NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F060266

Metagenome Family F060266

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060266
Family Type Metagenome
Number of Sequences 133
Average Sequence Length 40 residues
Representative Sequence EGFGYSVIDLGNLRDGGLIQQAGGPLAGRDFLERGEYHK
Number of Associated Samples 110
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.27 %
% of genes near scaffold ends (potentially truncated) 96.99 %
% of genes from short scaffolds (< 2000 bps) 92.48 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.744 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(21.053 % of family members)
Environment Ontology (ENVO) Unclassified
(36.842 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.609 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.46%    β-sheet: 0.00%    Coil/Unstructured: 92.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF08240ADH_N 56.39
PF05368NmrA 3.76
PF12680SnoaL_2 2.26
PF05977MFS_3 2.26
PF04255DUF433 1.50
PF02321OEP 1.50
PF12697Abhydrolase_6 1.50
PF00561Abhydrolase_1 0.75
PF03625DUF302 0.75
PF00724Oxidored_FMN 0.75
PF01972SDH_sah 0.75
PF12873DUF3825 0.75
PF00210Ferritin 0.75
PF00158Sigma54_activat 0.75
PF00378ECH_1 0.75
PF00111Fer2 0.75
PF00486Trans_reg_C 0.75
PF07992Pyr_redox_2 0.75
PF00027cNMP_binding 0.75
PF02771Acyl-CoA_dh_N 0.75
PF13602ADH_zinc_N_2 0.75
PF00578AhpC-TSA 0.75
PF00107ADH_zinc_N 0.75
PF00873ACR_tran 0.75
PF13609Porin_4 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 3.01
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 2.26
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.50
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 1.50
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.75
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 0.75
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.75
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.74 %
UnclassifiedrootN/A2.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY01B1VS0All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300001545|JGI12630J15595_10069681All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300001867|JGI12627J18819_10186884All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005434|Ga0070709_11065047All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300005467|Ga0070706_101910193All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005467|Ga0070706_102015005All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005468|Ga0070707_100806258All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300005518|Ga0070699_101596983All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005559|Ga0066700_11153312All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005591|Ga0070761_10423623All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300005602|Ga0070762_10599002All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005610|Ga0070763_10988068All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005614|Ga0068856_101486034All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005921|Ga0070766_10841314All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300005921|Ga0070766_10961162All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006028|Ga0070717_10110199All Organisms → cellular organisms → Bacteria → Proteobacteria2347Open in IMG/M
