NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061359

Metagenome / Metatranscriptome Family F061359

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061359
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 49 residues
Representative Sequence ALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME
Number of Associated Samples 127
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.52 %
% of genes near scaffold ends (potentially truncated) 96.97 %
% of genes from short scaffolds (< 2000 bps) 93.94 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(9.848 % of family members)
Environment Ontology (ENVO) Unclassified
(37.121 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.606 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.76%    β-sheet: 0.00%    Coil/Unstructured: 93.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF13714PEP_mutase 62.12
PF01613Flavin_Reduct 16.67
PF13343SBP_bac_6 4.55
PF09084NMT1 3.03
PF02538Hydantoinase_B 1.52
PF01402RHH_1 0.76
PF07883Cupin_2 0.76
PF01106NifU 0.76
PF00903Glyoxalase 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 16.67
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 3.03
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.03
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.03
COG0694Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domainPosttranslational modification, protein turnover, chaperones [O] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y02G8PR6All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium728Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0818286All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1817Open in IMG/M
3300000890|JGI11643J12802_12353857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1021Open in IMG/M
3300000891|JGI10214J12806_11652538All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300001431|F14TB_104665342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium625Open in IMG/M
3300003995|Ga0055438_10074912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium919Open in IMG/M
3300004051|Ga0055492_10165316All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300004463|Ga0063356_100646426All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1441Open in IMG/M
3300004463|Ga0063356_102129480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium852Open in IMG/M
3300004479|Ga0062595_100781899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium783Open in IMG/M
3300004633|Ga0066395_10023056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2501Open in IMG/M
3300005178|Ga0066688_10347349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium960Open in IMG/M
3300005294|Ga0065705_10734586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300005295|Ga0065707_10847496All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300005331|Ga0070670_101573284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300005336|Ga0070680_101506445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300005337|Ga0070682_100137737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1660Open in IMG/M
3300005444|Ga0070694_101312727All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium609Open in IMG/M
3300005450|Ga0066682_10689573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300005467|Ga0070706_100108274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2586Open in IMG/M
3300005471|Ga0070698_101430318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300005518|Ga0070699_101571116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300005526|Ga0073909_10090393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1192Open in IMG/M
3300005530|Ga0070679_100824343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium871Open in IMG/M
3300005545|Ga0070695_101265646All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300005564|Ga0070664_101837431All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300005718|Ga0068866_10645548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium720Open in IMG/M
3300005764|Ga0066903_103419103All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria856Open in IMG/M
3300005842|Ga0068858_100940896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium846Open in IMG/M
3300005844|Ga0068862_102619004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300006844|Ga0075428_100305795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1709Open in IMG/M
3300006865|Ga0073934_10103913All Organisms → cellular organisms → Bacteria2154Open in IMG/M
3300006865|Ga0073934_10347798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales929Open in IMG/M
3300006880|Ga0075429_101728541All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300006881|Ga0068865_100694066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium869Open in IMG/M
