Basic Information | |
---|---|
Family ID | F061359 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 49 residues |
Representative Sequence | ALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.52 % |
% of genes near scaffold ends (potentially truncated) | 96.97 % |
% of genes from short scaffolds (< 2000 bps) | 93.94 % |
Associated GOLD sequencing projects | 123 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.848 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.121 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.606 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.76% β-sheet: 0.00% Coil/Unstructured: 93.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF13714 | PEP_mutase | 62.12 |
PF01613 | Flavin_Reduct | 16.67 |
PF13343 | SBP_bac_6 | 4.55 |
PF09084 | NMT1 | 3.03 |
PF02538 | Hydantoinase_B | 1.52 |
PF01402 | RHH_1 | 0.76 |
PF07883 | Cupin_2 | 0.76 |
PF01106 | NifU | 0.76 |
PF00903 | Glyoxalase | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 16.67 |
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 3.03 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 3.03 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 3.03 |
COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459019|G14TP7Y02G8PR6 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 728 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0818286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1817 | Open in IMG/M |
3300000890|JGI11643J12802_12353857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1021 | Open in IMG/M |
3300000891|JGI10214J12806_11652538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
3300001431|F14TB_104665342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
3300003995|Ga0055438_10074912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 919 | Open in IMG/M |
3300004051|Ga0055492_10165316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
3300004463|Ga0063356_100646426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1441 | Open in IMG/M |
3300004463|Ga0063356_102129480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 852 | Open in IMG/M |
3300004479|Ga0062595_100781899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 783 | Open in IMG/M |
3300004633|Ga0066395_10023056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2501 | Open in IMG/M |
3300005178|Ga0066688_10347349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 960 | Open in IMG/M |
3300005294|Ga0065705_10734586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
3300005295|Ga0065707_10847496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
3300005331|Ga0070670_101573284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
3300005336|Ga0070680_101506445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
3300005337|Ga0070682_100137737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1660 | Open in IMG/M |
3300005444|Ga0070694_101312727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
3300005450|Ga0066682_10689573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
3300005467|Ga0070706_100108274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2586 | Open in IMG/M |
3300005471|Ga0070698_101430318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
3300005518|Ga0070699_101571116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
3300005526|Ga0073909_10090393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1192 | Open in IMG/M |
3300005530|Ga0070679_100824343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 871 | Open in IMG/M |
3300005545|Ga0070695_101265646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
3300005564|Ga0070664_101837431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
3300005718|Ga0068866_10645548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
3300005764|Ga0066903_103419103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 856 | Open in IMG/M |
3300005842|Ga0068858_100940896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 846 | Open in IMG/M |
3300005844|Ga0068862_102619004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300006844|Ga0075428_100305795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1709 | Open in IMG/M |
3300006865|Ga0073934_10103913 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
3300006865|Ga0073934_10347798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 929 | Open in IMG/M |
3300006880|Ga0075429_101728541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
3300006881|Ga0068865_100694066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 869 | Open in IMG/M |
3300006914|Ga0075436_100113950 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300006969|Ga0075419_10152443 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
3300009087|Ga0105107_10682289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 715 | Open in IMG/M |
3300009100|Ga0075418_11140761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
3300009147|Ga0114129_11671539 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300009174|Ga0105241_11221177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