3300006034|Ga0066656_10587658All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300006173|Ga0070716_101148529All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300006175|Ga0070712_101473079All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006796|Ga0066665_10897396All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300006844|Ga0075428_100363949All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300006844|Ga0075428_102006213All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300006847|Ga0075431_100783457All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300006852|Ga0075433_10476554All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300006852|Ga0075433_11315985All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300006854|Ga0075425_101959817All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300006871|Ga0075434_100697690All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300006904|Ga0075424_102845552All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300007258|Ga0099793_10503724All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300009012|Ga0066710_104843188All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300009094|Ga0111539_11801681All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300009143|Ga0099792_10683119All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300009143|Ga0099792_10698114All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300009147|Ga0114129_12505192All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300009156|Ga0111538_10364590All Organisms → cellular organisms → Bacteria1829Open in IMG/M
3300009162|Ga0075423_11984735All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300009174|Ga0105241_10829128All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300010046|Ga0126384_11491547All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium633Open in IMG/M
3300010048|Ga0126373_12622001All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010159|Ga0099796_10397259All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300010329|Ga0134111_10034503All Organisms → cellular organisms → Bacteria1778Open in IMG/M
3300010360|Ga0126372_12730900Not Available546Open in IMG/M
3300012199|Ga0137383_10663930All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300012207|Ga0137381_10627350All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus936Open in IMG/M
3300012349|Ga0137387_10086346All Organisms → cellular organisms → Bacteria2167Open in IMG/M
3300012356|Ga0137371_10657394All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300012357|Ga0137384_11076459All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300012359|Ga0137385_11472737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria544Open in IMG/M
3300012361|Ga0137360_10681141All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300012582|Ga0137358_10410847All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300012582|Ga0137358_10601766All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300012683|Ga0137398_10588294All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300012683|Ga0137398_10976782All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300012685|Ga0137397_10065936All Organisms → cellular organisms → Bacteria2617Open in IMG/M
3300012923|Ga0137359_10303796All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300012923|Ga0137359_10567062All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300012923|Ga0137359_11495805All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300012930|Ga0137407_10444104All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300012930|Ga0137407_10929503All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300012930|Ga0137407_12342223All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300012944|Ga0137410_10963166All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300012971|Ga0126369_12677360All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300015053|Ga0137405_1104631All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300015264|Ga0137403_11615453All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300015358|Ga0134089_10223091All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300015372|Ga0132256_100307378All Organisms → cellular organisms → Bacteria1671Open in IMG/M
