Basic Information | |
---|---|
Family ID | F060617 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 46 residues |
Representative Sequence | MTEEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDE |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 5.30 % |
% of genes near scaffold ends (potentially truncated) | 18.94 % |
% of genes from short scaffolds (< 2000 bps) | 67.42 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.63 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (32.576 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.939 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.47% β-sheet: 0.00% Coil/Unstructured: 57.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF00303 | Thymidylat_synt | 33.33 |
PF00149 | Metallophos | 1.52 |
PF08459 | UvrC_RNaseH_dom | 1.52 |
PF00574 | CLP_protease | 1.52 |
PF01471 | PG_binding_1 | 1.52 |
PF01966 | HD | 0.76 |
PF00908 | dTDP_sugar_isom | 0.76 |
PF01668 | SmpB | 0.76 |
PF09236 | AHSP | 0.76 |
PF04480 | DUF559 | 0.76 |
PF03951 | Gln-synt_N | 0.76 |
PF00012 | HSP70 | 0.76 |
PF01510 | Amidase_2 | 0.76 |
PF01476 | LysM | 0.76 |
PF00963 | Cohesin | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 33.33 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.03 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 3.03 |
COG0322 | Excinuclease UvrABC, nuclease subunit | Replication, recombination and repair [L] | 1.52 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.52 |
COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.76 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.94 % |
Unclassified | root | N/A | 31.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10012351 | All Organisms → Viruses → Predicted Viral | 3259 | Open in IMG/M |
3300001282|B570J14230_10002407 | Not Available | 7528 | Open in IMG/M |
3300002408|B570J29032_109827052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1503 | Open in IMG/M |
3300002408|B570J29032_109952535 | All Organisms → cellular organisms → Bacteria | 5781 | Open in IMG/M |
3300004240|Ga0007787_10408542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300005582|Ga0049080_10000316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15758 | Open in IMG/M |
3300005582|Ga0049080_10015102 | All Organisms → Viruses → Predicted Viral | 2687 | Open in IMG/M |
3300005662|Ga0078894_10279846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1514 | Open in IMG/M |
3300005955|Ga0073922_1004222 | All Organisms → Viruses → Predicted Viral | 1632 | Open in IMG/M |
3300007542|Ga0099846_1128604 | Not Available | 921 | Open in IMG/M |
3300007545|Ga0102873_1259924 | Not Available | 521 | Open in IMG/M |
3300007639|Ga0102865_1203032 | Not Available | 591 | Open in IMG/M |
3300007708|Ga0102859_1075617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 955 | Open in IMG/M |
3300007972|Ga0105745_1240325 | Not Available | 579 | Open in IMG/M |
3300007973|Ga0105746_1155986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300008267|Ga0114364_1019100 | Not Available | 2886 | Open in IMG/M |
3300008267|Ga0114364_1023684 | All Organisms → Viruses → Predicted Viral | 3270 | Open in IMG/M |
3300008267|Ga0114364_1032838 | All Organisms → Viruses → Predicted Viral | 2012 | Open in IMG/M |
3300008267|Ga0114364_1035456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2789 | Open in IMG/M |
3300008267|Ga0114364_1058564 | Not Available | 1346 | Open in IMG/M |
3300008448|Ga0114876_1223229 | Not Available | 613 | Open in IMG/M |
3300009026|Ga0102829_1074241 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