3300006914|Ga0075436_100113950All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300006969|Ga0075419_10152443All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300009087|Ga0105107_10682289All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium715Open in IMG/M
3300009100|Ga0075418_11140761All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium844Open in IMG/M
3300009147|Ga0114129_11671539All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300009174|Ga0105241_11221177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300010046|Ga0126384_10773114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium857Open in IMG/M
3300010047|Ga0126382_10028969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3008Open in IMG/M
3300010047|Ga0126382_11281797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium661Open in IMG/M
3300010166|Ga0126306_11255301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300010320|Ga0134109_10088241All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1068Open in IMG/M
3300010323|Ga0134086_10482102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300010361|Ga0126378_10244032All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1888Open in IMG/M
3300010362|Ga0126377_13412357All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300010366|Ga0126379_10220627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1841Open in IMG/M
3300010376|Ga0126381_101854933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria870Open in IMG/M
3300010399|Ga0134127_10447511All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1290Open in IMG/M
3300010401|Ga0134121_12830772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300011405|Ga0137340_1080396All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300011432|Ga0137428_1011271All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2295Open in IMG/M
3300011440|Ga0137433_1122105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium826Open in IMG/M
3300012038|Ga0137431_1008475All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2850Open in IMG/M
3300012129|Ga0137345_1033308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300012203|Ga0137399_10132340All Organisms → cellular organisms → Bacteria1972Open in IMG/M
3300012209|Ga0137379_11546949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300012355|Ga0137369_10397728All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium994Open in IMG/M
3300012360|Ga0137375_11252148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300012515|Ga0157338_1003587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1297Open in IMG/M
3300012519|Ga0157352_1050174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300012898|Ga0157293_10275308All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300012911|Ga0157301_10370423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300012929|Ga0137404_10326965All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300012930|Ga0137407_11139470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium740Open in IMG/M
3300012948|Ga0126375_11462859All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300012971|Ga0126369_10355610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1488Open in IMG/M
3300012976|Ga0134076_10082500All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300013100|Ga0157373_10082656All Organisms → cellular organisms → Bacteria2264Open in IMG/M
3300013105|Ga0157369_10229225All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1942Open in IMG/M
3300014861|Ga0180061_1086202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300014870|Ga0180080_1002895All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1746Open in IMG/M
3300014877|Ga0180074_1101655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium645Open in IMG/M
3300014879|Ga0180062_1067973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium782Open in IMG/M
3300014881|Ga0180094_1070250All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium773Open in IMG/M
3300014884|Ga0180104_1082270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium899Open in IMG/M
3300015262|Ga0182007_10376598All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300015373|Ga0132257_102000329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium747Open in IMG/M
3300015374|Ga0132255_103184935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300016319|Ga0182033_11695562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300016371|Ga0182034_11099519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium689Open in IMG/M
3300016422|Ga0182039_10494268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1055Open in IMG/M
3300018000|Ga0184604_10062539All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1063Open in IMG/M
3300018028|Ga0184608_10255360All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium771Open in IMG/M
3300018056|Ga0184623_10490078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300018061|Ga0184619_10539816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300018075|Ga0184632_10077152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1454Open in IMG/M
