Basic Information | |
---|---|
Family ID | F060943 |
Family Type | Metagenome |
Number of Sequences | 132 |
Average Sequence Length | 47 residues |
Representative Sequence | MSAELNNLSEEAQSLARVPLFKRLEPHELEHLAEDVDQVNYKAG |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.24 % |
% of genes near scaffold ends (potentially truncated) | 98.48 % |
% of genes from short scaffolds (< 2000 bps) | 93.18 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.485 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.879 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.394 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.576 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF13302 | Acetyltransf_3 | 5.30 |
PF01566 | Nramp | 3.79 |
PF03572 | Peptidase_S41 | 3.03 |
PF00027 | cNMP_binding | 1.52 |
PF04120 | Iron_permease | 1.52 |
PF14685 | Tricorn_PDZ | 0.76 |
PF07883 | Cupin_2 | 0.76 |
PF07992 | Pyr_redox_2 | 0.76 |
PF00871 | Acetate_kinase | 0.76 |
PF00583 | Acetyltransf_1 | 0.76 |
PF13740 | ACT_6 | 0.76 |
PF12883 | DUF3828 | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 3.79 |
COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 3.03 |
COG0282 | Acetate kinase | Energy production and conversion [C] | 0.76 |
COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.48 % |
Unclassified | root | N/A | 1.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101294264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101590377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300000789|JGI1027J11758_12104653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
3300004479|Ga0062595_101466708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300005167|Ga0066672_10052324 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
3300005171|Ga0066677_10310456 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300005175|Ga0066673_10510723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300005178|Ga0066688_10527556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300005332|Ga0066388_101090631 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300005332|Ga0066388_104892581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300005341|Ga0070691_10961967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
3300005341|Ga0070691_11098891 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005354|Ga0070675_101418976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300005356|Ga0070674_101482623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300005356|Ga0070674_101840002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300005438|Ga0070701_10433319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300005439|Ga0070711_100451522 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300005440|Ga0070705_101683583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300005454|Ga0066687_10952182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300005468|Ga0070707_100437716 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300005471|Ga0070698_100078556 | All Organisms → cellular organisms → Bacteria | 3298 | Open in IMG/M |
3300005518|Ga0070699_100955572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
