NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060386

Metagenome / Metatranscriptome Family F060386

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060386
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 46 residues
Representative Sequence VNTSVARRIARQTGLAVREARVVGSQHGYQHLMIALAGGQRAFA
Number of Associated Samples 118
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 72.73 %
% of genes near scaffold ends (potentially truncated) 97.74 %
% of genes from short scaffolds (< 2000 bps) 93.23 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (60.902 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.556 % of family members)
Environment Ontology (ENVO) Unclassified
(22.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.105 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.06%    β-sheet: 0.00%    Coil/Unstructured: 56.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF01451LMWPc 90.23
PF01757Acyl_transf_3 6.77
PF00753Lactamase_B 0.75



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A60.90 %
All OrganismsrootAll Organisms39.10 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003219|JGI26341J46601_10106660Not Available812Open in IMG/M
3300003219|JGI26341J46601_10113310Not Available781Open in IMG/M
3300005167|Ga0066672_10648872Not Available682Open in IMG/M
3300005178|Ga0066688_10542523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia748Open in IMG/M
3300005328|Ga0070676_10518814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia848Open in IMG/M
3300005354|Ga0070675_100722960Not Available907Open in IMG/M
3300005355|Ga0070671_100741132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia854Open in IMG/M
3300005355|Ga0070671_100790217Not Available826Open in IMG/M
3300005363|Ga0008090_15339597Not Available574Open in IMG/M
3300005434|Ga0070709_10486308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales935Open in IMG/M
3300005434|Ga0070709_11575513Not Available534Open in IMG/M
3300005435|Ga0070714_101855261Not Available588Open in IMG/M
3300005437|Ga0070710_10514173Not Available821Open in IMG/M
3300005437|Ga0070710_10885301Not Available643Open in IMG/M
3300005439|Ga0070711_100268015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1346Open in IMG/M
3300005451|Ga0066681_10934323Not Available519Open in IMG/M
3300005471|Ga0070698_101382398Not Available655Open in IMG/M
3300005546|Ga0070696_100734249Not Available807Open in IMG/M
3300005591|Ga0070761_10631158Not Available668Open in IMG/M
3300005602|Ga0070762_10459944Not Available829Open in IMG/M
3300005617|Ga0068859_101769236Not Available683Open in IMG/M
3300005842|Ga0068858_102487160Not Available512Open in IMG/M
3300005921|Ga0070766_10249780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1125Open in IMG/M
3300006102|Ga0075015_101033612Not Available504Open in IMG/M
3300006163|Ga0070715_10364527Not Available793Open in IMG/M
3300006173|Ga0070716_100566286Not Available849Open in IMG/M
3300006175|Ga0070712_100084184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2311Open in IMG/M
3300006755|Ga0079222_10164403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1283Open in IMG/M
3300006804|Ga0079221_10335639All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300007788|Ga0099795_10588113Not Available528Open in IMG/M
3300009011|Ga0105251_10248753Not Available801Open in IMG/M
3300009098|Ga0105245_11751475Not Available674Open in IMG/M
3300009143|Ga0099792_10965896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300009698|Ga0116216_10623352Not Available649Open in IMG/M