3300010046|Ga0126384_10773114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 857 | Open in IMG/M |
3300010047|Ga0126382_10028969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3008 | Open in IMG/M |
3300010047|Ga0126382_11281797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
3300010166|Ga0126306_11255301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
3300010320|Ga0134109_10088241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1068 | Open in IMG/M |
3300010323|Ga0134086_10482102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
3300010361|Ga0126378_10244032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1888 | Open in IMG/M |
3300010362|Ga0126377_13412357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
3300010366|Ga0126379_10220627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1841 | Open in IMG/M |
3300010376|Ga0126381_101854933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 870 | Open in IMG/M |
3300010399|Ga0134127_10447511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1290 | Open in IMG/M |
3300010401|Ga0134121_12830772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300011405|Ga0137340_1080396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
3300011432|Ga0137428_1011271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2295 | Open in IMG/M |
3300011440|Ga0137433_1122105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 826 | Open in IMG/M |
3300012038|Ga0137431_1008475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2850 | Open in IMG/M |
3300012129|Ga0137345_1033308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
3300012203|Ga0137399_10132340 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
3300012209|Ga0137379_11546949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
3300012355|Ga0137369_10397728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 994 | Open in IMG/M |
3300012360|Ga0137375_11252148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
3300012515|Ga0157338_1003587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1297 | Open in IMG/M |
3300012519|Ga0157352_1050174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
3300012898|Ga0157293_10275308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
3300012911|Ga0157301_10370423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
3300012929|Ga0137404_10326965 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300012930|Ga0137407_11139470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 740 | Open in IMG/M |
3300012948|Ga0126375_11462859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
3300012971|Ga0126369_10355610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1488 | Open in IMG/M |
3300012976|Ga0134076_10082500 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300013100|Ga0157373_10082656 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
3300013105|Ga0157369_10229225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1942 | Open in IMG/M |
3300014861|Ga0180061_1086202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
3300014870|Ga0180080_1002895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1746 | Open in IMG/M |
3300014877|Ga0180074_1101655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
3300014879|Ga0180062_1067973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 782 | Open in IMG/M |
3300014881|Ga0180094_1070250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 773 | Open in IMG/M |
3300014884|Ga0180104_1082270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 899 | Open in IMG/M |
3300015262|Ga0182007_10376598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
3300015373|Ga0132257_102000329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 747 | Open in IMG/M |
3300015374|Ga0132255_103184935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
3300016319|Ga0182033_11695562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
3300016371|Ga0182034_11099519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 689 | Open in IMG/M |
3300016422|Ga0182039_10494268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1055 | Open in IMG/M |
3300018000|Ga0184604_10062539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1063 | Open in IMG/M |
3300018028|Ga0184608_10255360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 771 | Open in IMG/M |
3300018056|Ga0184623_10490078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300018061|Ga0184619_10539816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
3300018075|Ga0184632_10077152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1454 | Open in IMG/M |
3300018079|Ga0184627_10606012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300018429|Ga0190272_10937084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 818 | Open in IMG/M |
3300018920|Ga0190273_12007750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
3300019878|Ga0193715_1095234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
3300020195|Ga0163150_10449627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