3300005536|Ga0070697_102065678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300005545|Ga0070695_101140505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300005545|Ga0070695_101615187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300005552|Ga0066701_10866194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300005559|Ga0066700_10163819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1516 | Open in IMG/M |
3300005561|Ga0066699_11149230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300005562|Ga0058697_10316590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 749 | Open in IMG/M |
3300005575|Ga0066702_10291868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
3300005576|Ga0066708_10606331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300005713|Ga0066905_102136716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300005841|Ga0068863_101820892 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300005843|Ga0068860_101296463 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005876|Ga0075300_1013609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300006031|Ga0066651_10750326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300006358|Ga0068871_101550128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300006791|Ga0066653_10349077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
3300006794|Ga0066658_10332610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
3300006800|Ga0066660_10785334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300006806|Ga0079220_12003006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300006844|Ga0075428_102336306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300006854|Ga0075425_102695077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300006871|Ga0075434_102241141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300006904|Ga0075424_102141695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300007076|Ga0075435_101985680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300007258|Ga0099793_10365589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
3300007265|Ga0099794_10767650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300007788|Ga0099795_10189685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
3300009012|Ga0066710_101801278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
3300009012|Ga0066710_102172106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
3300009089|Ga0099828_11866907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300009090|Ga0099827_11299585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300009100|Ga0075418_12628247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300009101|Ga0105247_10964176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300009148|Ga0105243_10592390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
3300009174|Ga0105241_11170108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300009177|Ga0105248_10907885 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300009553|Ga0105249_12648318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300009553|Ga0105249_13208680 | Not Available | 526 | Open in IMG/M |
3300010047|Ga0126382_10789065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
3300010047|Ga0126382_11629393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300010159|Ga0099796_10237888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300010391|Ga0136847_11443545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300010399|Ga0134127_12332400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300010399|Ga0134127_13659187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300010401|Ga0134121_10140958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2049 | Open in IMG/M |