3300009056|Ga0102860_1216401 | Not Available | 551 | Open in IMG/M |
3300009131|Ga0115027_10573057 | Not Available | 826 | Open in IMG/M |
3300009152|Ga0114980_10000213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 40592 | Open in IMG/M |
3300009152|Ga0114980_10083608 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
3300009155|Ga0114968_10001023 | Not Available | 21315 | Open in IMG/M |
3300009158|Ga0114977_10005660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7938 | Open in IMG/M |
3300009158|Ga0114977_10281562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 952 | Open in IMG/M |
3300009158|Ga0114977_10713591 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300009159|Ga0114978_10000849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25578 | Open in IMG/M |
3300009159|Ga0114978_10401291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300009161|Ga0114966_10000479 | Not Available | 38378 | Open in IMG/M |
3300009164|Ga0114975_10313349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300009165|Ga0105102_10057926 | All Organisms → Viruses → Predicted Viral | 1722 | Open in IMG/M |
3300009165|Ga0105102_10785135 | Not Available | 541 | Open in IMG/M |
3300009170|Ga0105096_10439571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300009181|Ga0114969_10749610 | Not Available | 522 | Open in IMG/M |
3300009183|Ga0114974_10067161 | All Organisms → Viruses → Predicted Viral | 2361 | Open in IMG/M |
3300012017|Ga0153801_1001219 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 5585 | Open in IMG/M |
3300012666|Ga0157498_1076801 | Not Available | 515 | Open in IMG/M |
3300012774|Ga0138283_1330026 | Not Available | 542 | Open in IMG/M |
3300012779|Ga0138284_1391359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300013004|Ga0164293_10099115 | All Organisms → Viruses → Predicted Viral | 2240 | Open in IMG/M |
(restricted) 3300013125|Ga0172369_10462982 | Not Available | 623 | Open in IMG/M |
3300013372|Ga0177922_10931646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300017754|Ga0181344_1006617 | Not Available | 3841 | Open in IMG/M |
3300017754|Ga0181344_1079112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300017754|Ga0181344_1108555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
3300017754|Ga0181344_1133452 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 712 | Open in IMG/M |
3300017761|Ga0181356_1152469 | Not Available | 715 | Open in IMG/M |
3300017777|Ga0181357_1114446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
3300017780|Ga0181346_1150604 | Not Available | 871 | Open in IMG/M |
3300017780|Ga0181346_1310855 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 532 | Open in IMG/M |
3300019784|Ga0181359_1045188 | All Organisms → Viruses → Predicted Viral | 1703 | Open in IMG/M |
3300019784|Ga0181359_1062205 | All Organisms → Viruses → Predicted Viral | 1428 | Open in IMG/M |
3300020141|Ga0211732_1327075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2230 | Open in IMG/M |
3300020141|Ga0211732_1446036 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
3300020151|Ga0211736_10501179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300020151|Ga0211736_10919377 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
3300020159|Ga0211734_10664652 | All Organisms → Viruses → Predicted Viral | 1723 | Open in IMG/M |
3300020160|Ga0211733_10366656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300020162|Ga0211735_10821044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300020492|Ga0208483_1021412 | Not Available | 729 | Open in IMG/M |