3300018079|Ga0184627_10606012All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300018429|Ga0190272_10937084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium818Open in IMG/M
3300018920|Ga0190273_12007750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300019878|Ga0193715_1095234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300020195|Ga0163150_10449627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300021081|Ga0210379_10166377All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium942Open in IMG/M
3300021344|Ga0193719_10335065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300024241|Ga0233392_1015575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium752Open in IMG/M
3300025310|Ga0209172_10237956All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300025324|Ga0209640_10524429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium963Open in IMG/M
3300025549|Ga0210094_1112992All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300025908|Ga0207643_10943792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300025931|Ga0207644_10192726All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300025932|Ga0207690_11760503All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300026116|Ga0207674_10316965All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300026297|Ga0209237_1237138All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300026325|Ga0209152_10227390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300026523|Ga0209808_1155333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium869Open in IMG/M
3300027577|Ga0209874_1118605All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300027765|Ga0209073_10172800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium809Open in IMG/M
3300027765|Ga0209073_10241274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300027840|Ga0209683_10004282All Organisms → cellular organisms → Bacteria5490Open in IMG/M
3300027862|Ga0209701_10413104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium750Open in IMG/M
3300027880|Ga0209481_10293170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium824Open in IMG/M
3300027961|Ga0209853_1066638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium964Open in IMG/M
3300028379|Ga0268266_10452134All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300028803|Ga0307281_10320581All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300028807|Ga0307305_10326574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300031114|Ga0308187_10296709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi605Open in IMG/M
3300031170|Ga0307498_10173653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium733Open in IMG/M
3300031538|Ga0310888_10204271All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1088Open in IMG/M
3300031573|Ga0310915_10557727All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium813Open in IMG/M
3300031716|Ga0310813_10539433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1024Open in IMG/M
3300031740|Ga0307468_100730101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium833Open in IMG/M
3300032180|Ga0307471_100561897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1296Open in IMG/M
3300032770|Ga0335085_10847572All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1001Open in IMG/M
3300032770|Ga0335085_11557048All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium686Open in IMG/M
3300032828|Ga0335080_11211648All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium758Open in IMG/M
3300033158|Ga0335077_10922195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium878Open in IMG/M
3300033412|Ga0310810_10885790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium787Open in IMG/M
3300033475|Ga0310811_10314923All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1788Open in IMG/M
3300033551|Ga0247830_11327993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.85%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.30%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.30%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.03%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.27%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment2.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.27%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.27%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.52%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.52%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.52%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.76%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.76%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.76%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.76%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.76%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003995Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2EnvironmentalOpen in IMG/M