3300009839|Ga0116223_10480213Not Available725Open in IMG/M
3300009839|Ga0116223_10833398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300010341|Ga0074045_10105417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1947Open in IMG/M
3300010373|Ga0134128_12165259Not Available612Open in IMG/M
3300010379|Ga0136449_103934837Not Available556Open in IMG/M
3300010379|Ga0136449_104424190Not Available518Open in IMG/M
3300010396|Ga0134126_11025835Not Available923Open in IMG/M
3300011270|Ga0137391_10928889All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300012189|Ga0137388_10811614Not Available867Open in IMG/M
3300012207|Ga0137381_11122163Not Available676Open in IMG/M
3300012357|Ga0137384_11066357Not Available649Open in IMG/M
3300012927|Ga0137416_12242839Not Available502Open in IMG/M
3300012958|Ga0164299_10047074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1992Open in IMG/M
3300012985|Ga0164308_11299775Not Available660Open in IMG/M
3300012989|Ga0164305_11189764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300014201|Ga0181537_10751883Not Available662Open in IMG/M
3300014745|Ga0157377_10594612Not Available788Open in IMG/M
3300016371|Ga0182034_10358409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1186Open in IMG/M
3300016422|Ga0182039_10328843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1276Open in IMG/M
3300017821|Ga0187812_1059415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1279Open in IMG/M
3300017975|Ga0187782_10584413Not Available857Open in IMG/M
3300018035|Ga0187875_10297306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium874Open in IMG/M
3300018060|Ga0187765_10957101Not Available584Open in IMG/M
3300018085|Ga0187772_11230693Not Available552Open in IMG/M
3300018433|Ga0066667_10724103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Acidothermales → Acidothermaceae → Acidothermus → Acidothermus cellulolyticus837Open in IMG/M
3300018433|Ga0066667_11426207Not Available609Open in IMG/M
3300019885|Ga0193747_1130142Not Available589Open in IMG/M
3300020581|Ga0210399_11118121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300020582|Ga0210395_10659857Not Available783Open in IMG/M
3300021088|Ga0210404_10344387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Acidothermales → Acidothermaceae → Acidothermus → Acidothermus cellulolyticus826Open in IMG/M
3300021171|Ga0210405_11102170Not Available593Open in IMG/M
3300021180|Ga0210396_11647472Not Available523Open in IMG/M
3300021362|Ga0213882_10088147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1251Open in IMG/M
3300021401|Ga0210393_11585457Not Available519Open in IMG/M
3300021402|Ga0210385_11567978Not Available503Open in IMG/M
3300021403|Ga0210397_10066793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2346Open in IMG/M
3300021432|Ga0210384_11489211Not Available582Open in IMG/M
3300021479|Ga0210410_10301371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1438Open in IMG/M
3300021560|Ga0126371_10615312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1235Open in IMG/M
3300021560|Ga0126371_12173847Not Available669Open in IMG/M
3300025898|Ga0207692_10174290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1249Open in IMG/M
3300025898|Ga0207692_10588026Not Available714Open in IMG/M
3300025915|Ga0207693_10840511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Acidothermales → Acidothermaceae → Acidothermus → Acidothermus cellulolyticus706Open in IMG/M
3300025929|Ga0207664_10890901Not Available799Open in IMG/M