3300020540|Ga0208227_1039844 | Not Available | 674 | Open in IMG/M |
3300020550|Ga0208600_1038658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 733 | Open in IMG/M |
3300020558|Ga0208362_1016802 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
3300021140|Ga0214168_1081655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300021141|Ga0214163_1029593 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
3300021516|Ga0194045_1010520 | Not Available | 2550 | Open in IMG/M |
3300021516|Ga0194045_1018288 | All Organisms → Viruses → Predicted Viral | 1867 | Open in IMG/M |
3300021519|Ga0194048_10065887 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
3300021600|Ga0194059_1000386 | Not Available | 21076 | Open in IMG/M |
3300021962|Ga0222713_10123908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1819 | Open in IMG/M |
3300022179|Ga0181353_1003837 | All Organisms → Viruses → Predicted Viral | 3423 | Open in IMG/M |
3300022543|Ga0212119_1054625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 628 | Open in IMG/M |
3300024262|Ga0210003_1016783 | All Organisms → Viruses → Predicted Viral | 4622 | Open in IMG/M |
3300024346|Ga0244775_10667865 | Not Available | 839 | Open in IMG/M |
3300027133|Ga0255070_1018302 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
3300027608|Ga0208974_1001860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8150 | Open in IMG/M |
3300027608|Ga0208974_1015763 | All Organisms → Viruses → Predicted Viral | 2391 | Open in IMG/M |
3300027659|Ga0208975_1144617 | Not Available | 666 | Open in IMG/M |
3300027693|Ga0209704_1038758 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
3300027720|Ga0209617_10323185 | Not Available | 574 | Open in IMG/M |
3300027721|Ga0209492_1000419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13269 | Open in IMG/M |
3300027732|Ga0209442_1213949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 706 | Open in IMG/M |
3300027733|Ga0209297_1008707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5024 | Open in IMG/M |
3300027733|Ga0209297_1043159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2059 | Open in IMG/M |
3300027754|Ga0209596_1002876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13960 | Open in IMG/M |
3300027759|Ga0209296_1015711 | All Organisms → Viruses → Predicted Viral | 4417 | Open in IMG/M |
3300027759|Ga0209296_1208344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300027759|Ga0209296_1299322 | Not Available | 640 | Open in IMG/M |
3300027770|Ga0209086_10000056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 98393 | Open in IMG/M |
3300027782|Ga0209500_10226857 | Not Available | 828 | Open in IMG/M |
3300028178|Ga0265593_1010521 | All Organisms → Viruses → Predicted Viral | 3203 | Open in IMG/M |
3300031746|Ga0315293_10028204 | All Organisms → Viruses → Predicted Viral | 4975 | Open in IMG/M |
3300031758|Ga0315907_10107565 | Not Available | 2387 | Open in IMG/M |
3300031834|Ga0315290_11584783 | Not Available | 529 | Open in IMG/M |
3300031952|Ga0315294_10555870 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
3300031952|Ga0315294_10605986 | Not Available | 979 | Open in IMG/M |
3300032516|Ga0315273_12404674 | Not Available | 611 | Open in IMG/M |
3300033992|Ga0334992_0027952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3397 | Open in IMG/M |
3300033993|Ga0334994_0163038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1241 | Open in IMG/M |
3300033993|Ga0334994_0439066 | Not Available | 621 | Open in IMG/M |