3300004051Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012129Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014879Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10DEnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300020195Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IBEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300024241Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PBEnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4MG_049137602170459019Switchgrass, Maize And Mischanthus LitterVALAHLEKLGVENGDRGAAKERTGTEGGTYMDDPAGYVIQFITDGME
ICChiseqgaiiDRAFT_081828643300000033SoilLDTLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME*
JGI11643J12802_1235385733300000890SoilGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITAGME*
JGI10214J12806_1165253823300000891SoilNGDRGAAKERTGEQGGTYMDDPAGYVIQFITAGME*
F14TB_10466534223300001431SoilYVPTAKWTEAIDQLAKLGIENGDRGAAKEPXXXXXXXXMDDPAGYVIQFITDGME*
Ga0055438_1007491223300003995Natural And Restored WetlandsVPGPHIAFYVPAAKWSLAIAHLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME*
Ga0055492_1016531623300004051Natural And Restored WetlandsAKWTKAIEHLANLGIENGDRGAAKEPSPDRGGTYMDDPAGYVIQFITDGME*
Ga0063356_10064642613300004463Arabidopsis Thaliana RhizosphereLARLGVENADRGAAKERIGEHGGTYMDDPAGYVIQFITDGME*
Ga0063356_10212948013300004463Arabidopsis Thaliana RhizosphereFYIPGAKWPAAIEHLDKLGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITAGME*
Ga0062595_10078189923300004479SoilKVPGPHIAFYVPGDRWRNAIAHLDALGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME*
Ga0066395_1002305613300004633Tropical Forest SoilHIAFYVPATNWSSALAHLDALGIAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME*
Ga0066688_1034734923300005178SoilPHIAFYVPAGQWSTAMAHLDALGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME
Ga0065705_1073458623300005294Switchgrass RhizosphereAHLDALGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME*
Ga0065707_1084749623300005295Switchgrass RhizosphereHLEKLGIENADRGAAKERVDGHGGTYMDDPAGYVIQFITDGME*
Ga0070670_10157328423300005331Switchgrass RhizosphereWRNAIAHLDALGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME*
Ga0070680_10150644523300005336Corn RhizosphereWNAALAQLEQLGIANGDRGAAKERHAGQGGTYMDDPAGYVIQYITDGME*
Ga0070682_10013773713300005337Corn RhizospherePHIAFYVPGDRWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME
Ga0070694_10131272713300005444Corn, Switchgrass And Miscanthus RhizosphereKVPGPHIAFYVPGANWTAAIAHLDKLGIENGDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME*
Ga0066682_1068957323300005450SoilLSQLEQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME*
Ga0070706_10010827443300005467Corn, Switchgrass And Miscanthus RhizosphereKVPGPHIAFYVPAAKWSLALLQLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME*
Ga0070698_10143031823300005471Corn, Switchgrass And Miscanthus RhizosphereSLAIAHLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME*
Ga0070699_10157111613300005518Corn, Switchgrass And Miscanthus RhizosphereFYVPATKWSLAIAHLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME*
Ga0073909_1009039333300005526Surface SoilIAHLDALGIPHGDRGTAKERHEGQGGTYMDDPAGYVIQLITDGME*
Ga0070679_10082434323300005530Corn RhizosphereWNAALAQLEQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME*
Ga0070695_10126564623300005545Corn, Switchgrass And Miscanthus RhizosphereGANWKAALAHLEKLGVENGDRGAAKERTGTEGGTYMDDPAGYVIQFITDGME*
Ga0070664_10183743113300005564Corn RhizosphereGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME*
Ga0068866_1064554823300005718Miscanthus RhizosphereVPAANWSAALSRLEQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME*
Ga0066903_10341910313300005764Tropical Forest SoilGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME*
Ga0068858_10094089613300005842Switchgrass RhizosphereDRWRDALAHLDTLRIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME*
Ga0068862_10261900413300005844Switchgrass RhizosphereGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME*
Ga0075428_10030579513300006844Populus RhizospherePGPHIAFYVPAADWSSALAHLDALGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITAGME*
Ga0073934_1010391343300006865Hot Spring SedimentWSAALAHLRELGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME*
Ga0073934_1034779813300006865Hot Spring SedimentPAERWREALAHLEELGIPNGDRGAAKVRRPGEGGTYMDDPAGYVVQYITDGME*
Ga0075429_10172854113300006880Populus RhizosphereRKVPGPHIAFYVPATKWGGALAHLDNLQIANGDRGAAKERHDGQGGTYMDDPAGYVIQFISDGME*
Ga0068865_10069406623300006881Miscanthus RhizosphereFYVPGDRWRDALAHLDTLRIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME*
Ga0075436_10011395043300006914Populus RhizosphereIANGDRGAAKERRDGQGGTYMDDPAGYVIQFITDGME*
Ga0075419_1015244343300006969Populus RhizosphereFYIEAHDWERALKHLEQLGIPNADRGAAKEPRPGRGGTYMDDPAGNVIQFITEGME*