3300015373|Ga0132257_101789481All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300015374|Ga0132255_102835771All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300016270|Ga0182036_10820737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae758Open in IMG/M
3300018061|Ga0184619_10045630All Organisms → cellular organisms → Bacteria1893Open in IMG/M
3300018076|Ga0184609_10218307All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300020199|Ga0179592_10038894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2154Open in IMG/M
3300020579|Ga0210407_10325414All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300020579|Ga0210407_10711168All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300020581|Ga0210399_10148582All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300020582|Ga0210395_11153835All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300020583|Ga0210401_10006700All Organisms → cellular organisms → Bacteria11651Open in IMG/M
3300020583|Ga0210401_10740347All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300021080|Ga0210382_10149186All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300021088|Ga0210404_10199939All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300021168|Ga0210406_10549364All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha908Open in IMG/M
3300021171|Ga0210405_11236281All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. OK233552Open in IMG/M
3300021180|Ga0210396_11712289All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300021181|Ga0210388_11350670All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300021432|Ga0210384_10743572All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300021474|Ga0210390_11003766All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300021475|Ga0210392_10176428All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300021475|Ga0210392_10803470All Organisms → cellular organisms → Bacteria → Proteobacteria702Open in IMG/M
3300021479|Ga0210410_11199185All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300021559|Ga0210409_11629599All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300024347|Ga0179591_1149705All Organisms → cellular organisms → Bacteria2096Open in IMG/M
3300025910|Ga0207684_10500942All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300025915|Ga0207693_10060293All Organisms → cellular organisms → Bacteria2972Open in IMG/M
3300025916|Ga0207663_11716310All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300025941|Ga0207711_10336259All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300025961|Ga0207712_10484694All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300026320|Ga0209131_1080294All Organisms → cellular organisms → Bacteria1760Open in IMG/M
3300026361|Ga0257176_1030420All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300026499|Ga0257181_1050462All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300026999|Ga0207949_1011479All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300027034|Ga0209730_1019190All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300027047|Ga0208730_1044965All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300027050|Ga0209325_1004075All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300027050|Ga0209325_1015873All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300027050|Ga0209325_1027006All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300027371|Ga0209418_1018217All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300027502|Ga0209622_1033642All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300027502|Ga0209622_1070539All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300027583|Ga0209527_1070774All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300027853|Ga0209274_10273779All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300027855|Ga0209693_10565828All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300027903|Ga0209488_11041088All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300028047|Ga0209526_10202893All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300028293|Ga0247662_1053983All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300028906|Ga0308309_10157822All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300028906|Ga0308309_10217673All