKVLIELYEKRA*
Ga0132258_1065347213300015371Arabidopsis RhizosphereHSRPGADGTRINFFLVAASGGGKILIELYEAPKS*
Ga0187802_1019466723300017822Freshwater SedimentTRPGADGTRINFFLLSAPSANKVLIELYEPAPRLD
Ga0187806_108833513300017928Freshwater SedimentFSLQPIYPATRPGADGTRVNFFLLSAPGASKVLIELYEPAPRLD
Ga0187814_1020148423300017932Freshwater SedimentPIYPATRPGADGTRVNFFLLSAPDANKVLIELYEPAPRLD
Ga0187803_1043246113300017934Freshwater SedimentPVFPATRTGADGTRINFFLVSAPSASKVLIELYEPAPRID
Ga0187822_1010067033300017994Freshwater SedimentGQASIYPEKRPGANHTQVNFFLASAPDSSKVLIELYE
Ga0187874_1005080023300018019PeatlandGIAPAYPATRAGADGTRINFFLVSAPIASKVLIELYEPAPRLD
Ga0066669_1045763913300018482Grasslands SoilILKDKFGVAPVYPASRPGADGTRINFFLVVSPDGGKVLIELYESPSSR
Ga0179594_1031950423300020170Vadose Zone SoilKFKVASIYPATRAGADGTRVNFFLVASPDGGKVLIELYEAQSRG
Ga0210407_1015560023300020579SoilLKPVYPATRPGADETRVNFFLLSAPGANKVLIELYEPAQRLE
Ga0210399_1005102913300020581SoilQAVYPDTRQGADGTRVNFFLVPAPDAGKVLIELYEPAPRLD
Ga0210399_1028789423300020581SoilPDTRAGADGTRVNFFLVKSPDGGKVLIELYELPSRA
Ga0210399_1057227913300020581SoilRPGADGTRVNFFLVSTPGAGKVLIELYELPSAAQTPTKK
Ga0210399_1083374813300020581SoilATRPGADGTRVNFFLVSTPGVGKVLIELYELPPGAPRT
Ga0210399_1090206613300020581SoilYPGTRPGADGARVNFFLVAAPGVNKVLIELYEHVPNLE
Ga0210401_1071863823300020583SoilIYPEARPGADGTRVNFFLAPTSAGGKVLIELYEIPANQS
Ga0210406_1045084923300021168SoilAFGVQAVYPQTRPGANNTRVNFFLIPSPKSGRVLIELYEL
Ga0210400_1047600513300021170SoilIYPETRAGADNTRVNFFLVPSPVSGKVLIELYQRDGGV
Ga0210394_1041782823300021420SoilVYPETRAGSDGTRINFFLAVAPGGGKVLIELYERK
Ga0210384_1082590613300021432SoilFAITSVYPATRPGADGTRVNFFLVSTPDSGKVLIEFYEPAARPS
Ga0210410_1068941723300021479SoilFSVQPIYPQTRPGAGDTRVNFFLVPSSNSGKILIELYET
Ga0126371_1044215713300021560Tropical Forest SoilRFGLSPVYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID
Ga0126371_1216892023300021560Tropical Forest SoilYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID
Ga0126371_1302017923300021560Tropical Forest SoilYPEARPGADGTRVNFFLLASPDGGKVLVELYEAKSGG
Ga0224520_108922223300023075SoilFGIAPVFPATRTGADGTRINFFLVSAPGASKVLIELYEPAPRID
Ga0224564_103345333300024271SoilVAAVYPETRAGTDGTRINFFLVVAPGGGKVLIELYERK
Ga0207699_1071724513300025906Corn, Switchgrass And Miscanthus RhizosphereAHPGADGTRVNFFLTSNADGKKVLIELYEPAAIRFE
Ga0207646_1176716413300025922Corn, Switchgrass And Miscanthus RhizosphereVYPATRPGADGTRVNFFLVVSPDGGKVLIELYQATSKAPS
Ga0209239_103231633300026310Grasslands SoilQFKIAPVYPATRPGADGTRVNFFLVASPDGGKVLIELYQPASKAQS
Ga0209155_122454613300026316SoilRPGADGTRVNFFLVASPDGGKVLIELYQPASRAQS
Ga0209161_1031111013300026548SoilGILAVYPETRPGANATRVNFFLMPAADGKKVLIELYEAPAPQP
Ga0209577_1015734713300026552SoilVYPATRPGADGTRVNFFLVASPDGGKVLIELYQTASKA
Ga0207758_100656123300026895Tropical Forest SoilLSPVYPATRPGADGTRINFFLVSAPKANKVLIELYESAPHID
Ga0208983_105706623300027381Forest SoilATRHGADGTRVNFFLVASPDGGKVLIELYELQSRG
Ga0209116_107991023300027590Forest SoilAVEPIYPQTRPGADGTRINFFLARTFDGGKVLIELYEK
Ga0209076_117455213300027643Vadose Zone SoilILKENFGVQPIYPQTRAGAGDTRVNFFLVSSPNSAKVLIELYET
Ga0209073_1028513723300027765Agricultural SoilVREGADGARVNFFLVSAQDGSKLLIELAEEPPARS
Ga0209448_1026978023300027783Bog Forest SoilEKFGVAAIYPETRPGSDGTRVNFFLVPLPDKGKVLIELYERMATKS
Ga0209040_1025175713300027824Bog Forest SoilTRPGADGTRVNFFLVSAPGANKVLIELYEPAQRLD