3300025931|Ga0207644_10960143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia717Open in IMG/M
3300025939|Ga0207665_10483135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria955Open in IMG/M
3300025939|Ga0207665_10925341Not Available692Open in IMG/M
3300027765|Ga0209073_10231253Not Available713Open in IMG/M
3300027824|Ga0209040_10156325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1225Open in IMG/M
3300027855|Ga0209693_10497729Not Available583Open in IMG/M
3300027895|Ga0209624_10291258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1087Open in IMG/M
3300028015|Ga0265353_1017992Not Available675Open in IMG/M
3300028138|Ga0247684_1063930Not Available601Open in IMG/M
3300028379|Ga0268266_11876011Not Available573Open in IMG/M
3300028381|Ga0268264_10265883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1600Open in IMG/M
3300028784|Ga0307282_10348015Not Available716Open in IMG/M
3300028875|Ga0307289_10232056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia759Open in IMG/M
3300028885|Ga0307304_10025897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2025Open in IMG/M
3300029951|Ga0311371_10354115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2028Open in IMG/M
3300030503|Ga0311370_10380689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1783Open in IMG/M
3300030618|Ga0311354_11596690Not Available574Open in IMG/M
3300031572|Ga0318515_10474481Not Available668Open in IMG/M
3300031765|Ga0318554_10346536Not Available844Open in IMG/M
3300031769|Ga0318526_10085004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1250Open in IMG/M
3300031777|Ga0318543_10333389Not Available679Open in IMG/M
3300031779|Ga0318566_10275179Not Available834Open in IMG/M
3300031805|Ga0318497_10206785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300031819|Ga0318568_10042364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2595Open in IMG/M
3300031823|Ga0307478_11432931Not Available573Open in IMG/M
3300031831|Ga0318564_10030119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2306Open in IMG/M
3300031833|Ga0310917_11001458Not Available560Open in IMG/M
3300031833|Ga0310917_11216601Not Available501Open in IMG/M
3300031835|Ga0318517_10350880Not Available667Open in IMG/M
3300031845|Ga0318511_10090568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1290Open in IMG/M
3300031860|Ga0318495_10385629Not Available618Open in IMG/M
3300031879|Ga0306919_11019880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Acidothermales → Acidothermaceae → Acidothermus → Acidothermus cellulolyticus632Open in IMG/M
3300031897|Ga0318520_10029068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2741Open in IMG/M
3300031954|Ga0306926_11024690Not Available981Open in IMG/M
3300031962|Ga0307479_11437884Not Available648Open in IMG/M
3300032001|Ga0306922_11228750Not Available761Open in IMG/M
3300032001|Ga0306922_11554180Not Available660Open in IMG/M
3300032035|Ga0310911_10431006Not Available763Open in IMG/M
3300032043|Ga0318556_10675382Not Available538Open in IMG/M
3300032066|Ga0318514_10232327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia969Open in IMG/M
3300032066|Ga0318514_10313358Not Available830Open in IMG/M
3300032089|Ga0318525_10105580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1437Open in IMG/M
3300032174|Ga0307470_10224379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1221Open in IMG/M
3300032770|Ga0335085_12199174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300032783|Ga0335079_11876528Not Available581Open in IMG/M
3300032805|Ga0335078_11222946Not Available865Open in IMG/M