Organisms → cellular organisms → Bacteria → Acidobacteria1582Open in IMG/M
3300031057|Ga0170834_109791294All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300031128|Ga0170823_17675185All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031547|Ga0310887_10169175All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300031715|Ga0307476_11158762All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031718|Ga0307474_10011112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6519Open in IMG/M
3300031720|Ga0307469_11991739All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300031720|Ga0307469_12248276All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031754|Ga0307475_11225560Not Available583Open in IMG/M
3300031754|Ga0307475_11247799All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300031754|Ga0307475_11301330All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031820|Ga0307473_10998678All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300031942|Ga0310916_10098909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2341Open in IMG/M
3300031962|Ga0307479_11042469All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300031962|Ga0307479_12133163All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300032180|Ga0307471_100395372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1508Open in IMG/M
3300032180|Ga0307471_102973355All Organisms → cellular organisms → Bacteria601Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.54%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil9.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil9.02%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.02%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.27%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.26%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.50%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.50%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.75%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026999Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes)EnvironmentalOpen in IMG/M
3300027034Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028293Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_069578602170459010Grass SoilLLKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGES
JGI12630J15595_1006968113300001545Forest SoilSLLEGFGYSVIDLGNYSVIDLGNLRVGGLIQQAGGPLAGRDLFKAGRAS*
JGI12627J18819_1018688413300001867Forest SoilYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEFHK*
Ga0070709_1106504713300005434Corn, Switchgrass And Miscanthus RhizosphereLLKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGES*
Ga0070706_10191019323300005467Corn, Switchgrass And Miscanthus RhizosphereLEGFGYAVVDLGNLRNGGLIQQAGGPLVGRDFLERGESPK*
Ga0070706_10201500523300005467Corn, Switchgrass And Miscanthus RhizosphereKEVGSLLAGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLLEEGERHK*
Ga0070707_10080625823300005468Corn, Switchgrass And Miscanthus RhizosphereEDCGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEYHK*
Ga0070699_10159698313300005518Corn, Switchgrass And Miscanthus RhizosphereKQVEILLKELGYSVIDLGNLRDGGLAQQAGGPLAGRDFLERGEY*
Ga0066700_1115331213300005559SoilLLAGFGYSVIDLGNLPDGGLIQQAGGPFAGQNLLEEGERHK*