Ga0209773_1041854013300027829Bog Forest SoilPQTRPGADGTRVNFFLVPAPDAGKVLIELYEVAGVSR
Ga0209180_1019277123300027846Vadose Zone SoilKFKVASVYPAARAGADGTRVNFFLVASPDGGKVLIELYETQSRG
Ga0209166_1039015213300027857Surface SoilYPETRNGADGTRVNFFLATTPEHEKVLIELYEKKI
Ga0209579_1004480543300027869Surface SoilTSIYPEKRPGANHTQVNFFLASAPDSSKVLIELYE
Ga0209380_1000522413300027889SoilGVAAVYPETRAGADGTRINFFLVVAPGGGKVLIELYERK
Ga0209583_1005954013300027910WatershedsPIYPQTRAGAGGTRVNFFLVGSPNSDKVLIELYET
Ga0209583_1012637823300027910WatershedsQTRPGADDTKVNFFLVPQPSSGKVLVELYERGNGV
Ga0137415_1124340223300028536Vadose Zone SoilVYPAMRHGADGTRVNFFLVVSPDGGKVLIELYESPSRG
Ga0170823_1187313323300031128Forest SoilEARPGADGTRVNFFLASNADGKKVLIELYQPAAIRFA
Ga0170824_10591634713300031231Forest SoilPVYPEGRPGADGTLVNFFLAGAADGKKVLIELYEPGAIRFE
Ga0318571_1028253023300031549SoilKMAPVYPATRPGADGTRVNFFLVASPDGGKVLIELYQAATKVPS
Ga0318573_1039509413300031564SoilGLSPVYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHMD
Ga0318561_1021630123300031679SoilPATRPGADGTRINFFLVAAPKANKVLIELYEPVPHID
Ga0307474_1083550623300031718Hardwood Forest SoilPETRPGAEGTRVNFFLVPVPGGGKVLIELYEAAAKSHQK
Ga0307474_1123910923300031718Hardwood Forest SoilARLGADGTRVNFFLAPTSAGGKVLIELYEIPGNQS
Ga0307469_1003387613300031720Hardwood Forest SoilKTKFDLSAVYPETRPGADGTRVNFFLVSAPDAAKVLIELYEPAPTLD
Ga0307469_1013775713300031720Hardwood Forest SoilEKLGITAVYEATRPGADGTRINFFLVTDTEGGKVLVELYEAAITSGD
Ga0306918_1001319513300031744SoilAPVYPATRPGADGTRVNFFLVASPDGGKVLIELYQAATKVPS
Ga0306918_1038605813300031744SoilFGLSPVYPTTRPGADGTRINFFLVSAPKANKVLIELYEPAPHIE
Ga0307477_1004175713300031753Hardwood Forest SoilPIYPEKRAGADGTQVNFFLAAGPDGKKVLIELYETAEAQR
Ga0307477_1051171013300031753Hardwood Forest SoilQASIYPEKRPGANHTQVNFFLASAPDSTKVLIELYE
Ga0307475_1001593013300031754Hardwood Forest SoilKEHFAVQAIYPQPRAGADNARVNFFLVPSPTSGKVLIELYQPTGDR
Ga0307475_1051219813300031754Hardwood Forest SoilPETRAGADGTRVNFFLVKSPDGGHVLIELYELPSRA
Ga0318543_1053799923300031777SoilGLSPIYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHMD
Ga0318557_1028199223300031795SoilSPIYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID
Ga0310917_1009809013300031833SoilLSPVYPATRPGADGTRINFFLVAAPKANKVLIELYEPVPHID
Ga0310916_1021158423300031942SoilLRERFGLSPVYPTTRPGADGTRINFFLVSAPKANKVLIELYEPAPHID
Ga0307479_1155283623300031962Hardwood Forest SoilAPVYPQKRAGADGTQVNFFLTAAPDGSKVLVELYEPAGTKR
Ga0307479_1172781423300031962Hardwood Forest SoilETRLGADGTRVNFFLVAGPDGKKVLIELYEPPLIRF
Ga0307479_1185254213300031962Hardwood Forest SoilAVYPETRAGADRTRVNFFLVTTPDKEKVLIELYEKLKP
Ga0318531_1003044113300031981SoilIYPATRPGADGARVNFFLVSAPKANKVLIELYEPAPHID
Ga0310911_1014637023300032035SoilLSPVYPTTRPGADGTRINFFLVSAPKANKVLIELYEPAPHID
Ga0318559_1012630213300032039SoilPVYPATRPGADDARVNFFLVSAPKANKVLIELYEPAPHMD
Ga0307470_1184036313300032174Hardwood Forest SoilETRPGADGTRVNFFLVSATDSAKVLIELYEPAPRLD
Ga0307471_10251786423300032180Hardwood Forest SoilRVPPVYPETRNGADGTRVNFFLVPSPDGGKVLIELYEMQSRG
Ga0307472_10024875423300032205Hardwood Forest SoilETRPGANATRVNFFLMPVADGKKVLIELYEAPVPQP
Ga0335072_1080266823300032898SoilILRAKMGVSPVYPATRPGADGTRVNFILVPATDGQKVLIELVEDPAAR
Ga0335077_1072895713300033158SoilTRPGADGTRVNFYLLSAPGASKVLVELYEPAPHMD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.