3300033995|Ga0335003_0334083 | Not Available | 669 | Open in IMG/M |
3300033996|Ga0334979_0009946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6558 | Open in IMG/M |
3300034013|Ga0334991_0126438 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
3300034018|Ga0334985_0167516 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1483 | Open in IMG/M |
3300034051|Ga0335024_0277573 | Not Available | 867 | Open in IMG/M |
3300034060|Ga0334983_0000036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 98693 | Open in IMG/M |
3300034061|Ga0334987_0046123 | All Organisms → Viruses → Predicted Viral | 3658 | Open in IMG/M |
3300034061|Ga0334987_0486629 | Not Available | 756 | Open in IMG/M |
3300034061|Ga0334987_0548546 | Not Available | 693 | Open in IMG/M |
3300034061|Ga0334987_0664551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300034062|Ga0334995_0530224 | Not Available | 701 | Open in IMG/M |
3300034063|Ga0335000_0040961 | All Organisms → Viruses → Predicted Viral | 3367 | Open in IMG/M |
3300034066|Ga0335019_0161727 | All Organisms → Viruses → Predicted Viral | 1469 | Open in IMG/M |
3300034082|Ga0335020_0096053 | All Organisms → Viruses → Predicted Viral | 1513 | Open in IMG/M |
3300034093|Ga0335012_0327819 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium | 768 | Open in IMG/M |
3300034101|Ga0335027_0657574 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 629 | Open in IMG/M |
3300034103|Ga0335030_0120847 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
3300034104|Ga0335031_0000530 | Not Available | 29684 | Open in IMG/M |
3300034104|Ga0335031_0052164 | All Organisms → Viruses → Predicted Viral | 2946 | Open in IMG/M |
3300034104|Ga0335031_0337472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
3300034105|Ga0335035_0247796 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
3300034105|Ga0335035_0325814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
3300034106|Ga0335036_0073899 | All Organisms → Viruses → Predicted Viral | 2549 | Open in IMG/M |
3300034106|Ga0335036_0236243 | Not Available | 1246 | Open in IMG/M |
3300034107|Ga0335037_0341353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 813 | Open in IMG/M |
3300034283|Ga0335007_0094368 | All Organisms → Viruses → Predicted Viral | 2226 | Open in IMG/M |
3300034283|Ga0335007_0184314 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
3300034356|Ga0335048_0538534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 25.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.67% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.30% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.79% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.79% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.79% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.79% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.79% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.03% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.52% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.52% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.76% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.76% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.76% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.76% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.76% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.76% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.76% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.76% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.76% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.76% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020492 | Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020540 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020558 | Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021516 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100123515 | 3300000756 | Freshwater And Sediment | MTEEEKDIRIKELEEFLEEVIEHPYMCGSSIWEEGWELLNKNKNDKTRD* |