3300011119|Ga0105246_10357562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
3300012096|Ga0137389_11265693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300012202|Ga0137363_10925155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300012202|Ga0137363_10947624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
3300012205|Ga0137362_10949066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
3300012208|Ga0137376_11589535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300012357|Ga0137384_10462360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
3300012363|Ga0137390_10090186 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
3300012469|Ga0150984_100914327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300012532|Ga0137373_10060122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3484 | Open in IMG/M |
3300012948|Ga0126375_10947128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300012955|Ga0164298_10707125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300012957|Ga0164303_10619159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300012961|Ga0164302_11349444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300012971|Ga0126369_10299608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1608 | Open in IMG/M |
3300013297|Ga0157378_11040291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
3300013297|Ga0157378_11150360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300014969|Ga0157376_12806823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300015262|Ga0182007_10402369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300015374|Ga0132255_105619714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300016422|Ga0182039_11769047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300017792|Ga0163161_11904845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300018431|Ga0066655_10190416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
3300018431|Ga0066655_11162407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300018468|Ga0066662_11305510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300018468|Ga0066662_12477788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300019885|Ga0193747_1092142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300020004|Ga0193755_1182995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300020062|Ga0193724_1084068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300024187|Ga0247672_1090285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300024251|Ga0247679_1071264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300024330|Ga0137417_1330511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2610 | Open in IMG/M |
3300024330|Ga0137417_1357461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5212 | Open in IMG/M |
3300025315|Ga0207697_10270584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
3300025898|Ga0207692_10797574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300025911|Ga0207654_10881789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300025922|Ga0207646_10390254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