3300021081|Ga0210379_10166377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 942 | Open in IMG/M |
3300021344|Ga0193719_10335065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
3300024241|Ga0233392_1015575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 752 | Open in IMG/M |
3300025310|Ga0209172_10237956 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300025324|Ga0209640_10524429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 963 | Open in IMG/M |
3300025549|Ga0210094_1112992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
3300025908|Ga0207643_10943792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
3300025931|Ga0207644_10192726 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300025932|Ga0207690_11760503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300026116|Ga0207674_10316965 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300026297|Ga0209237_1237138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
3300026325|Ga0209152_10227390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
3300026523|Ga0209808_1155333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 869 | Open in IMG/M |
3300027577|Ga0209874_1118605 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300027765|Ga0209073_10172800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 809 | Open in IMG/M |
3300027765|Ga0209073_10241274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
3300027840|Ga0209683_10004282 | All Organisms → cellular organisms → Bacteria | 5490 | Open in IMG/M |
3300027862|Ga0209701_10413104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
3300027880|Ga0209481_10293170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 824 | Open in IMG/M |
3300027961|Ga0209853_1066638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 964 | Open in IMG/M |
3300028379|Ga0268266_10452134 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
3300028803|Ga0307281_10320581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
3300028807|Ga0307305_10326574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
3300031114|Ga0308187_10296709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 605 | Open in IMG/M |
3300031170|Ga0307498_10173653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
3300031538|Ga0310888_10204271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1088 | Open in IMG/M |
3300031573|Ga0310915_10557727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 813 | Open in IMG/M |
3300031716|Ga0310813_10539433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1024 | Open in IMG/M |
3300031740|Ga0307468_100730101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 833 | Open in IMG/M |
3300032180|Ga0307471_100561897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1296 | Open in IMG/M |
3300032770|Ga0335085_10847572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1001 | Open in IMG/M |
3300032770|Ga0335085_11557048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 686 | Open in IMG/M |
3300032828|Ga0335080_11211648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 758 | Open in IMG/M |
3300033158|Ga0335077_10922195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 878 | Open in IMG/M |
3300033412|Ga0310810_10885790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 787 | Open in IMG/M |
3300033475|Ga0310811_10314923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1788 | Open in IMG/M |
3300033551|Ga0247830_11327993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.85% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.30% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.30% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.79% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.03% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.27% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 2.27% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.27% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.27% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.52% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.52% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.76% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.76% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.76% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.76% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.76% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.76% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
3300012129 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300024241 | Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4MG_04913760 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | VALAHLEKLGVENGDRGAAKERTGTEGGTYMDDPAGYVIQFITDGME |
ICChiseqgaiiDRAFT_08182864 | 3300000033 | Soil | LDTLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME* |
JGI11643J12802_123538573 | 3300000890 | Soil | GIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITAGME* |
JGI10214J12806_116525382 | 3300000891 | Soil | NGDRGAAKERTGEQGGTYMDDPAGYVIQFITAGME* |