Ga0070761_1042362323300005591SoilFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEYPK*
Ga0070762_1059900213300005602SoilGYAVVDLGNLRNGGLIQQAGGPLVGRDFLERGESPK*
Ga0070763_1098806813300005610SoilAVVDLGNLRNGGLIQQAGGPLAGRDFLERGEFYK*
Ga0068856_10148603423300005614Corn RhizosphereETLLKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGES*
Ga0070766_1084131423300005921SoilYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEYPK*
Ga0070766_1096116213300005921SoilGYSVVDLGNLRDGGLIQQTGGPLGGRDFLEKGEYRR*
Ga0070717_1011019923300006028Corn, Switchgrass And Miscanthus RhizosphereMIWNVDLGNLRAGGLIRQAGGPLAGRDFLERGES*
Ga0066656_1058765843300006034SoilGSLLAGFGYSVIDLGNLRDGGLIQQAGGPFAGRNLLEEGERHK*
Ga0070716_10114852923300006173Corn, Switchgrass And Miscanthus RhizosphereSVIDLGNLRDGGLIQQAGGPLAGRDFLERGEYHK*
Ga0070712_10147307913300006175Corn, Switchgrass And Miscanthus RhizosphereGFGYAVVDLGNLRNGGLIQQAGGPLVGRDFLERGESPK*
Ga0066665_1089739643300006796SoilYSVIDLGNLRDGGLIQQAGGPFAGRNLLEEGERHK*
Ga0075428_10036394913300006844Populus RhizosphereLLKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEFHK*
Ga0075428_10200621313300006844Populus RhizosphereGYSVIDLGNLRDGGLIQQAGGPLAGRDFLERGEYPK*
Ga0075431_10078345723300006847Populus RhizosphereLKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEFHK*
Ga0075433_1047655413300006852Populus RhizosphereLKELGYSVIDLGNLRDGGLIQQAGGPLAGRDLLERGD*
Ga0075433_1131598523300006852Populus RhizosphereEILLEEIGYSVIDLGDLRNGGLIQQAGGPLAGRDLLERGHYQK*
Ga0075425_10195981713300006854Populus RhizosphereEILLKELGYSVIDLGNLRDGGLIQQAGGPLAGRDLLERGD*
Ga0075434_10069769013300006871Populus RhizosphereTLLENCGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEYRK*
Ga0075424_10284555213300006904Populus RhizosphereVEILLKELGYSVIDLGNLRDGGLAQQAGGPLAGRDFLERGEY*
Ga0099793_1050372413300007258Vadose Zone SoilKKRVQTLLENCGYSVVDLGNLRDGGLIQQAGGPIAGRDFFERGEYHK*
Ga0066710_10484318813300009012Grasslands SoilKAFGYCVIDLGNLRDGGLIQQAGGPLAGRDLLERGE
Ga0111539_1180168113300009094Populus RhizosphereIDLGNLRDGGLIQQAGGPLAGRDLLELGEYRKKGDPS*
Ga0099792_1068311913300009143Vadose Zone SoilKKEVETLLAGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLWEEGERHK*
Ga0099792_1069811423300009143Vadose Zone SoilESLGYSVIDLGDLRHGGLLQQGGGPLAGRDLLERGEYHK*
Ga0114129_1250519213300009147Populus RhizosphereALLKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEFHK*
Ga0111538_1036459013300009156Populus RhizosphereTFGFAVIDVGTLRDGGLLQQAGGPLAGLDILQRL*
Ga0075423_1198473513300009162Populus RhizosphereILLKELGYSVIDLGNLRDGGLIQQAGGPLAGRDLWERGEYYK*
Ga0105241_1082912823300009174Corn RhizosphereSSGRFKGFGYSVIDLGNLRDGGLIQQAGGPLAGRDFLERGES*
Ga0126384_1149154713300010046Tropical Forest SoilKKRVETLLKAFAYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGG*
Ga0126373_1262200123300010048Tropical Forest SoilKRVETLLKAFAYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGE*
Ga0099796_1039725913300010159Vadose Zone SoilVQALLEGCGYSVVDLGNLRDGGLIQQAGGPIAGRDFFERGEYH*
Ga0134111_1003450313300010329Grasslands SoilKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDLLERGEYPT*
Ga0126372_1273090013300010360Tropical Forest SoilSVINLGNLRDGGLIQQAGGPLAGRDLWERGEYYKKGDPS*
Ga0137383_1066393023300012199Vadose Zone SoilLRTFGFAVIDVGNLRDGGMIQQAGGPLAALDTLQRL*
Ga0137381_1062735013300012207Vadose Zone SoilLEGLGYSVIDLGNLRDGGLIQQPGGPFAGRDLLERGEYHK*
Ga0137387_1008634613300012349Vadose Zone SoilHQCGYSVVDLGSLRDGGLMQQAGGPLAGRDFFERGEYSR*
Ga0137371_1065739413300012356Vadose Zone SoilKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDLLERGEYPK*
Ga0137384_1107645923300012357Vadose Zone SoilLRTFGFAVIDLGNLRDGGLIQQAGGSLAGLDILQRL*
Ga0137385_1147273723300012359Vadose Zone SoilLIATFLLRLLAVIDLGNLRDGGLIQQAGGPLAGLDILQRL*
Ga0137360_1068114113300012361Vadose Zone SoilLLKELGYSVIDLGNLRDGGLIQQAGGPLAGRDLLERGEHD*