B570J14230_100024071 | 3300001282 | Freshwater | TYSMMMTEEEKDNRIKELEEFLEDVIEHPYMYGSHIWEEGWELLNKNKIGTL* |
B570J29032_1098270521 | 3300002408 | Freshwater | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGWELLNKTEDDK* |
B570J29032_10995253510 | 3300002408 | Freshwater | MTEEEKDNRIKELEEFIEEVIEHPSMYGSYIWEQGWELLNKNKDE* |
Ga0007787_104085422 | 3300004240 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGCKLLNKDEDE* |
Ga0049080_1000031639 | 3300005582 | Freshwater Lentic | MTEEEKDIRIKELEEFLEEVIEHPYMCGSSIWEEGRKLLNKDEDE* |
Ga0049080_100151025 | 3300005582 | Freshwater Lentic | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDVDDE* |
Ga0078894_102798463 | 3300005662 | Freshwater Lake | MTEEEKDIRIKELEEFIEEVIEHNYMYGSSIWEEGWKLLNKNKDEQKS* |
Ga0073922_10042222 | 3300005955 | Sand | MMTDEEKDNRIKELEEFLENVIEHPYMCGSSIWEEGRKLLNKEEGEQIR* |
Ga0099846_11286041 | 3300007542 | Aqueous | MTEEEKDLRIKELEQFILEYIIDNVYYYGSPLWDKGMELLNIKEDE* |
Ga0102873_12599241 | 3300007545 | Estuarine | MMTDEEKDNRIKELEEFLEEVIEHPYMYGSPIWEEGWELLLLNKDEDDK* |
Ga0102865_12030321 | 3300007639 | Estuarine | KELEEFLEEVIEDSNICGSYIWREGCKLLNKNEDE* |
Ga0102859_10756172 | 3300007708 | Estuarine | MMMTEEEKDNRIKELEEFLEDVIEHPYMYGSHIWEEGWELLNKNKIGTL* |
Ga0105745_12403251 | 3300007972 | Estuary Water | KILTLGKNGKINQNKMTEEEKDIRIKELEEFLEEVIEDSNICGSYIWREGCKLLNKNEDE |
Ga0105746_11559863 | 3300007973 | Estuary Water | MTEEEKDIRIKELEEFLEEVIEDSNICGSYIWREGCKLLNKNEDE* |
Ga0114364_10191009 | 3300008267 | Freshwater, Plankton | MTEEEKDNRIKELEEFLEDVIEHPYMCGSSIWEEGWELLNKNKNDKTRD* |
Ga0114364_10236844 | 3300008267 | Freshwater, Plankton | MTEEEKDIRIKELEEFLEEVIEHNYMYGSSIWEEGWKLLNKNKDEK* |
Ga0114364_10328388 | 3300008267 | Freshwater, Plankton | MTEEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDE* |
Ga0114364_10354569 | 3300008267 | Freshwater, Plankton | MTEEEKDIRIKELEEFLEEVIEDSSIYGSYIWREGWELLNKNE* |
Ga0114364_10585641 | 3300008267 | Freshwater, Plankton | MTEEEKDIRIKELEEFIEDVIEHPYMCGSSIWEEGWELLNKD |
Ga0114876_12232292 | 3300008448 | Freshwater Lake | MTEEEKDIRIKELEEFLEEVIEHPYMCGSPIWEEGWELLNKNKDE* |
Ga0102829_10742412 | 3300009026 | Estuarine | MTEEEKDIRIKELEEFLEDVIEHPYMCGSSIWEEGRKLLNKDEDE* |
Ga0102860_12164011 | 3300009056 | Estuarine | MMTDEEKDNRIKELEEFLEDVIEHPYMCGSSIWEEGRKLLNKEEGEQIR* |
Ga0115027_105730572 | 3300009131 | Wetland | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKTEDDNRS* |
Ga0114980_1000021342 | 3300009152 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDE* |
Ga0114980_100836084 | 3300009152 | Freshwater Lake | MTDEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKTEDE* |
Ga0114968_100010236 | 3300009155 | Freshwater Lake | MTEEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGCKLLNKDEDDE* |
Ga0114977_1000566023 | 3300009158 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDE* |
Ga0114977_102815622 | 3300009158 | Freshwater Lake | EEEKDNRIKELEEFLEEVIEDSSMYGSHIWKEGWELLNKDKDE* |
Ga0114977_107135912 | 3300009158 | Freshwater Lake | MTEEKKDIRIKELEEFLEEVIEDPSMYGSHIWKEGWELLNKDKDEQFR* |
Ga0114978_1000084942 | 3300009159 | Freshwater Lake | EEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDE* |