3300025922|Ga0207646_10787671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
3300025922|Ga0207646_11182280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300025930|Ga0207701_10456760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
3300025930|Ga0207701_10507943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
3300025933|Ga0207706_10240913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1581 | Open in IMG/M |
3300025938|Ga0207704_10068102 | All Organisms → cellular organisms → Bacteria | 2242 | Open in IMG/M |
3300025941|Ga0207711_10308745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
3300025941|Ga0207711_11386371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300025942|Ga0207689_10069077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2903 | Open in IMG/M |
3300026003|Ga0208284_1021626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300026075|Ga0207708_11792889 | Not Available | 538 | Open in IMG/M |
3300026088|Ga0207641_11248901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300026088|Ga0207641_11595027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300026089|Ga0207648_11411219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300026095|Ga0207676_10830162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
3300026095|Ga0207676_10980996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
3300026095|Ga0207676_11760396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
3300026095|Ga0207676_12173880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300026116|Ga0207674_11617356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300026331|Ga0209267_1248882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300026335|Ga0209804_1292826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300026515|Ga0257158_1053598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300028065|Ga0247685_1027125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300028381|Ga0268264_10396771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
3300028792|Ga0307504_10390682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300030513|Ga0268242_1073620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300031716|Ga0310813_11760306 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300031720|Ga0307469_11132559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.06% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.03% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.27% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.27% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.76% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026003 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1012942643 | 3300000364 | Soil | MAADMNDLSDEAKSLARVPLFKKLEPHELEHLAEEIDQVNY |
INPhiseqgaiiFebDRAFT_1015903772 | 3300000364 | Soil | MAAEMNNLSDEARSLARVPLFKRLDAAELEHLAEEIDQVNYEAGATIFNEHD |
JGI1027J11758_121046532 | 3300000789 | Soil | MAADMNDLSDEAKSLARVPLFKKLEPHELEHLAEEI |
Ga0062595_1014667082 | 3300004479 | Soil | MAPELTNLSDEARSLSRVPLFKRLDAAELEHLAEEIDQVDYKAGATIFNEH |
Ga0066672_100523244 | 3300005167 | Soil | MSANLTNLSDEAQSLSRVSLFKRLEPHELEHLAEEVDQVQFKAGEVIFN |
Ga0066677_103104561 | 3300005171 | Soil | MPTDPTQLSDEAQSLARVPLFKRLEPHELEKLAEEIDQVDYKAGEIIFNEHDHGDALY |
Ga0066673_105107231 | 3300005175 | Soil | MSANLTNLSDEAQSLSRVSLFKRLEPHELEHLAEEVDQVQFKAGEVIFNEHDRGDAL |