3300032828|Ga0335080_10220549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2080Open in IMG/M
3300032892|Ga0335081_11193081Not Available868Open in IMG/M
3300032892|Ga0335081_12329099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300032892|Ga0335081_12336050Not Available558Open in IMG/M
3300032893|Ga0335069_10361248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1713Open in IMG/M
3300032895|Ga0335074_10544543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1184Open in IMG/M
3300032954|Ga0335083_11155679Not Available602Open in IMG/M
3300032955|Ga0335076_11174453Not Available651Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.28%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.02%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.51%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.76%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.01%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.01%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.01%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.26%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.26%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.26%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.26%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.50%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.75%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.75%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.75%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.75%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028015Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26341J46601_1010666023300003219Bog Forest SoilVTSFASAARQVARQTGLAVREARIAGSQHGYQHLMLTLAGGRRAFAK
JGI26341J46601_1011331023300003219Bog Forest SoilVTSFTSAVRQVARQTGLAVRGARVVGXQHGYQHLMITLAGGRR
Ga0066672_1064887213300005167SoilVKLVNQTAAHRIARLTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVAPVQEA
Ga0066688_1054252323300005178SoilVNTSVARQIARQTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVA
Ga0070676_1051881433300005328Miscanthus RhizosphereVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALPGGQRAFAKVAG
Ga0070675_10072296033300005354Miscanthus RhizosphereVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALLGGQRAFAKVAAEQEAV
Ga0070671_10074113213300005355Switchgrass RhizosphereVSLSVARRIARQTGLPVREARVVGSQHGYQHLIIALPGGQR
Ga0070671_10079021723300005355Switchgrass RhizosphereVTSRTSAARRIARLTGLAVRDARVVGAQHGYQHLMVTLSGGQRAFAKV
Ga0008090_1533959723300005363Tropical Rainforest SoilVTLVNLSAARRIGRQTGLAVREARVVGSQHGYQHLMLALA
Ga0070709_1048630833300005434Corn, Switchgrass And Miscanthus RhizosphereVKLVNEPAAHRIARLTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVANQEQ
Ga0070709_1157551313300005434Corn, Switchgrass And Miscanthus RhizosphereVKLVNESAAHRIARLTGLAVREARVVGSQHGYQHLMIALAGGQRAF
Ga0070714_10185526113300005435Agricultural SoilVSLSVARRIAGQTGLAVREARVVGSQHGYQHLIIALPGGQRAFAKVAAEQEAVP
Ga0070710_1051417313300005437Corn, Switchgrass And Miscanthus RhizosphereVKLVNEPAAHRIARLTGLAVREARVVGSQHGYQHLMIALAGGQRAF
Ga0070710_1088530113300005437Corn, Switchgrass And Miscanthus RhizosphereVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALPGGQRAFAKVAAEQEAVP
Ga0070711_10026801513300005439Corn, Switchgrass And Miscanthus RhizosphereVKLVNESAAHRIARLTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVANQEQA
Ga0066681_1093432323300005451SoilVKLVNQTAAHRIARLTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVA
Ga0070698_10138239823300005471Corn, Switchgrass And Miscanthus RhizosphereVSLSVARRIARQTGLAVREARVVGSQPGYQHLIIALPGGQRAFAKVAAEQ