Ga0114978_104012914 | 3300009159 | Freshwater Lake | EEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDE* |
Ga0114966_1000047954 | 3300009161 | Freshwater Lake | MTEEEKDIRIKELEEFLEDVIEHPYMYGSTIWKEGCKLLNKDE* |
Ga0114975_103133491 | 3300009164 | Freshwater Lake | EEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDE* |
Ga0105102_100579262 | 3300009165 | Freshwater Sediment | MMMTEEEKDNRIKELEEFLEDVIEHPYMYGSHIWEEGRELLNKNKNENGTKH* |
Ga0105102_107851352 | 3300009165 | Freshwater Sediment | MTDEEKDIRIKELEEFIEDVIEHPYIFGSPIWKKGCKLLNKDEDE* |
Ga0105096_104395712 | 3300009170 | Freshwater Sediment | MTDEEKDKRIKELEEFIENIIENVYYYGSPIWREGCKLLNKNEDE* |
Ga0114969_107496101 | 3300009181 | Freshwater Lake | MTEEEKDIRIKELEEFLEDVIEHPYMYGSHIWEQGWE |
Ga0114974_100671617 | 3300009183 | Freshwater Lake | MMTEEEKDIRIKELEEFLEDVIEHPYMYGSHIWEQGWELLNKNKNKDE* |
Ga0153801_10012192 | 3300012017 | Freshwater | MTEEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKTEDE* |
Ga0157498_10768012 | 3300012666 | Freshwater, Surface Ice | MMTDEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKTEDE* |
Ga0138283_13300262 | 3300012774 | Freshwater Lake | MMTDEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDE* |
Ga0138284_13913592 | 3300012779 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKTEDE* |
Ga0164293_100991156 | 3300013004 | Freshwater | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEKGCKLLNKTEDDK* |
(restricted) Ga0172369_104629823 | 3300013125 | Freshwater | MTEEEKDIRIKELEEFIENIIENPYYYGSPIWEEGWKLLNKDKDE* |
Ga0177922_109316462 | 3300013372 | Freshwater | MTEEEKDIRIKELEEFLEEVIENSSIYGSYIWREGWELLNKNKNKDE* |
Ga0181344_10066172 | 3300017754 | Freshwater Lake | MKEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGCKLLNKDEDE |
Ga0181344_10791125 | 3300017754 | Freshwater Lake | LTLGKNGKTNQNKMTEEEKDNRIKELEEFLEEVIEDSSMYGSHIWKEGWELLNKDK |
Ga0181344_11085553 | 3300017754 | Freshwater Lake | MTEEEKDIRIKELEEFIEEVIEHNYMYGSSIWEEGWKLLNKNKDEQKS |
Ga0181344_11334523 | 3300017754 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDDN |
Ga0181356_11524693 | 3300017761 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGWELLNKNKDE |
Ga0181357_11144464 | 3300017777 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMCGSSIWEEGWELLNKNKDEDDK |
Ga0181346_11506044 | 3300017780 | Freshwater Lake | MTDEEKDIRIKELEEFLEDVIEHPYMCGLSIWEEGWELLNKNKDE |
Ga0181346_13108552 | 3300017780 | Freshwater Lake | MTEEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDE |
Ga0181359_10451882 | 3300019784 | Freshwater Lake | MTDEEKDIRIKELEEFLEDVIEHPYMCGSSIWEEGWELLNKNKDE |
Ga0181359_10622052 | 3300019784 | Freshwater Lake | LTLGKNGKTNHNKMTEEEKDIRIKELEEFLEEVIEDSNICGSYIWREGCKLLNKNEDE |
Ga0211732_13270756 | 3300020141 | Freshwater | MMTEEEKDIRIKELEEFLEEVVEHPYMCGSPIWEEGWELLNKNKDE |
Ga0211732_14460362 | 3300020141 | Freshwater | MTEEEKDIRIKELEEFLEEVIEDSSMYGSHIWKEGCKLLNKDEDE |
Ga0211736_105011793 | 3300020151 | Freshwater | MTEEEKDIRIKELEEFLEEVIEHPYMCGSSIWEEGWKLLNKNKDE |
Ga0211736_109193775 | 3300020151 | Freshwater | MTEEEKDIRIKELEEFLEDVIEHPYMYGSSIWEQGRKLLNIEEEDDDDE |
Ga0211734_106646528 | 3300020159 | Freshwater | MTEEEKDIRIKELEEFLEDVIEHPYMCGSSIWEQGRKLLNIEEEDDDDDE |
Ga0211733_103666562 | 3300020160 | Freshwater | MTEEEKDIRIKELEEFLEEVIEHPYMCGSSIWEEGWKLLNKNKDDKTRD |
Ga0211735_108210443 | 3300020162 | Freshwater | MTEEEKDIRIKELEEFLEEVIEHPYMCGSPIWEEGWELLNKNKDE |
Ga0208483_10214122 | 3300020492 | Freshwater | MMTDEEKDNRIKELEEFLEDVIEHPYMCGSSIWEEGRKLLNKEEGEQIR |
Ga0208227_10398441 | 3300020540 | Freshwater | MMTDEEKDNRIKELEEFLEDVIEHPYMCGSSIWEEGRKLLNKEEG |