Ga0105107_1068228913300009087Freshwater SedimentKCNGLNVRRRQRGAAKELSADRGGIYIDDPAGYVIQFITDGME*
Ga0075418_1114076123300009100Populus RhizosphereAFYVPGDRWRDALAHLDTLRIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME*
Ga0114129_1167153913300009147Populus RhizosphereADRGAAKEPRPGRGGTYMDDPAGNVIQFITEGME*
Ga0105241_1122117723300009174Corn RhizosphereKWPAALAHLDALGVPHGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME*
Ga0126384_1077311413300010046Tropical Forest SoilLGIAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME*
Ga0126382_1002896933300010047Tropical Forest SoilHLENLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME*
Ga0126382_1128179723300010047Tropical Forest SoilAALAHLDKLNITNGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME*
Ga0126306_1125530113300010166Serpentine SoilGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME*
Ga0134109_1008824113300010320Grasslands SoilTKWNTALAHLEKLGIPNGDRGAAKERQAGQGGTYMDDPAGYVIQFITDGME*
Ga0134086_1048210213300010323Grasslands SoilLGIPNGDRGAAKERQAGQGGTYQGGTYMDDPAGYVIQFITDGME*
Ga0126378_1024403213300010361Tropical Forest SoilLENLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME*
Ga0126377_1341235713300010362Tropical Forest SoilANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME*
Ga0126379_1022062713300010366Tropical Forest SoilVPATKWSLALAHLENLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME*
Ga0126381_10185493313300010376Tropical Forest SoilATKWSLALAHLENLGIENGDRGAAKERIEGQGGTYMDDPAGYVIQFITDGME*
Ga0134127_1044751113300010399Terrestrial SoilIAFYVPGAKWSAALAYLEELGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME*
Ga0134121_1283077223300010401Terrestrial SoilAIELLANLGIENGDRGAAKEPNADRGGTYMDDPAGYVIQFITDGME*
Ga0137340_108039623300011405SoilPGPHIAFYVPAAKWNAAVAHLEELKIPNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME*
Ga0137428_101127143300011432SoilPNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME*
Ga0137433_112210523300011440SoilIAFYVPAAKWNAAVAHLEELKIPNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME*
Ga0137431_100847513300012038SoilLEELKIPNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME*
Ga0137345_103330813300012129SoilKLGIENGDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME*
Ga0137399_1013234043300012203Vadose Zone SoilASWSAAIARLEQLEIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME*
Ga0137379_1154694923300012209Vadose Zone SoilATKWSAALKRLDQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME*
Ga0137369_1039772813300012355Vadose Zone SoilLDKLQIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME*
Ga0137375_1125214823300012360Vadose Zone SoilVPAASWSAAMARLEQLEIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME*
Ga0157338_100358733300012515Arabidopsis RhizosphereAFYVPGDRWRDALAHLDTLGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME*
Ga0157352_105017423300012519Unplanted SoilALSQLEQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME*
Ga0157293_1027530823300012898SoilGDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME*
Ga0157301_1037042313300012911SoilKVPGPHIAFYVPGDRWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME*
Ga0137404_1032696533300012929Vadose Zone SoilIVNGDRGAAKERRDGQGGTYMDDPAGYVIQFITDGME*
Ga0137407_1113947023300012930Vadose Zone SoilNGDRGAAKERHDGQGGTYMDGPAGYVIQYITGGME*
Ga0126375_1146285913300012948Tropical Forest SoilLDALGIAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME*
Ga0126369_1035561013300012971Tropical Forest SoilIAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME*
Ga0134076_1008250013300012976Grasslands SoilKWSAALKRLDQLGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME*
Ga0157373_1008265643300013100Corn RhizospherePGDRWRDALAHLEALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME*
Ga0157369_1022922513300013105Corn RhizosphereGPHIAFYVPGDRWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME*
Ga0180061_108620213300014861SoilEAIEQLAELGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME*
Ga0180080_100289513300014870SoilENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME*
Ga0180074_110165523300014877SoilLGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME*
Ga0180062_106797323300014879SoilPAAKWNAAVAHLEELKIPNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME*
Ga0180094_107025013300014881SoilPGPHIAFFVPGAKWSAALAHLNELKVENGDRGAAKERTDGQGGTYMDDPAGYVIQFITDGIE*
Ga0180104_108227023300014884SoilELGIENGDRGAAKERTDGQGGTYMDDPAGYVIQFITDGME*
Ga0182007_1037659813300015262RhizosphereRWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME*
Ga0132257_10200032923300015373Arabidopsis RhizosphereGSKWNAALAQLQTLGIENGDRGAAKERTGDQGGTYMDDPAGYVIQYITDGME*
Ga0132255_10318493523300015374Arabidopsis RhizosphereDALAHLDTLGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME*
Ga0182033_1169556213300016319SoilHIAFYIPGERWREAIAHLDNLGIPHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME
Ga0182034_1109951913300016371SoilKLKIANGDRGAAKERQQGQGGTYMDDPAGYVIQFITDGME