Ga0070696_10073424923300005546Corn, Switchgrass And Miscanthus RhizosphereVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALPGGQRAFAKVAAE
Ga0070761_1063115813300005591SoilVNPAASRIARLTGLPVREARVAGSQHGYQHLMITLVGGQRAFAKALP
Ga0070762_1045994433300005602SoilVSPRTASQIARLSGLAVREARQVGSQHGYQHFMITLAGGRRAFAKV
Ga0068859_10176923613300005617Switchgrass RhizosphereVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALPG
Ga0068858_10248716013300005842Switchgrass RhizosphereVKLVNESAAHRIARLTGLAVREARVVGSQHGYQHLIIALPGGQRAFAKVAA
Ga0070766_1024978043300005921SoilVNTSVARRIARLTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVA
Ga0075015_10103361223300006102WatershedsVTSFTSAARQVARQTGLAVREARVVGSQHGYQHLM
Ga0070715_1036452713300006163Corn, Switchgrass And Miscanthus RhizosphereMTFTSAARRIARQTGLSVRAVRAVGSQHGYQHLMITLAGGQRAFAKVTAHEEAP
Ga0070716_10056628633300006173Corn, Switchgrass And Miscanthus RhizosphereVNSSVAHRIAQQTGLAVREARVVGSQHGYQHLIIALAGGQRAFAK
Ga0070712_10008418413300006175Corn, Switchgrass And Miscanthus RhizosphereVTSFTSAARRIASLTGLAVRDARVVGAQHGYQHLLITLSGGQRAFAKVAPDDD
Ga0079222_1016440313300006755Agricultural SoilVTSFTSAARRIASLTGLAVRDARVVGAQHGYQHLLITLSGGQR
Ga0079221_1033563913300006804Agricultural SoilVSLSVARRIGRQTGLAVREARVVGSQHGYQHLIIALPGGQR
Ga0099795_1058811313300007788Vadose Zone SoilVKLVNPSAARRIARQTGLAVREARVVGAQHGYQHLMIALAGGQRAF
Ga0105251_1024875323300009011Switchgrass RhizosphereVTSFTSAARRIASLTGLAVRDARVVGAQHGYQHLLITLSGGQRAFA
Ga0105245_1175147513300009098Miscanthus RhizosphereVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALP
Ga0099792_1096589613300009143Vadose Zone SoilVTLFTSAASRIARQTGLAVREARVVGSQHGYQHLMITLTGGRRAFAKVAADAAPGAP
Ga0116216_1062335223300009698Peatlands SoilVTSFTSAARQVAGQTGLPVREARVVGSQHGYQHLMLTLA
Ga0116223_1048021323300009839Peatlands SoilVTSFTSAARQVARQTGLAVREARVVGSQHGYQHLMLTLAGGQRAFAKVAAAATAEAATG*
Ga0116223_1083339813300009839Peatlands SoilVTSFTSATRQVARQTGLAVREARVVGSQHGYQHLM
Ga0074045_1010541713300010341Bog Forest SoilVTSFASAARQVARQSGLAVREARVVGSQHGYQHLMLTLAGGQR
Ga0134128_1216525923300010373Terrestrial SoilVTSFTSAARRIASLTGLAVRDARVVGAQHGYQHLLI
Ga0136449_10393483723300010379Peatlands SoilVTSFTSATRQVARQTGLAVREARVVGSQHGYQHLMITLAGGRRAFAKVAAAASPAT
Ga0136449_10442419023300010379Peatlands SoilVTSFTSAARQVARQTGLAVREARVVGSQHGYQHLLITLAGGRRAFAKMAAASPATVGSLATGASP
Ga0134126_1102583513300010396Terrestrial SoilVSLSVARRIAWQTGLPVREARVVGSQHGYQHLIIALPGGQRAFAKVAAEQEAVPA
Ga0137391_1092888913300011270Vadose Zone SoilVTSFGSAARRIARQTGLPVREARVVGSQHGYQHLLLTLAGGRRAFAK
Ga0137388_1081161413300012189Vadose Zone SoilVTSFGSAARQIARQTGLPVREARVVGSQHGYQHLLLTL
Ga0137381_1112216323300012207Vadose Zone SoilVSLSAARRIAQQTGLPVREARVVGSQHGYQHLIIALAGGQRAFAKVAAEQ
Ga0137384_1106635723300012357Vadose Zone SoilMTSLTSVARRVARLTGLAVRDARVVGAQHGYQHLMVTLAGGQRAFAKVADQDGPSAPGSPAPAGTG
Ga0137416_1224283923300012927Vadose Zone SoilVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALAGGQRAFA
Ga0164299_1004707433300012958SoilVKLVNEPAAHRIARLTGLAVREARVVGSQHGYHHLMIALAGGQ
Ga0164308_1129977513300012985SoilVSLSVARRIARQTGLAVREARVVGSQHGYRHMIIALPGGQRAFAKVAAE
Ga0164305_1118976433300012989SoilMTFTSAARRIARQTGLSVRAVRAVGSQHGYQHLMITLAGGQRAFAKVTAPEEAPA
Ga0181537_1075188313300014201BogVSSAASRIARLTGLSVRDARVVGSQHGYQHLMLTLAGGQRAFAK
Ga0157377_1059461233300014745Miscanthus RhizosphereVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALPGGQR
Ga0182034_1035840913300016371SoilVNLSAARRIARQTGLAVREARVVGSQHGYQHLMLALAGG
Ga0182039_1032884333300016422SoilVNLSPARRIARQTGLAVREARAVGAQHGYQHLMLALAGGQRAFAKVAA