Ga0208600_10386582 | 3300020550 | Freshwater | MMMTEEEKDNRIKELEEFLEDVIEHPYMYGSHIWEEGWELLNKNKIGTL |
Ga0208362_10168022 | 3300020558 | Freshwater | MSDEEKDKRIKELEEFIENIIKDVYYYGSPIWREGCKLLNKNEDE |
Ga0214168_10816552 | 3300021140 | Freshwater | MSDEEKDKRIKELEEFIENIINDVYYYGSPIWREGCKLLNKNEDE |
Ga0214163_10295933 | 3300021141 | Freshwater | MTEEEKDIRIKELEEFLEDVIEHPYMCGSSIWEEGWELLNKNKDE |
Ga0194045_10105205 | 3300021516 | Anoxic Zone Freshwater | LTLGKNGKTNQNKMTEEEKDIRIKELEEFLEEVIEDSSIYGSYIWREGCKLLNKDEDE |
Ga0194045_10182884 | 3300021516 | Anoxic Zone Freshwater | MTEEEKDIRIKELEEFLEEVIEHPYMCGSSIWEEGWELLNKNKDE |
Ga0194048_100658872 | 3300021519 | Anoxic Zone Freshwater | LTLGKNGKTNQNKMTEEEKDIRIKKLEEFLEEVIEDSSIYGSYIWREGCKLLNKDEDE |
Ga0194059_100038617 | 3300021600 | Anoxic Zone Freshwater | MEKINQNKMTAEEKDIRIKELEEFLEEVIEDSSIYGSYIWREGCKLLNKDEDE |
Ga0222713_101239082 | 3300021962 | Estuarine Water | MTEEEKDIRIKELEEFLEEVIEHPYMYGSPIWEEGWELLLLNKDEDDK |
Ga0181353_10038377 | 3300022179 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGCKLLNKDEDE |
Ga0212119_10546251 | 3300022543 | Freshwater | RTHSIMMTDEEKDNRIKELEEFLEDVIEHPYMCGSSIWEEGRKLLNKEEGEQIR |
Ga0210003_10167836 | 3300024262 | Deep Subsurface | MTEEEKDNRIKELEEFLEDVIEHPYMCGSSIWEEGRKLLNKEEDE |
Ga0244775_106678652 | 3300024346 | Estuarine | MMTDEEKDNRIKELEEFLENVIEHPYMCGSSIWEEGRKLLNKEEGEQIR |
Ga0255070_10183026 | 3300027133 | Freshwater | EEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGCKLLNKDEDE |
Ga0208974_10018607 | 3300027608 | Freshwater Lentic | MTEEEKDIRIKELEEFLEEVIEHPYMCGSSIWEEGRKLLNKDEDE |
Ga0208974_10157633 | 3300027608 | Freshwater Lentic | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDVDDE |
Ga0208975_11446171 | 3300027659 | Freshwater Lentic | MTEEEKDNRIKELEEFLEDVIEHPYMCGSSIWEEGRKLLNKDE |
Ga0209704_10387586 | 3300027693 | Freshwater Sediment | MMMTEEEKDNRIKELEEFLEDVIEHPYMYGSHIWEEGRELLNKNKNENGTKH |
Ga0209617_103231852 | 3300027720 | Freshwater And Sediment | MTEEEKDIRIKELEEFLEEVIEHPYMCGSSIWEEGWELLNKNKNDKTRD |
Ga0209492_100041918 | 3300027721 | Freshwater Sediment | MTDEEKDIRIKELEEFIEDVIEHPYIFGSPIWKKGCKLLNKDEDE |
Ga0209442_12139492 | 3300027732 | Freshwater Lake | MTDEEKDIRIKELEEFLEEVIEDSNICGSYIWREGCKLLNKNEDE |
Ga0209297_100870711 | 3300027733 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDE |
Ga0209297_10431593 | 3300027733 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDE |
Ga0209596_100287634 | 3300027754 | Freshwater Lake | MTEEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGCKLLNKDEDDE |
Ga0209296_101571111 | 3300027759 | Freshwater Lake | MMTEEEKDIRIKELEEFLEDVIEHPYMYGSHIWEQGWELLNKNKNKDE |
Ga0209296_12083441 | 3300027759 | Freshwater Lake | IKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKTEDE |
Ga0209296_12993221 | 3300027759 | Freshwater Lake | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNK |
Ga0209086_1000005672 | 3300027770 | Freshwater Lake | LGYDLNRNVKMTEEEKDIRIKELEEFLEDVIEHPYMYGSTIWKEGCKLLNKDE |
Ga0209500_102268571 | 3300027782 | Freshwater Lake | MTDEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLN |
Ga0265593_10105217 | 3300028178 | Saline Water | MTEEEKDIRIKELEEFLEEVIEHPYMYGSPIWEEGRKLLNKDEDE |
Ga0315293_100282045 | 3300031746 | Sediment | MTEEEKDIRIKELEEFLEDVIEHPYMCGSSIWEEGWELLNKNKNKNKDE |
Ga0315907_101075657 | 3300031758 | Freshwater | MTEEEKDIRIKELEEFLEEVIEHNYMYGSSIWEEGWKLLNKNKDEK |
Ga0315290_115847832 | 3300031834 | Sediment | MMTDEEKDNRIKELEEFLEDVIEHPYMYGSSIWEEGRKLLNKEEDE |