Ga0182039_1049426823300016422SoilVPAARWNEGIAQLDKLKIANGDRGAAKERQQGQGGTYMDDPAGYVIQFITDGME
Ga0184604_1006253923300018000Groundwater SedimentAALAYLEELGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME
Ga0184608_1025536013300018028Groundwater SedimentASWPVAIAHLDKLGIENGDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME
Ga0184623_1049007813300018056Groundwater SedimentPHIAFYIPAPKWSAATAHLDELKIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME
Ga0184619_1053981613300018061Groundwater SedimentFYVPAGNWTAALAHLDSLGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME
Ga0184632_1007715233300018075Groundwater SedimentIAFYIPAAKWRAAMAHLDDLKIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME
Ga0184627_1060601213300018079Groundwater SedimentGANWTAAIAHLDKLGIENGDRGAAKERVDGQGGTYMDDPAGYVIQFITDGME
Ga0190272_1093708413300018429SoilLDQLGIENGDRGAAKERTGEQGGTYMDDPAGYVIQ
Ga0190273_1200775013300018920SoilIANGDRGAAKERVEGQGGTYMDDPAGYVIQFITDGME
Ga0193715_109523423300019878SoilPGPHIAFYVPAEKWSAALAHLDQIGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME
Ga0163150_1044962723300020195Freshwater Microbial MatHIAFYVPTAKWPEAIEQLAKLGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME
Ga0210379_1016637713300021081Groundwater SedimentGPGPHIAFYVPGANWTAALEHLEKLGIENGDRGAAKERVDGHGGTYMDDPAGYVIQFITDGME
Ga0193719_1033506523300021344SoilIPAAKWSAAMAHLDELKIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME
Ga0233392_101557523300024241Deep Subsurface SedimentDNGDRGAAKERTGDQGGTYMDDPAGYVIQFITDGME
Ga0209172_1023795633300025310Hot Spring SedimentWSAALAHLRELGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME
Ga0209640_1052442913300025324SoilPHIAFYVPGENWNAAIEHLAKLGIENGDRGAAKERVDGQGGTYMDDPAGYVIQFITDGME
Ga0210094_111299213300025549Natural And Restored WetlandsVPGPHIAFYVPAAKWSLAIAHLNKLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME
Ga0207643_1094379213300025908Miscanthus RhizosphereYVPGAKWSAALAYLEELGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME
Ga0207644_1019272633300025931Switchgrass RhizospherePGDRWRDALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME
Ga0207690_1176050323300025932Corn RhizosphereAYLEELGIENGDRGAAKERTGEQGGTYMDDPAGYVIQFITDGME
Ga0207674_1031696513300026116Corn RhizosphereIAFYVPGDRWRDALAHLDTLGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME
Ga0209237_123713813300026297Grasslands SoilPNGDRGAAKERQAGQGGTYMDDPAGYVIQFITDGME
Ga0209152_1022739023300026325SoilPGPHIAFYVPATKWNTALAHLEKLGIPNGDRGAAKERQAGQDGTYMDDPAGYVIQFITDGME
Ga0209808_115533323300026523SoilPGPHIAFYVPATKWNTALAHLEKFGIPNGDRGAAKERQAGQGGTYMDDPAGYVIQFITDGME
Ga0209874_111860523300027577Groundwater SandMGSHHTPRGCIHRGAAKERHDGQGGTYMDDPAGYVIQFITDGME
Ga0209073_1017280013300027765Agricultural SoilWRDALAHLDALGIAHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME
Ga0209073_1024127423300027765Agricultural SoilYVPGNRWRDALAHLDTLGIPHGDRGAAKERHEGQGGTYTDDPAGYVIQLITDGME
Ga0209683_1000428283300027840Wetland SedimentPTAKWTEALDHLDKLGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME
Ga0209701_1041310413300027862Vadose Zone SoilAMAHLDTLGIANGDRGAAKERQPGQGGTYMDDPAGYVIQFITDGME
Ga0209481_1029317013300027880Populus RhizosphereALAHLDALGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME
Ga0209853_106663833300027961Groundwater SandTALAHLDSLGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME
Ga0268266_1045213433300028379Switchgrass RhizosphereLAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME
Ga0307281_1032058113300028803SoilLGIENGDRGAAKEPSADRGGTYMDDPAGYVIQFITDGME
Ga0307305_1032657423300028807SoilIGIANGDRGAAKERHDGQGGTYMDDPAGYVIQFITDGME
Ga0308187_1029670923300031114SoilEKLGIPNGDRGAAKVRRPGEGGTYIDDPAGYVVQYITDGMD
Ga0307498_1017365323300031170SoilWSAAIARLEQLEIANGDRGAAKERHDGQGGTYMDDPAGYVIQYITDGME
Ga0310888_1020427113300031538SoilNWSAALSQLEQLGIANGDRGAAKERHNGQGGTYMDDPAGYVIQYITDGME
Ga0310915_1055772713300031573SoilIAQLDKLKIANGDRGAAKERQQGQGGTYMDDPAGYVIQFITDGME
Ga0310813_1053943313300031716SoilDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME
Ga0307468_10073010123300031740Hardwood Forest SoilNWTAALAHLDRLGISHGDRGAAKERHEGQGGTYMDDPAGYVIQFITDGME
Ga0307471_10056189713300032180Hardwood Forest SoilENLGIENGDRGAAKERTEGQGGTYLDDPAGYVIQFITDGME
Ga0335085_1084757223300032770SoilTAAIEHLAKLGIENGDRGAAKERTAEQGGTYMDDPAGYVIQFITDGME
Ga0335085_1155704823300032770SoilIAFYVPATKWRAALARLDELGIQNGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME
Ga0335080_1121164813300032828SoilLGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME
Ga0335077_1092219513300033158SoilPAAKWNAALTRLNELGIENGDRGAAKERTEGQGGTYMDDPAGYVIQFITDGME
Ga0310810_1088579023300033412SoilHIAFYVRGANWKTALAHLEKLGVENGDRGAAKERTGTEGGTYMDDAAGYVIQFITDGME
Ga0310811_1031492343300033475SoilALAHLDALGIAHGDRGAAKERQEGQGGTYMDDPAGYVIQFITDGME
Ga0247830_1132799313300033551SoilYVPGDRWRDALAHLDTLGIPHGDRGAAKERHEGQGGTYMDDPAGYVIQLITDGME


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.