Ga0066688_105275562 | 3300005178 | Soil | MSADLTKLSEEAQSLARVPLFKRLEPHELEHVAEEVDQVKFKDGEVIFNEH |
Ga0066388_1010906311 | 3300005332 | Tropical Forest Soil | MSAISNLSDEAQSLARVPLFRRLEPHELEHLAEEVEQVNYKAGEIIFHEYDTGDALY |
Ga0066388_1048925811 | 3300005332 | Tropical Forest Soil | MSSTSNLSDEAQSLARIPLFQRLEPYELEHLAEDVEQVNYKAGEVIFH |
Ga0070691_109619672 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDDLNILSDEARGLSRIPLFKRLEPDELEKLAREIDHVDVEAGETIFHE |
Ga0070691_110988911 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTETDNLSDEAQSLARIPLFKRLEPHELEHLAEEVDQINYR |
Ga0070675_1014189762 | 3300005354 | Miscanthus Rhizosphere | MAAEMNNLSEEAQSLARVPLFKRLEAHELEHLAEEVDQVNY |
Ga0070674_1014826232 | 3300005356 | Miscanthus Rhizosphere | MAPEIDNLSDEAQSLARVPLFKRLEPHELEHLAEEVDQVNYQA |
Ga0070674_1018400021 | 3300005356 | Miscanthus Rhizosphere | MSARFNSLSEEAQSLARVPLFKRLDAQELEKLADEIVQVNYPAGET |
Ga0070701_104333191 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSATSNLSDEAQSLARVPLFQRLEPHELEHLADEVEQVNYKAGEI |
Ga0070711_1004515223 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPEMTNLSEEARSLSRVPLFKRLDAAELEHLAEEIDQVNYNAGETIFNEHDRGDA |
Ga0070705_1016835831 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDLSTLSDEAQSLARIPLFQRLEPHELEHLAEDVEQVNYKAGE |
Ga0066687_109521822 | 3300005454 | Soil | MPTDVTQLSEEAQSLARVPLFKRLEPHELEKLAEEIDQVDYK |
Ga0070707_1004377163 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAQMNNLSEEAQSLARVPLFKRLEAHELEHLAEEIDQVNYKAGETIF |
Ga0070698_1000785561 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VNDDPQSNDQPLSNEAESLSRVALFRRLDHDELEKLATRVEQVNYKAGDTIFNENDK |
Ga0070699_1009555722 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAELNNLSEEAQSLARVPLFKRLEPHELEHLAEDVDQVNYKAG |
Ga0070697_1020656782 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAQMNNLSEEAQSLARVPLFKRLEAHELEHLAEEIDQVNYKAGETIFNEHDRGDALYIL |
Ga0070695_1011405051 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAIPNLSEEAQSLARVPLFKRLEPHELEELAEAVEQVNYKADEVIFHEYDTADA |
Ga0070695_1016151872 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MADLTNLSEEAQSLARVPLFKRLEPHELEKLAEEIDQVNYPAGETIFSEHDRG |
Ga0066701_108661942 | 3300005552 | Soil | MSADLTKLSDEAQSLARVPLFKRLEPHELEHLAEDVDQVNYKAGETI |
Ga0066700_101638191 | 3300005559 | Soil | MPTDVTQLSEEAQSLARVPLFKRLEPHELEKLAEEIDQVDYKAGE |
Ga0066699_111492301 | 3300005561 | Soil | MSANLTNLSDEAQSLSRVSLFKRLEPHELEHLAEEVDQVQ |
Ga0058697_103165901 | 3300005562 | Agave | MSAISNLSEDARSLARVPLFQRLEPHELEHLAQGIE |
Ga0066702_102918681 | 3300005575 | Soil | MSAQMNNLSDEAQSLARVPLFKRLEPHELEHLAEEVDQVNYKAGETIFNEHDRGDAL |
Ga0066708_106063312 | 3300005576 | Soil | MPTDLTQLSDEAQSLARVPLFKRLEPHELEKLAEEIDQVDYK |
Ga0066905_1021367162 | 3300005713 | Tropical Forest Soil | MATQFNSLSDEAQSLARVPLFKRLDAQELEKLAHEIDQVNYQAGETIFHEHDRGD |
Ga0068863_1018208922 | 3300005841 | Switchgrass Rhizosphere | VIEDPLANDQSLSDEAQSLARVSLFRRLESDELERLAERVEQVTYPAGETIFNEND |
Ga0068860_1012964631 | 3300005843 | Switchgrass Rhizosphere | MSATSNLSDEAQSLARIPLFQRLEPHELEHLAEDVEQVNYNAGEIIFHEYD |
Ga0075300_10136091 | 3300005876 | Rice Paddy Soil | MSAISNLSDEAQSLARVPLFQRLEPHELEDLAAEVEQVNYKAGEVIFHEHD |
Ga0066651_107503261 | 3300006031 | Soil | MPTDVTQLSDEAQSLARVPLFKRLEPHELEKLAEEIDQVDYKAGEV |
Ga0068871_1015501282 | 3300006358 | Miscanthus Rhizosphere | MSDLSTLSDEAQSLARIPLFQRLEPHELEHLAEDVEQVNYKAGEIIFHEYD |