Ga0187812_105941533300017821Freshwater SedimentVTSFTSAARQIARQTGLAVREARVVGAQHGYQHLMITL
Ga0187782_1058441313300017975Tropical PeatlandVTFTSAARRIAGLTGLAVREARVVGAQHGYRHVMITLSGGQRAFAKVAPEP
Ga0187875_1029730623300018035PeatlandVTPAARRIARLTGLAVRDARVVGAQHGYQHLMVTLAGGQRAFAKVAA
Ga0187765_1095710123300018060Tropical PeatlandVTLVSLSAARRIGRQTGLAVREARVVGSQHGYQHLMLALPGGQRAFAKVAAVGDRAQDAA
Ga0187772_1123069323300018085Tropical PeatlandVNPTSSAANRLGQLTGLAVREARVVGSQHGYQHLIVTLSGGRRAF
Ga0066667_1072410333300018433Grasslands SoilVNTSVARRIARQTGLAVREARVVGSQHGYQHLMIALAGGQ
Ga0066667_1142620723300018433Grasslands SoilVTTLGSAARRIARLTGLAVRDARAVGAQHGYQHFMVTLA
Ga0193747_113014213300019885SoilVNSSVVRRIARQTGLAVREARVVGSQHGYQHLIIALPGGQRAFTKVAAEQEAVPAE
Ga0210399_1111812133300020581SoilVTLVNLSAARRIAQQTGLAVREARVVGSQHGYEHLLLALA
Ga0210395_1065985713300020582SoilVTSFTSAARQAARQTGLAVREARVVGSQHGYQHLMITLAGGRRAFAKVAA
Ga0210404_1034438733300021088SoilVNTSVARRIARQTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVAME
Ga0210405_1110217013300021171SoilVNLPAARRIARQTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVTAVEEA
Ga0210396_1164747223300021180SoilVNTSVARRIARQTGLAVREARVVGSQHGYQHLVIALA
Ga0213882_1008814733300021362Exposed RockVSSVASAARRIARQTGLAVREARVAGSQHGYQHLMLTLAGGRRAFAKVAAAAEGEAVPP
Ga0210393_1158545723300021401SoilVTSFTSAARQAARQTGLAVREARVVGSQHGYQHLMITLAGGRRAFAK
Ga0210385_1156797813300021402SoilMVSSAASRMARLTGLGVRDARVAGSQHGYQHLMLTL
Ga0210397_1006679313300021403SoilMTPVTLSAARRIARQTGLAVREARVVGSQHGYQHLMLALAGGPRASAK
Ga0210384_1148921123300021432SoilVNLPAARRIARQTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVA
Ga0210410_1030137133300021479SoilVNLPAARRIARQTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVAAALPAPGGGTPPQ
Ga0126371_1061531213300021560Tropical Forest SoilVTPFNSAASRITRQTGLRARDVRVVGSQHGYQHLMITLAGGRRA
Ga0126371_1217384713300021560Tropical Forest SoilVTLVNLSAARRIGRQTGLAVREARVVGSQHGYQHLMLTLAGGRR
Ga0207692_1017429033300025898Corn, Switchgrass And Miscanthus RhizosphereVNTSVARQIARQTGLAVREARVVGSQHGYQHLMIALAGGQ
Ga0207692_1058802623300025898Corn, Switchgrass And Miscanthus RhizosphereVKLVNEPAAHRIARLTGLAVREARVVGSQHGYQHLMIALAGGQRAFAKVANQEQAA
Ga0207693_1084051113300025915Corn, Switchgrass And Miscanthus RhizosphereVNTSVARQIARQTGLAVREARVVGSQHGYQHLMIALAGGQRAFAK
Ga0207664_1089090123300025929Agricultural SoilMTFTSAARRIARQTGLSVRAVRAVGSQHGYQHLMITLAGGQRA
Ga0207644_1096014313300025931Switchgrass RhizosphereVSLSVARRIARQTGLPVREARVVGSQHGYQHLIIALPG
Ga0207665_1048313533300025939Corn, Switchgrass And Miscanthus RhizosphereVNTSVARRIARQTGLAVREARVVGSQHGYQHLMIALAGGQRAFA
Ga0207665_1092534123300025939Corn, Switchgrass And Miscanthus RhizosphereVKLVNEPAAHRIARLTGLAVREARVVGSQHGYQHLMIALAGGQRAFA
Ga0209073_1023125313300027765Agricultural SoilVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALPGGQRAFAKVA
Ga0209448_1005873833300027783Bog Forest SoilVTSFTSATRQVARQTGLAVRDARVVGSQHGYQHLMITLAGGRRAFAKVAMSASPATAASPATAVPDE
Ga0209040_1015632533300027824Bog Forest SoilVTSFASAARQVARQTGLAVREARIAGSQHGYQHLMLTLAGGRRAF
Ga0209693_1049772923300027855SoilVTSFTSAARQASRQTGLAVREARVVGSQHGYQHLMITLVGGQRAFAKVAAAASPAAA
Ga0209624_1029125813300027895Forest SoilMVSSAASRMARLTGLGVRDARVAGSQHGYQHLMLTLS
Ga0265353_101799223300028015SoilVTSFTSAARQAARQTGLAVREARVVGSQHGYQHLMLTLAGGQRAFAKVAALTGE
Ga0247684_106393023300028138SoilVNTSVARRIARQTGLAVREARVVGSQHGYQHLIIALPGGQRAFAKVAA
Ga0268266_1187601123300028379Switchgrass RhizosphereVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALPGGQRAFAKVAA
Ga0268264_1026588313300028381Switchgrass RhizosphereVSLSVARRIARQTGLAVREARVVGSQHGYQHLIIALPGGQRAFAKVAAEQEAV