F14TB_1046653422 | 3300001431 | Soil | YVPTAKWTEAIDQLAKLGIENGDRGAAKEPXXXXXXXXMDDPAGYVIQFITDGME* |
Ga0055438_100749122 | 3300003995 | Natural And Restored Wetlands | VPGPHIAFYVPAAKWSLAIAHLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME* |
Ga0055492_101653162 | 3300004051 | Natural And Restored Wetlands | AKWTKAIEHLANLGIENGDRGAAKEPSPDRGGTYMDDPAGYVIQFITDGME* |
Ga0063356_1006464261 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LARLGVENADRGAAKERIGEHGGTYMDDPAGYVIQFITDGME* |
Ga0063356_1021294801 | 3300004463 | Arabidopsis Thaliana Rhizosphere | FYIPGAKWPAAIEHLDKLGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITAGME* |
Ga0062595_1007818992 | 3300004479 | Soil | KVPGPHIAFYVPGDRWRNAIAHLDALGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME* |
Ga0066395_100230561 | 3300004633 | Tropical Forest Soil | HIAFYVPATNWSSALAHLDALGIAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME* |
Ga0066688_103473492 | 3300005178 | Soil | PHIAFYVPAGQWSTAMAHLDALGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME |
Ga0065705_107345862 | 3300005294 | Switchgrass Rhizosphere | AHLDALGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME* |
Ga0065707_108474962 | 3300005295 | Switchgrass Rhizosphere | HLEKLGIENADRGAAKERVDGHGGTYMDDPAGYVIQFITDGME* |
Ga0070670_1015732842 | 3300005331 | Switchgrass Rhizosphere | WRNAIAHLDALGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME* |
Ga0070680_1015064452 | 3300005336 | Corn Rhizosphere | WNAALAQLEQLGIANGDRGAAKERHAGQGGTYMDDPAGYVIQYITDGME* |
Ga0070682_1001377371 | 3300005337 | Corn Rhizosphere | PHIAFYVPGDRWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME |
Ga0070694_1013127271 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KVPGPHIAFYVPGANWTAAIAHLDKLGIENGDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME* |
Ga0066682_106895732 | 3300005450 | Soil | LSQLEQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME* |
Ga0070706_1001082744 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KVPGPHIAFYVPAAKWSLALLQLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME* |
Ga0070698_1014303182 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SLAIAHLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME* |
Ga0070699_1015711161 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FYVPATKWSLAIAHLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME* |
Ga0073909_100903933 | 3300005526 | Surface Soil | IAHLDALGIPHGDRGTAKERHEGQGGTYMDDPAGYVIQLITDGME* |
Ga0070679_1008243432 | 3300005530 | Corn Rhizosphere | WNAALAQLEQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME* |
Ga0070695_1012656462 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GANWKAALAHLEKLGVENGDRGAAKERTGTEGGTYMDDPAGYVIQFITDGME* |
Ga0070664_1018374311 | 3300005564 | Corn Rhizosphere | GIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME* |
Ga0068866_106455482 | 3300005718 | Miscanthus Rhizosphere | VPAANWSAALSRLEQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME* |
Ga0066903_1034191031 | 3300005764 | Tropical Forest Soil | GIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME* |
Ga0068858_1009408961 | 3300005842 | Switchgrass Rhizosphere | DRWRDALAHLDTLRIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME* |
Ga0068862_1026190041 | 3300005844 | Switchgrass Rhizosphere | GIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME* |
Ga0075428_1003057951 | 3300006844 | Populus Rhizosphere | PGPHIAFYVPAADWSSALAHLDALGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITAGME* |
Ga0073934_101039134 | 3300006865 | Hot Spring Sediment | WSAALAHLRELGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME* |
Ga0073934_103477981 | 3300006865 | Hot Spring Sediment | PAERWREALAHLEELGIPNGDRGAAKVRRPGEGGTYMDDPAGYVVQYITDGME* |
Ga0075429_1017285411 | 3300006880 | Populus Rhizosphere | RKVPGPHIAFYVPATKWGGALAHLDNLQIANGDRGAAKERHDGQGGTYMDDPAGYVIQFISDGME* |
Ga0068865_1006940662 | 3300006881 | Miscanthus Rhizosphere | FYVPGDRWRDALAHLDTLRIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME* |
Ga0075436_1001139504 | 3300006914 | Populus Rhizosphere | IANGDRGAAKERRDGQGGTYMDDPAGYVIQFITDGME* |
Ga0075419_101524434 | 3300006969 | Populus Rhizosphere | FYIEAHDWERALKHLEQLGIPNADRGAAKEPRPGRGGTYMDDPAGNVIQFITEGME* |
Ga0105107_106822891 | 3300009087 | Freshwater Sediment | KCNGLNVRRRQRGAAKELSADRGGIYIDDPAGYVIQFITDGME* |
Ga0075418_111407612 | 3300009100 | Populus Rhizosphere | AFYVPGDRWRDALAHLDTLRIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME* |
Ga0114129_116715391 | 3300009147 | Populus Rhizosphere | ADRGAAKEPRPGRGGTYMDDPAGNVIQFITEGME* |
Ga0105241_112211772 | 3300009174 | Corn Rhizosphere | KWPAALAHLDALGVPHGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME* |
Ga0126384_107731141 | 3300010046 | Tropical Forest Soil | LGIAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME* |
Ga0126382_100289693 | 3300010047 | Tropical Forest Soil | HLENLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME* |
Ga0126382_112817972 | 3300010047 | Tropical Forest Soil | AALAHLDKLNITNGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME* |