Ga0066653_103490772 | 3300006791 | Soil | MPTDPTQLSDEAQSLARVPLFKRLEPHELEKLAEEIDQVDYKDGE |
Ga0066658_103326102 | 3300006794 | Soil | MSANPTNLSDEAQSLSRVSLFKRLVPHELEHLAEEVDQVQFKAGEVIFNEHD |
Ga0066660_107853341 | 3300006800 | Soil | MPADMTNLSEEAQSLSRVPLFKRLEPHELEHLAEEVDQ |
Ga0079220_120030062 | 3300006806 | Agricultural Soil | MPDLDELSEEAQSLARIPIFKRLEPHELEHLAQEVDQVDF |
Ga0075428_1023363062 | 3300006844 | Populus Rhizosphere | MSITSNLSDEAQSLARIPLFQRLEPHELEHLAEDVEQVNYKAGEIIFHEYD |
Ga0075425_1026950771 | 3300006854 | Populus Rhizosphere | MAADLTGLSEEAQSLARVPIFKRLEPHELEKLAEEIDQINFK |
Ga0075434_1022411412 | 3300006871 | Populus Rhizosphere | MSAIPNLSDEAQSLARIPLFHRLEPHELEELAEAVEQVNYKADEVIF |
Ga0075424_1021416951 | 3300006904 | Populus Rhizosphere | MPADMTNLSEEAQSLARVPLFKRLEPDELEKLAEEIDQVNYPAGETIFNEHDRGDALYI |
Ga0075435_1019856801 | 3300007076 | Populus Rhizosphere | MAPELTNLSDEARSLSRVPLFKRLDAAELEHLAEEIDQVDYKAGATIFNEHDRGDALYILEEGS |
Ga0099793_103655892 | 3300007258 | Vadose Zone Soil | MSAELNKLSEEAQSLARVPLFKRLEPHELEHLAEDVDQVNYA |
Ga0099794_107676502 | 3300007265 | Vadose Zone Soil | MSAEMNKLSDEAQSLARVPLFKRLEPDELEHLAEEVDQVNY |
Ga0099795_101896853 | 3300007788 | Vadose Zone Soil | MSAELNSLSEEAQSLARVPLFKRLEPHELEHLAEDVAQVNYAAGETIFNEHDLGDGLY |
Ga0066710_1018012783 | 3300009012 | Grasslands Soil | MSADLTNLSDEAQSLARIPLFKRLEPHELEHLAEDVDQVDYKAGETIFN |
Ga0066710_1021721061 | 3300009012 | Grasslands Soil | MPADMTNLSEEAQSLSRVPLFKRLEAHELEHLAEEVDQVNYK |
Ga0099828_118669071 | 3300009089 | Vadose Zone Soil | MSADLNKLSDEAQSLARVPLFKRLEPHELEHLAEEI |
Ga0099827_112995851 | 3300009090 | Vadose Zone Soil | MSVDTTNLSEEAQSLARVPLFKRLEAHELEKLAQEIDQVNYKA |
Ga0075418_126282472 | 3300009100 | Populus Rhizosphere | MAADMNNLSEEAQSLARVPLFKRLEPHELEHLAEEVDQVNY |
Ga0105247_109641761 | 3300009101 | Switchgrass Rhizosphere | MSDLSNLSDEAQSLAQVPLFQRLEPHELEHLAEDVEQVNYKAGEVIFHEY |
Ga0105243_105923901 | 3300009148 | Miscanthus Rhizosphere | MAAEMNNLSEEAQSLARVPLFRRLEPEELEHLAEEVDQVNYQA |
Ga0105241_111701082 | 3300009174 | Corn Rhizosphere | MSATENLSDEAQSLARVPLFQRLEPHELEHLAEDVEQVNYEA |
Ga0105248_109078853 | 3300009177 | Switchgrass Rhizosphere | MSAISNLSDEAQSLARVPLFQRLEPHELEHLAEEVEQVNYQAGEVFFHEYDTGD |
Ga0105249_126483181 | 3300009553 | Switchgrass Rhizosphere | MSATLNLSDEAQSLARVPLFQRLEPHELEHLAEDVEQVNYKAGEII |
Ga0105249_132086802 | 3300009553 | Switchgrass Rhizosphere | MPEDLNNLSDEARSLSRIPLFKRLDARELEKLAAEIDQVNVKAGEPIFHQH |
Ga0126382_107890651 | 3300010047 | Tropical Forest Soil | MTEQPKSLTEEAQSLARVPLFKRLEPHELEHLAEEVDQVNY |
Ga0126382_116293931 | 3300010047 | Tropical Forest Soil | MSAILNLSDEAQSLARVPLFQRLEPHELEHLAEDV |
Ga0099796_102378881 | 3300010159 | Vadose Zone Soil | MSAELNKLSEEAQSLARVPLFKRLEPHELEHLAEDVTQVNYAGGETIFNEHDLGDGLYVVET |
Ga0136847_114435451 | 3300010391 | Freshwater Sediment | MSTEPNKLSEEAQSLARIPLFKRLEPHELEHLAEDVDPVN |
Ga0134127_123324001 | 3300010399 | Terrestrial Soil | MSATLNLSDEAQSLARVPLFQRLEPHELEHLAEEVEQVNYKAGEIIFH |
Ga0134127_136591872 | 3300010399 | Terrestrial Soil | MAAEMNNLSEEAQSLARVPLFKRLEAHELEHLAEEVDQVNYQAGATIFHEHD |
Ga0134121_101409581 | 3300010401 | Terrestrial Soil | MSTRFTSLSDEAQSLARVPLFKRLEPDELEKLAEAIDQVNYPA |
Ga0105246_103575621 | 3300011119 | Miscanthus Rhizosphere | MSDTSNLSDEAQSLARVPLFQRLEPHELEHLAEDVEQVN |
Ga0137389_112656931 | 3300012096 | Vadose Zone Soil | MSADLTKLSDEAQSLARVPLFKRLEPHELEHLAEEIDQVNYKAGETIFNEHDRG |