Ga0307282_1034801523300028784SoilVNSSVVRRIARQTGLAVREARAVGSQHGYQHLIIALAGGQRAFA
Ga0307289_1023205613300028875SoilVSLSVARRIARQTGLPVREARVVGSQHGYQHLIIALPGGQRAFAKVA
Ga0307304_1002589733300028885SoilVSLSVARRIARQTGLPVREARVVGSQHGYQHLIIALPGGQRAF
Ga0311371_1035411513300029951PalsaMTTGSPASRITQLTGLCVREARVAGTQHGYQHLML
Ga0311370_1038068913300030503PalsaLTTGSPASRIAQLTGLSVREARVAGTQHGYQHLMLTLA
Ga0311354_1159669023300030618PalsaMTSGSPASRIAQLTGLSVREARVAGTQHGYQHLMLTLAGGRRAFAKVAAAAPAANR
Ga0318515_1047448123300031572SoilVTLVNLSVARRIGQQTGLAVREARVVGSQHGYQHVMLALPGGQRAFAKVAQ
Ga0318554_1034653633300031765SoilVNLSPARRIARQTGLAVREARAVGAQHGYQHLMLA
Ga0318526_1008500413300031769SoilVTSFGSAARLIARQTGLPVREARVVGSQHGYQHLLLTLAGGRRAFAK
Ga0318543_1033338923300031777SoilVNLSPARRIARQTGLAVREARAVGAQHGYQHLMLALAGGQRAFAK
Ga0318566_1027517913300031779SoilVNLSPARRIARQTGLAVREARAVGAQHGYQHLMLALAGGQRAFAKVA
Ga0318497_1020678533300031805SoilVTSFTSAARQLARQTGLTVREARVAGSQHGYQHLMLTLAGGRRAFAKVAPEA
Ga0318568_1004236413300031819SoilVTLVNLSAARRIGRQTDLAVREARVVGSQHGYQHLMLA
Ga0307478_1143293123300031823Hardwood Forest SoilVTSFTSAARRIAGQTGLAVREARVVGSQHGYQHLMITLAGGRRAFAKVSAEDGA
Ga0318564_1003011913300031831SoilVNFPAARRIGQQTGLAVREARVVGSQHGYQHLMLTLGGGRRAFAKVAGAQEAA
Ga0310917_1100145823300031833SoilVTLVNLSAARRIGRQTGLAVREARVVGSQHGYQHLLLA
Ga0310917_1121660123300031833SoilVTLVNLSAARRIGQQTGLAVREARVVGSQHGYQHLLL
Ga0318517_1035088023300031835SoilVTLVNLSVARRIGQQAGLAVREARVVGSQHGYQHLML
Ga0318511_1009056813300031845SoilVNFPAARRIGQQTGLAVREARVVGSQHGYQHLMLALAGGQRAFAKVAAARE
Ga0318495_1038562913300031860SoilVTLVNLSAARRIGRQTGLAVREARVVGSQHGYQHLMLALAGGQRAFAKVAAAQE
Ga0306919_1101988023300031879SoilVNFPAARRIGQQTGLAVREARVVGSQHGYQHLMLTLGGGRRAFAKVAGA
Ga0318520_1002906813300031897SoilVTLVNLSAARRIGRQTGLAVREARVVGSQHGYQHLMLALAGGQRAFAK
Ga0306926_1102469033300031954SoilVTSFTSAARRIAQQTGLAVREARVVGSQHGYQHLMITLAGGRRAF
Ga0307479_1143788423300031962Hardwood Forest SoilVTSFTSAARRIARQTGLAVREARVVGSQHGYQHLMITL
Ga0306922_1122875033300032001SoilVNFPAARRIGQQTGLAVREARVVGSQHGYQHLMLT
Ga0306922_1155418023300032001SoilVTLVNLSVARRIGQQTGLAVREARVVGSQHGYQHVMLALPGGQRAFAKV
Ga0310911_1043100623300032035SoilVNFPAARRIGQQTGLAVREARVVGSQHGYQHLMLTLGGGRRAFAKV
Ga0318556_1067538223300032043SoilVNLSPARRIARQTGLAVREARAVGAQHGYQHLMLALAGGQRAFAKVAAAEAA
Ga0318514_1023232743300032066SoilVNFPAARRIGQQTGLAVREARVVGSQHGYQHLMLTL
Ga0318514_1031335833300032066SoilVNLSPARRIARQTGLAVREARAVGAQHGYQHLMLALAGGQRAI
Ga0318525_1010558013300032089SoilVTLVNLSAARRIGRQTGLAVREARVVGSQHGYQHL
Ga0307470_1022437933300032174Hardwood Forest SoilVSLSVARRIARQTGLPVREARVVGSQHGYQHLIIALPGGQRAFAKVAGEQEAVPA
Ga0335085_1219917413300032770SoilVTPVNLSAARRIGRQTGLAVREARVVGSQHGYQHLMLALAGGQRAFAKVAPVGDRAQE
Ga0335079_1187652823300032783SoilVTSFTSAARRIASLTGLAVRDARVVGAQHGYQHLLITLAGGQRAFAKVAP
Ga0335078_1122294613300032805SoilVSSTASRIARLAGLGVRDARVVGSQHGYQHLMLTLAGGQRAFAKAIL
Ga0335080_1022054913300032828SoilVTSFTSAARQLTRQTGLAVRDARVVGSQHGYQHLMLTLAGSRRAFAKV
Ga0335081_1119308113300032892SoilVTLVNLSAARRIARQTGLAVREARAVGSQHGYQHLLLALAGGQRAFAKVAPVGDRAQEAP
Ga0335081_1232909923300032892SoilVSSTASRIARLAGLGVRDARVVGSQHGYQHLMLTLAGGQRAFAKAILDLAGLDMAA
Ga0335081_1233605023300032892SoilVTRVNLSAARRIAQQTGLAVREARVVGSQHGYQHLM
Ga0335069_1036124833300032893SoilVTSFTSAARQLTRQTGLAVRDARVVGSQHGYQHLMLT
Ga0335074_1054454313300032895SoilVSSTASTIARLTGLSVREARVVGSQHGYQHLMLTLTGGQRAFAKALLTTP
Ga0335083_1115567913300032954SoilVSLSVARRIAGQTGLAVREARVVGSQHGYQHLIIAL
Ga0335076_1117445323300032955SoilVTLVNLSAARRIGRQTGLAVREARVVGSQHGYQHLMLTLAGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.