Ga0126306_112553011 | 3300010166 | Serpentine Soil | GDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME* |
Ga0134109_100882411 | 3300010320 | Grasslands Soil | TKWNTALAHLEKLGIPNGDRGAAKERQAGQGGTYMDDPAGYVIQFITDGME* |
Ga0134086_104821021 | 3300010323 | Grasslands Soil | LGIPNGDRGAAKERQAGQGGTYQGGTYMDDPAGYVIQFITDGME* |
Ga0126378_102440321 | 3300010361 | Tropical Forest Soil | LENLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME* |
Ga0126377_134123571 | 3300010362 | Tropical Forest Soil | ANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME* |
Ga0126379_102206271 | 3300010366 | Tropical Forest Soil | VPATKWSLALAHLENLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME* |
Ga0126381_1018549331 | 3300010376 | Tropical Forest Soil | ATKWSLALAHLENLGIENGDRGAAKERIEGQGGTYMDDPAGYVIQFITDGME* |
Ga0134127_104475111 | 3300010399 | Terrestrial Soil | IAFYVPGAKWSAALAYLEELGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME* |
Ga0134121_128307722 | 3300010401 | Terrestrial Soil | AIELLANLGIENGDRGAAKEPNADRGGTYMDDPAGYVIQFITDGME* |
Ga0137340_10803962 | 3300011405 | Soil | PGPHIAFYVPAAKWNAAVAHLEELKIPNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME* |
Ga0137428_10112714 | 3300011432 | Soil | PNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME* |
Ga0137433_11221052 | 3300011440 | Soil | IAFYVPAAKWNAAVAHLEELKIPNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME* |
Ga0137431_10084751 | 3300012038 | Soil | LEELKIPNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME* |
Ga0137345_10333081 | 3300012129 | Soil | KLGIENGDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME* |
Ga0137399_101323404 | 3300012203 | Vadose Zone Soil | ASWSAAIARLEQLEIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME* |
Ga0137379_115469492 | 3300012209 | Vadose Zone Soil | ATKWSAALKRLDQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME* |
Ga0137369_103977281 | 3300012355 | Vadose Zone Soil | LDKLQIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME* |
Ga0137375_112521482 | 3300012360 | Vadose Zone Soil | VPAASWSAAMARLEQLEIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME* |
Ga0157338_10035873 | 3300012515 | Arabidopsis Rhizosphere | AFYVPGDRWRDALAHLDTLGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME* |
Ga0157352_10501742 | 3300012519 | Unplanted Soil | ALSQLEQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME* |
Ga0157293_102753082 | 3300012898 | Soil | GDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME* |
Ga0157301_103704231 | 3300012911 | Soil | KVPGPHIAFYVPGDRWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME* |
Ga0137404_103269653 | 3300012929 | Vadose Zone Soil | IVNGDRGAAKERRDGQGGTYMDDPAGYVIQFITDGME* |
Ga0137407_111394702 | 3300012930 | Vadose Zone Soil | NGDRGAAKERHDGQGGTYMDGPAGYVIQYITGGME* |
Ga0126375_114628591 | 3300012948 | Tropical Forest Soil | LDALGIAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME* |
Ga0126369_103556101 | 3300012971 | Tropical Forest Soil | IAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME* |
Ga0134076_100825001 | 3300012976 | Grasslands Soil | KWSAALKRLDQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME* |
Ga0157373_100826564 | 3300013100 | Corn Rhizosphere | PGDRWRDALAHLEALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME* |
Ga0157369_102292251 | 3300013105 | Corn Rhizosphere | GPHIAFYVPGDRWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME* |
Ga0180061_10862021 | 3300014861 | Soil | EAIEQLAELGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME* |
Ga0180080_10028951 | 3300014870 | Soil | ENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME* |
Ga0180074_11016552 | 3300014877 | Soil | LGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME* |
Ga0180062_10679732 | 3300014879 | Soil | PAAKWNAAVAHLEELKIPNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME* |
Ga0180094_10702501 | 3300014881 | Soil | PGPHIAFFVPGAKWSAALAHLNELKVENGDRGAAKERTDGQGGTYMDDPAGYVIQFITDGIE* |
Ga0180104_10822702 | 3300014884 | Soil | ELGIENGDRGAAKERTDGQGGTYMDDPAGYVIQFITDGME* |
Ga0182007_103765981 | 3300015262 | Rhizosphere | RWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME* |
Ga0132257_1020003292 | 3300015373 | Arabidopsis Rhizosphere | GSKWNAALAQLQTLGIENGDRGAAKERTGDQGGTYMDDPAGYVIQYITDGME* |
Ga0132255_1031849352 | 3300015374 | Arabidopsis Rhizosphere | DALAHLDTLGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME* |
Ga0182033_116955621 | 3300016319 | Soil | HIAFYIPGERWREAIAHLDNLGIPHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME |
Ga0182034_110995191 | 3300016371 | Soil | KLKIANGDRGAAKERQQGQGGTYMDDPAGYVIQFITDGME |
Ga0182039_104942682 | 3300016422 | Soil | VPAARWNEGIAQLDKLKIANGDRGAAKERQQGQGGTYMDDPAGYVIQFITDGME |
Ga0184604_100625392 | 3300018000 | Groundwater Sediment | AALAYLEELGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME |
Ga0184608_102553601 | 3300018028 | Groundwater Sediment | ASWPVAIAHLDKLGIENGDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME |
Ga0184623_104900781 | 3300018056 | Groundwater Sediment | PHIAFYIPAPKWSAATAHLDELKIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME |
Ga0184619_105398161 | 3300018061 | Groundwater Sediment | FYVPAGNWTAALAHLDSLGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME |
Ga0184632_100771523 | 3300018075 | Groundwater Sediment | IAFYIPAAKWRAAMAHLDDLKIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME |
Ga0184627_106060121 | 3300018079 | Groundwater Sediment | GANWTAAIAHLDKLGIENGDRGAAKERVDGQGGTYMDDPAGYVIQFITDGME |
Ga0190272_109370841 | 3300018429 | Soil | LDQLGIENGDRGAAKERTGEQGGTYMDDPAGYVIQ |
Ga0190273_120077501 | 3300018920 | Soil | IANGDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME |
Ga0193715_10952342 | 3300019878 | Soil | PGPHIAFYVPAEKWSAALAHLDQIGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME |
Ga0163150_104496272 | 3300020195 | Freshwater Microbial Mat | HIAFYVPTAKWPEAIEQLAKLGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME |
Ga0210379_101663771 | 3300021081 | Groundwater Sediment | GPGPHIAFYVPGANWTAALEHLEKLGIENGDRGAAKERVDGHGGTYMDDPAGYVIQFITDGME |
Ga0193719_103350652 | 3300021344 | Soil | IPAAKWSAAMAHLDELKIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME |
Ga0233392_10155752 | 3300024241 | Deep Subsurface Sediment | DNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME |
Ga0209172_102379563 | 3300025310 | Hot Spring Sediment | WSAALAHLRELGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME |
Ga0209640_105244291 | 3300025324 | Soil | PHIAFYVPGENWNAAIEHLAKLGIENGDRGAAKERVDGQGGTYMDDPAGYVIQFITDGME |
Ga0210094_11129921 | 3300025549 | Natural And Restored Wetlands | VPGPHIAFYVPAAKWSLAIAHLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME |
Ga0207643_109437921 | 3300025908 | Miscanthus Rhizosphere | YVPGAKWSAALAYLEELGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME |
Ga0207644_101927263 | 3300025931 | Switchgrass Rhizosphere | PGDRWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME |
Ga0207690_117605032 | 3300025932 | Corn Rhizosphere | AYLEELGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME |
Ga0207674_103169651 | 3300026116 | Corn Rhizosphere | IAFYVPGDRWRDALAHLDTLGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME |
Ga0209237_12371381 | 3300026297 | Grasslands Soil | PNGDRGAAKERQAGQGGTYMDDPAGYVIQFITDGME |
Ga0209152_102273902 | 3300026325 | Soil | PGPHIAFYVPATKWNTALAHLEKLGIPNGDRGAAKERQAGQDGTYMDDPAGYVIQFITDGME |
Ga0209808_11553332 | 3300026523 | Soil | PGPHIAFYVPATKWNTALAHLEKFGIPNGDRGAAKERQAGQGGTYMDDPAGYVIQFITDGME |
Ga0209874_11186052 | 3300027577 | Groundwater Sand | MGSHHTPRGCIHRGAAKERHDGQGGTYMDDPAGYVIQFITDGME |
Ga0209073_101728001 | 3300027765 | Agricultural Soil | WRDALAHLDALGIAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME |
Ga0209073_102412742 | 3300027765 | Agricultural Soil | YVPGNRWRDALAHLDTLGIPHGDRGAAKERHEGQGGTYTDDPAGYVIQLITDGME |
Ga0209683_100042828 | 3300027840 | Wetland Sediment | PTAKWTEALDHLDKLGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME |
Ga0209701_104131041 | 3300027862 | Vadose Zone Soil | AMAHLDTLGIANGDRGAAKERQPGQGGTYMDDPAGYVIQFITDGME |
Ga0209481_102931701 | 3300027880 | Populus Rhizosphere | ALAHLDALGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME |
Ga0209853_10666383 | 3300027961 | Groundwater Sand | TALAHLDSLGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME |
Ga0268266_104521343 | 3300028379 | Switchgrass Rhizosphere | LAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME |
Ga0307281_103205811 | 3300028803 | Soil | LGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME |
Ga0307305_103265742 | 3300028807 | Soil | IGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME |
Ga0308187_102967092 | 3300031114 | Soil | EKLGIPNGDRGAAKVRRPGEGGTYIDDPAGYVVQYITDGMD |
Ga0307498_101736532 | 3300031170 | Soil | WSAAIARLEQLEIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME |
Ga0310888_102042711 | 3300031538 | Soil | NWSAALSQLEQLGIANGDRGAAKERHNGQGGTYMDDPAGYVIQYITDGME |
Ga0310915_105577271 | 3300031573 | Soil | IAQLDKLKIANGDRGAAKERQQGQGGTYMDDPAGYVIQFITDGME |
Ga0310813_105394331 | 3300031716 | Soil | DALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME |
Ga0307468_1007301012 | 3300031740 | Hardwood Forest Soil | NWTAALAHLDRLGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME |
Ga0307471_1005618971 | 3300032180 | Hardwood Forest Soil | ENLGIENGDRGAAKERTEGQGGTYLDDPAGYVIQFITDGME |
Ga0335085_108475722 | 3300032770 | Soil | TAAIEHLAKLGIENGDRGAAKERTAEQGGTYMDDPAGYVIQFITDGME |
Ga0335085_115570482 | 3300032770 | Soil | IAFYVPATKWRAALARLDELGIQNGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME |
Ga0335080_112116481 | 3300032828 | Soil | LGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME |
Ga0335077_109221951 | 3300033158 | Soil | PAAKWNAALTRLNELGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME |
Ga0310810_108857902 | 3300033412 | Soil | HIAFYVRGANWKTALAHLEKLGVENGDRGAAKERTGTEGGTYMDDAAGYVIQFITDGME |
Ga0310811_103149234 | 3300033475 | Soil | ALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME |
Ga0247830_113279931 | 3300033551 | Soil | YVPGDRWRDALAHLDTLGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME |
⦗Top⦘ |