Ga0315294_105558701 | 3300031952 | Sediment | MTEEEKDNRIKELEEFLEDVIEHPYMFGSPIWEQGWELLNKNKNKNKDE |
Ga0315294_106059863 | 3300031952 | Sediment | MTEEEKDIRIKELEEFLEDVIEHPYMCGSSIWEEGWELLNKNKNENGTRH |
Ga0315273_124046743 | 3300032516 | Sediment | DEEKDIRIKELEEFLEDVIEHPYMCGSSIWEEGWELLNKNKNENGTRH |
Ga0334992_0027952_3201_3347 | 3300033992 | Freshwater | MTDEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKEEGEQIR |
Ga0334994_0163038_956_1096 | 3300033993 | Freshwater | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGWELLNKTEDDK |
Ga0334994_0439066_52_189 | 3300033993 | Freshwater | MTEEEKDNRIKELEEFIEEVIEHPSMYGSYIWEQGWELLNKNKDE |
Ga0335003_0334083_544_669 | 3300033995 | Freshwater | MTDEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKD |
Ga0334979_0009946_1797_1937 | 3300033996 | Freshwater | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEKGCKLLNKTEDDK |
Ga0334991_0126438_632_769 | 3300034013 | Freshwater | MTDEEKDIRIKELEEFLEDVIEHPYMCGSSIWEEGRKLLNKTEDE |
Ga0334985_0167516_234_386 | 3300034018 | Freshwater | MTEEEKDIRIKELEEFLEEVIEHPYMCGSPIWEEGWELLNKNKDENGTRN |
Ga0335024_0277573_735_866 | 3300034051 | Freshwater | MTEEEKDIRIKELEEFLEDVIEHPYMCGSSIWEEGWELLNKNKD |
Ga0334983_0000036_1547_1684 | 3300034060 | Freshwater | MTEEEKDIRIKELEEFLEEVIEHPYMCGSPIWEEGWELLNKDKDE |
Ga0334987_0046123_169_315 | 3300034061 | Freshwater | MTEEEKDNRIKELEEFLEEVIEHPYMYGSHIWEEGCKLLNKDEDEQTR |
Ga0334987_0486629_312_449 | 3300034061 | Freshwater | MTEEEKDNRIKELEEFIENIIEDVYYYGSPIWREGCKLLNKNEDE |
Ga0334987_0548546_3_107 | 3300034061 | Freshwater | MMMTEEEKDNRIKELEEFLEEVIEHPYMYGSHIWE |
Ga0334987_0664551_411_563 | 3300034061 | Freshwater | MTEEEKDIRIKELEEFLEEVIEHPYMCGSPIWEEGWELLNKNKDENGTRY |
Ga0334995_0530224_529_666 | 3300034062 | Freshwater | MSDEEKDKRIKELEEFIENIIEDVYYYGSPIWREGCKLLNKNEDE |
Ga0335000_0040961_209_349 | 3300034063 | Freshwater | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDDE |
Ga0335019_0161727_256_402 | 3300034066 | Freshwater | MTEEEKDIRIKELEEFLEDVIEHPYMYGSSIWEEGRKLLNKEEGEQIR |
Ga0335020_0096053_488_625 | 3300034082 | Freshwater | MTEEEKDIRIKELEGFLEEVIEDPSMYGSHIWKEGCKLLNKDENE |
Ga0335012_0327819_141_287 | 3300034093 | Freshwater | MTEEEKDIRIKELEEFLEDVIEHPYMYGSPIWDEGWELLLLNKDEDDK |
Ga0335027_0657574_226_363 | 3300034101 | Freshwater | MTEEEKDKRIKELEEFIENIINDVYYYGSPIWREGCKLLNKNKDE |
Ga0335030_0120847_419_559 | 3300034103 | Freshwater | MTEEEKDIRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDDE |
Ga0335031_0000530_127_258 | 3300034104 | Freshwater | MTEEEKDNRIKELEEFLENVIEHPYMYGSPIWEEGRKLLNKDE |
Ga0335031_0052164_2308_2457 | 3300034104 | Freshwater | MMMTEEEKDNRIKELEEFLEEVIEHPYMYGSHIWEEGWELLNKNKIGTL |
Ga0335031_0337472_696_833 | 3300034104 | Freshwater | MTEEEKDIRIKKLEEFLEEVIEHPYMCGSPIWEEGWELLNKNNDE |
Ga0335035_0247796_938_1072 | 3300034105 | Freshwater | MMMTEEEKDNRIKELEEFLEDVIEHPYMYGSHIWEEGWELLNKNK |
Ga0335035_0325814_489_629 | 3300034105 | Freshwater | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWEEGRKLLNKDEDDK |
Ga0335036_0073899_1550_1687 | 3300034106 | Freshwater | MTDEEKDIRIKELEEFLEDVIEHPYMCGSSIWEEGWELLNKNKNE |
Ga0335036_0236243_3_134 | 3300034106 | Freshwater | MMMTEEEKDNRIKELEEFLEEVIEHPYMYGSHIWEEGCKLLNKD |
Ga0335037_0341353_703_813 | 3300034107 | Freshwater | ELEEFLEDVIEHPYMYGSHIWEEGWELLNKNKIGTL |
Ga0335007_0094368_1800_1937 | 3300034283 | Freshwater | MTEEEKDIRIKELEEFLEEVIEDSNICGSYIWREGCKLLNKNEDE |
Ga0335007_0184314_123_266 | 3300034283 | Freshwater | MTEEEKDNRIKELEEFLEEVIEHPYMYGSHIWEEGWELLNKNKIGTL |
Ga0335048_0538534_101_247 | 3300034356 | Freshwater | MTEEEKDNRIKELEEFLEDVIEHPYMYGSPIWDEGWELLLLNKDEDDK |
⦗Top⦘ |