Ga0137363_109251551 | 3300012202 | Vadose Zone Soil | MSAELNELSEEAQSLARIPLFKRLEPHELEHLAEDVVQVNYA |
Ga0137363_109476241 | 3300012202 | Vadose Zone Soil | MSAEMNNLSDEAQSLARVPLFKRLEPHELEHLAEEIDQVNYKAGETIFNEHD |
Ga0137362_109490662 | 3300012205 | Vadose Zone Soil | MSAEMNNLSDEAQSLARVPLFKRLEPHELEHLAEEIDQVNYKAGDTIFN |
Ga0137376_115895352 | 3300012208 | Vadose Zone Soil | MSAELTKLSDEAQSLSRVSLFKRLEPHELEHLAEEV |
Ga0137384_104623601 | 3300012357 | Vadose Zone Soil | MAPEQPFSSEADSLSRVPLFKRLSSQELEQLASGVDQVYYPAGETI |
Ga0137390_100901865 | 3300012363 | Vadose Zone Soil | MAADLTNLSEEAQSLARVPLFRRLEPTELEKLAEEIDQVNFKDGELIFNQHDRGDSL |
Ga0150984_1009143271 | 3300012469 | Avena Fatua Rhizosphere | MAPEMTNLSEEARSLSRVPLFKRLDAGELEHLAEEIDQVNYKAGETIFNEHDRGDA |
Ga0137373_100601221 | 3300012532 | Vadose Zone Soil | MSAELNRLSDEAQSLARVPLFKRLEPHELEKLAEEIDQVNYKAGETI |
Ga0126375_109471282 | 3300012948 | Tropical Forest Soil | MTPDLSKLSDEAQSLARVPLFKRLDAQELEHLAEEIDQVNYKAG |
Ga0164298_107071251 | 3300012955 | Soil | MAPELTNLSDEARSLSRVPLFKRLDAAELEHLAEEID |
Ga0164303_106191592 | 3300012957 | Soil | MAPELTNLSDEARSLSRVPLFKRLDAAELEHLAEEIDQVDYKAGETIFNEH |
Ga0164302_113494442 | 3300012961 | Soil | MSATLNLSDEAQSLARVPLFQRLEPHELEHLAEDVEQVNYKSG* |
Ga0126369_102996081 | 3300012971 | Tropical Forest Soil | MAPELNNLSEEARSLAHVPLFKRLDAQELEHLAAEIDQVNYNAGETIFNEHDHGDA |
Ga0157378_110402911 | 3300013297 | Miscanthus Rhizosphere | MTPEMNNLSDEAQSLSRVPIFKRLEPHELEKLAEEIDQVNYPAGETIFHEND |
Ga0157378_111503603 | 3300013297 | Miscanthus Rhizosphere | MAPELTNLSEEARSLSRVPLFKRLDAAELEHLAEEIDQVNYKAGETIFNEHDRGDALYIL |
Ga0157376_128068232 | 3300014969 | Miscanthus Rhizosphere | MAAEMNNLSEEAQSLARVPLFKRLEAHELEHLAEEVDQV |
Ga0182007_104023691 | 3300015262 | Rhizosphere | MSAISNLSDEAQSLARVPLFQRLEPHELEHLAEEVEQ |
Ga0132255_1056197141 | 3300015374 | Arabidopsis Rhizosphere | MADLTGLTEEAQSLARIPIFKRLEPHELEHLAEEVDQVNFKAGETIFNEHDRGD |
Ga0182039_117690472 | 3300016422 | Soil | MAPELDNLSEEAQSLARVPLFKRLDASELEHLAEEIDQVNYKAGETIFNEHDRG |
Ga0163161_119048452 | 3300017792 | Switchgrass Rhizosphere | MAAEMNDLSDEAKSLARVPLFKRLEPHELEHLAEEIDQVNYKAGETIFNEHDRG |
Ga0066655_101904163 | 3300018431 | Grasslands Soil | MSANLTNLSDEAQSLSRVSLFKRLEPHELEHLAEEVDQVQFKAGEVIFNEHD |
Ga0066655_111624072 | 3300018431 | Grasslands Soil | MPADMTDLSEEAQSLSRVPLFKRLEPAELEHLAEEVD |
Ga0066662_113055101 | 3300018468 | Grasslands Soil | MSADLTKLSEEAQSLARVPLFKRLDAQELEHLAEEIDQVNYKAGETIF |
Ga0066662_124777881 | 3300018468 | Grasslands Soil | MSANLTKLSDEAQSLSRVPLFKRLEPQELEHLAEEVEQVN |
Ga0193747_10921421 | 3300019885 | Soil | MSAEEIKLSDEADSLSRVPLFKRLEPHELEHLAEDVDQVNYAAGETI |
Ga0193755_11829951 | 3300020004 | Soil | MSADLTKLSDEAQSLARIPLFKRLEPHELEHLAEDVDQVNYAAGATIFK |
Ga0193724_10840682 | 3300020062 | Soil | MSADLNSLSEEAQSLARVPLFKRLEPHELEHLAEDVTQVNYAAGETIFNEHDLGDGLYV |
Ga0247672_10902851 | 3300024187 | Soil | MAAEMNNLSEEAQSLARVPLFRRLEPEELEHLAEEVDQVNYQAG |
Ga0247679_10712641 | 3300024251 | Soil | MAADMNNLSEEAQSLARVPLFKRLEPHELEHLAEEIDQVNYKAGDTIFNEHDRGDA |
Ga0137417_13305114 | 3300024330 | Vadose Zone Soil | MSAELNKLSEEAQSLARVPLFKRLEPHELEHLAEDVDQVNYAAGQTIFNEHDLG |
Ga0137417_135746111 | 3300024330 | Vadose Zone Soil | MSADLTKLSDEAQSLARIPLFKRLEPHELEHLAEDVDQVNYAAGTTIFNEHDLGDGLYVVGNRIGAHLGNG |
Ga0207697_102705841 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAEMNNLSEEAQSLARVPLFRRLEPEKLEHLAEEVDQVNYQA |