Ga0137358_1041084713300012582Vadose Zone SoilETLLTGFGYSVIDLGNLRDGGLFQQAGGPLAGRNLFAEGERHK*
Ga0137358_1060176613300012582Vadose Zone SoilLLEGCGYSVVDLGNLRDGGLIQQAGGPIAGRDFFERGEYHK*
Ga0137398_1058829423300012683Vadose Zone SoilLLQNCGYSVIELGNLRDGGLIQQAGGPIAGRDFFERGEYHK*
Ga0137398_1097678233300012683Vadose Zone SoilESLGYSVIDLGDLRHGGLLQQAGGPLAGRDLLERGEYHK*
Ga0137397_1006593613300012685Vadose Zone SoilKKRVHKLLHQCGYSVVDLGNLRDGGLIQQAGGPLAGRDFFERGEYSK*
Ga0137359_1030379613300012923Vadose Zone SoilTLLADFGYSVIDLGNLRDGGLIQQAGGPLAGRNLLEVGERYK*
Ga0137359_1056706223300012923Vadose Zone SoilHELLAHCGYSVVDLGNLRDGGLMQQAGGPLAGRDLFERGEY*
Ga0137359_1149580523300012923Vadose Zone SoilSVIDLGNLRDGGLIQQAGGPLAGRDLLEEGERHK*
Ga0137407_1044410413300012930Vadose Zone SoilLLENCGYSVVDLGNLRDGGLIQQAGGPIAGRDFFEKGEYHK*
Ga0137407_1092950313300012930Vadose Zone SoilGCGYSVVDLGNLRDGGLIQQAGGPIAGRDFFEKGEYHR*
Ga0137407_1234222323300012930Vadose Zone SoilSVVDLGNLRDGGLIQQAGGPLAGRDFFERGEYSK*
Ga0137410_1096316623300012944Vadose Zone SoilGYSVIDLGNLRDGGLIQQAGGPLAGRNLLEEGERHK*
Ga0126369_1267736013300012971Tropical Forest SoilTLLDNFGYSVIDLGNLRDGGLIQQAGGPLADRDFLERGAYPK*
Ga0137405_110463123300015053Vadose Zone SoilLRTFGFAVIDVGTLRDGGLLQQAGGPLAGLDILQRL*
Ga0137403_1161545313300015264Vadose Zone SoilKRRVETLLRTFGSAVVDLGNLRDGGLIQQAGGLLAGRDFFERGEYSE*
Ga0134089_1022309123300015358Grasslands SoilFGYSVIDLGNLRDGGLIQQAGGPLAGRDILERGEYPK*
Ga0132256_10030737813300015372Arabidopsis RhizosphereVEILLKEFGYYEFDLGDLRDGGLIQQAGAPLAGRDLWERGEYRKKGDPS*
Ga0132257_10178948123300015373Arabidopsis RhizosphereMIRNIDLGNLRDGGLIQQAGGALAGRDFLERGES*
Ga0132255_10283577113300015374Arabidopsis RhizosphereLGYSVIDLGNLRDGGLIQQAGGPLAGRDLLEQGEYPK*
Ga0182036_1082073713300016270SoilKRVETLLKAFAYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGE
Ga0184619_1004563043300018061Groundwater SedimentLENFGYSVIDLGNLRDGGLIQQAGGPLAGRDFLERGEYPK
Ga0184609_1021830723300018076Groundwater SedimentYSVIDLGDLRDGGLIQQAGGPLAGRDFFERGEYPK
Ga0179592_1003889413300020199Vadose Zone SoilEGFGYAVVDLGNLRNGGLIQQAGGPLVGRDFLERGEFHK
Ga0210407_1032541413300020579SoilKQLGYSVIDLGNLRDGGLIQQAGGPLAGRDFLERGES
Ga0210407_1071116813300020579SoilFGYAVVDLGNLRNGGLIQQAGGPLVGRDFLERGESPK
Ga0210399_1014858243300020581SoilENCGYSVVDLGNLRDGGLIQQTGGPLGGRDFLEKGEYRR
Ga0210395_1115383513300020582SoilKKVEFLLAGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLFEEGERQ
Ga0210401_10006700133300020583SoilLLAGFGYSVIDLGNLRDGGLIQQAGGPLAGRDLFEQGERYK
Ga0210401_1074034713300020583SoilYAVVDLGNLRNGGLIQQAGGPLVGRDFLERGEFNK
Ga0210382_1014918613300021080Groundwater SedimentETLLKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGES
Ga0210404_1019993933300021088SoilSVIDLGNLRDGGLIQQVGGPFVMRNLLEEGERERHK
Ga0210406_1054936413300021168SoilTLPESLGYSVIDLGDLRHGRLLQQAGGPPAGRDLLERGEYHQ
Ga0210405_1123628123300021171SoilGFGYAVVDLGNLRNGGLIQQAGGPLVGRDFLERGESPK
Ga0210396_1171228923300021180SoilENLLAGFGYAVVDLGNLRNGGLIQQAGGPLVGRDFLERGEFHK
Ga0210388_1135067033300021181SoilYAVVDLGNLRNGGLIQQAGGALAGRDFLERGEFHK
Ga0210394_1001447953300021420SoilVVISGDDDDAKKQVETLLAGFGYSVLDLGNLRDGGLIQQIGGPFVMRNLLEEGERERHK
Ga0210384_1074357223300021432SoilVGTLLAGFGYSVIDLGNLRDGGLIQQVGGPFVMRNLLEEGERELHK
Ga0210390_1100376623300021474SoilAKKEVETLLTGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLFEEGERHK
Ga0210392_1017642813300021475SoilEGFGYSVIDLGNLRDGGLIQQAGGPLAGRDFLERGES
Ga0210392_1080347013300021475SoilQVETLLAGFGYSVIDLGNLRDGGLIQQVGGPFVMRNLLEEGERERHK
Ga0210410_1119918523300021479SoilLKAFGYCVIDLGNLRDGGLIQQAGGPLAGRDLLERGEYPK
Ga0210409_1162959913300021559SoilGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEYPK
Ga0179591_114970513300024347Vadose Zone SoilREERVETLLKAFGYSVVDLGNLRDGGLIQQASGPLAGRDFLERGES
Ga0207684_1050094213300025910Corn, Switchgrass And Miscanthus RhizosphereRAFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEYSK
Ga0207693_1006029343300025915Corn, Switchgrass And Miscanthus RhizosphereLLKAFGYSVDDLGNLRDGGLIQQAAGPLAGRDFLERGEYPK
Ga0207663_1171631023300025916Corn, Switchgrass And Miscanthus RhizosphereVIFAPAAAKERVETLLKTFGYAVVDLGNLRDGGLIQQGGGPLANRDFLERGESPK
Ga0207711_1033625913300025941Switchgrass RhizosphereLLEEIGYSVIDLGDLRNGGLIQQAGGPLAGRDLLERGHYQK
Ga0207712_1048469423300025961Switchgrass RhizosphereGYSVIDLGDLRNGGLIQQAGGPLAGRDLLERGHYQK
Ga0209131_108029413300026320Grasslands SoilYAVVDLGNLRNGGLIQQAGGPLVGRDFLERGEFHK
Ga0257176_103042023300026361SoilKEVETLLAGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLWEEGERHK
Ga0257181_105046213300026499SoilTLLAGFGYSVINLGNLRDGGLIQQAGGPLAGRNLLEEGERHR
Ga0207949_101147923300026999Forest SoilQVETLLKAFGYSVVDLGNLRNGGLIQQAGGPLVGRDFLERGEFHK
Ga0209730_101919013300027034Forest SoilRVEVLLAGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLFEEGERHR
Ga0208730_104496513300027047Forest SoilLKAFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGG
Ga0209325_100407533300027050Forest SoilTLLESFGYSVIDLGNLRDGGLIQQGGGPLAGRNLLEQGERHK
Ga0209325_101587323300027050Forest SoilLAGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLLEEGERHK
Ga0209325_102700623300027050Forest SoilAGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLFEEGERHR
Ga0209418_101821733300027371Forest SoilTLLAGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLLEEGERHR
Ga0209622_103364213300027502Forest SoilRVQTLLENCGYSVVDLGNLRDGGLIQQTGGPLGGRDFLEKGEYRR
Ga0209622_107053923300027502Forest SoilVETLLTGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLFEEGERHK
Ga0209527_107077413300027583Forest SoilGAKKEVETLLTGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLFEEGERHR
Ga0209274_1027377923300027853SoilGFGYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGEYPK
Ga0209693_1056582823300027855SoilGYSVIDLGNLRDGGLIQQAGGPLAGRNLFEEGEPHK
Ga0209488_1104108813300027903Vadose Zone SoilEGFGYSVIDLGNLRDGGLIQQAGGPLAGRDFLERGEYHK
Ga0209526_1020289323300028047Forest SoilLLENCGYSVVDLGNLRDGGLIQQTGGPLGGRDFLEKGEYRR
Ga0247662_105398313300028293SoilKKRVHTLLHQCGYSVVDLGNLRDGGLIQQAGGPLAGRDFFDRGEYST
Ga0308309_1015782213300028906SoilGYSVVDLGNLRDGGLIQQTGGPLGGRDFLEKGEYRR
Ga0308309_1021767313300028906SoilGHAVVDLGNLRNGGLIQQAGGPLVGRDFLERGESPK
Ga0170834_10979129413300031057Forest SoilQTLLQSCGYSVVDLGNLRDGGLVQQAGGPLAGRDFFERGEYPK
Ga0170823_1767518523300031128Forest SoilRGYSVVDLGNLRDGGLVQQAGGPLAGRDLFERGEYPK
Ga0310887_1016917533300031547SoilTLLENCGYSVVDLGNLRDGGLIQQAGGPLAGPDFLERGEYSK
Ga0307476_1115876213300031715Hardwood Forest SoilTLLRAFGYSVIDLGDLRDGGLIQQAGGPLAGRDFLERGEYPE
Ga0307474_1001111213300031718Hardwood Forest SoilVEVLLAGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLFEEGERHR
Ga0307469_1199173913300031720Hardwood Forest SoilHTLLHQCGYSVVDLGNLRDGGLIQQAGGPLAGRDFFERGEYST
Ga0307469_1224827613300031720Hardwood Forest SoilTLLEICGYSVVDLGNLRDGGLIQQAGGPLAGPDFLERGEYSK
Ga0307475_1122556013300031754Hardwood Forest SoilNCGYSVVDLGNLRDGGLIQQTGGPLGGRDFLEKGEYRR
Ga0307475_1124779923300031754Hardwood Forest SoilGFGYSVIDLGNLRDGGLIQQAGGPLAGRNLLEEGERHT
Ga0307475_1130133023300031754Hardwood Forest SoilVATLLTGCGYSVIDLGNLRDGGLIQQAGGPLAGRDLLEQGERHK
Ga0307473_1099867823300031820Hardwood Forest SoilLLRELGYSVIDLGDLRSGGLIQQAGGPLAGRDLLERGEYHR
Ga0310916_1009890913300031942SoilLLKAFAYSVVDLGNLRDGGLIQQAGGPLAGRDFLERGE
Ga0307479_1104246923300031962Hardwood Forest SoilQVVTLLTVFGYSVIDLGNLRDGGLLQQAGGPLAGRNLLEQGEPHK
Ga0307479_1213316323300031962Hardwood Forest SoilATLLAGFGYSVIDLGNLRDGGLIQQAGGPFAGRNLWEEGERHQ
Ga0307471_10039537213300032180Hardwood Forest SoilARKRVETLLKAFAYSVVNLGNLRDGGLIQQAGGPLAGRDFLERGE
Ga0307471_10297335513300032180Hardwood Forest SoilEICGYSVVDLGNLRDGGLIQQAGGPLAGPDFLERGEYSK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.