Ga0207692_107975741 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MADLTNLSEEAQSLARVPLFKRLEPQELEKLAEEIDQVNYPA |
Ga0207654_108817892 | 3300025911 | Corn Rhizosphere | MSATSNLSDEAQSLARVPLFQRLEPHELEHLADEVEQVNYKAGEII |
Ga0207646_103902541 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAQMNNLSEEAQSLARVPLFKRLEAHELEHLAEEIDQVNYKAGE |
Ga0207646_107876713 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTEGLSHEAESLSRVSLFKRLEPGELETLAAEVDQVNFKAGETIFNESDKGD |
Ga0207646_111822801 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAEMNKLSDEAQSLARVPLFKRLEPDELEHLAEEVDQVNYKAGETI |
Ga0207701_104567603 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAEMNNLSDEAKSLARVPLFKRLEPHELEHLAEEIDQVN |
Ga0207701_105079431 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSATLNLSDEAQSLARVPLFQRLEPHELEHLAEEVEQVNYKAGEIIFHEYDTGDA |
Ga0207706_102409131 | 3300025933 | Corn Rhizosphere | MSATLNLSDEAQSLARVPLFQRLEPHELEHLAEDVEQVDYQAGEIIFHEY |
Ga0207704_100681023 | 3300025938 | Miscanthus Rhizosphere | MSTETDNLSDEARSLARIPLFKRLEPHELEHLAEEVD |
Ga0207711_103087454 | 3300025941 | Switchgrass Rhizosphere | MAPEVENLSDEARSLARIPLFKRLDAAELEHLAEEIDQVNYKAGETIFNEHD |
Ga0207711_113863712 | 3300025941 | Switchgrass Rhizosphere | MSSTSNLSDEAQSLARIPLFQRLEPYELEHLAEDVEQVNYKAGEIIF |
Ga0207689_100690774 | 3300025942 | Miscanthus Rhizosphere | MPDLSELSEEAQSLARVPIFKRLEPHELEHLAQEVDQVNFKA |
Ga0208284_10216262 | 3300026003 | Rice Paddy Soil | MSAISNLSDEAQSLARVPLFQRLEPHELEDLAAEVEQVNYKAGEVIFHEHDTA |
Ga0207708_117928891 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEDLKNLSDEARSLSRIPLFKRLDARELEKLAAEIDQV |
Ga0207641_112489013 | 3300026088 | Switchgrass Rhizosphere | MSAEMNNLTDEARSLARVPLFKRLEPHELEHLAQEIDQVN |
Ga0207641_115950272 | 3300026088 | Switchgrass Rhizosphere | MSAIENLSDEAQSLARVPLFQRLEPHELEHLAEDVEQVNYEAG |
Ga0207648_114112192 | 3300026089 | Miscanthus Rhizosphere | MPDLSELSEEAQSLAHVPIFKRLEPHELERLAREVDQVNFHAGETIFNEHDRGDSLYVV |
Ga0207676_108301623 | 3300026095 | Switchgrass Rhizosphere | MSATSNLSDEAQSLARVPLFQRLEPHELEHLAEDVEQVNYKA |
Ga0207676_109809961 | 3300026095 | Switchgrass Rhizosphere | MSAISNLSDEAQSLARVPLFQRLEPHELEHLAEEVEQVNYQ |
Ga0207676_117603961 | 3300026095 | Switchgrass Rhizosphere | MSAISNLSEEAQSLARVPLFQRLEPHELEHLAEDVEQVNYKS |
Ga0207676_121738802 | 3300026095 | Switchgrass Rhizosphere | MSATLNLSDEAQSLARVPLFQRLEPHELEHLAEEVEQ |
Ga0207674_116173561 | 3300026116 | Corn Rhizosphere | MSATLNLSDEAQSLARVPLFQRLEPHELEHLAEDVEQVDYQAGEIIFHEYDTGDA |
Ga0209267_12488821 | 3300026331 | Soil | MSADLTKLSEEAQSLARVPLFKRLEPHELEHVAEEVDQVKFKDGEVIFNEHDRG |
Ga0209804_12928262 | 3300026335 | Soil | MPTDPTQLSDEAQSLARVPLFKRLEPHELEKLAEEIDQVDYKAGEII |
Ga0257158_10535982 | 3300026515 | Soil | MSDDLTKLSEEAQSLARVPLFKRLEAPELEHLAEEIDQVNYKAGETIFH |
Ga0247685_10271252 | 3300028065 | Soil | MAPEVDNLSDEARSLARIPLFKRLDAAELEHLAEEIDQVNYKA |
Ga0268264_103967711 | 3300028381 | Switchgrass Rhizosphere | MAAEMNNLSEEAQSLARVPLFKRLEAHELEHLAEEVD |
Ga0307504_103906821 | 3300028792 | Soil | MAADLTNLSEEAQSLARVPLFKRLGPQELEKLAEEIDQVNFKNGELIFNEHDRGDS |
Ga0268242_10736202 | 3300030513 | Soil | MSTELTLSDEAQSLSRVPLFKQLDQTELENLAEHVDQVAFASG |
Ga0310813_117603062 | 3300031716 | Soil | MAVISNMSDEAQNLARVPLFQRLELHEVERLAEDVE |
Ga0307469_111325591 | 3300031720 | Hardwood Forest Soil | MAGEVIQLSEEAQSLARVPLFKRLEPHELEKLAEEIDQVNYKAGETIFNE |
⦗Top⦘ |