Basic Information | |
---|---|
Family ID | F060258 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 44 residues |
Representative Sequence | MSESVQTTSGSWWRTSLLDRVAELRQREDQVFLVLALVIGALTGL |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 86.72 % |
% of genes near scaffold ends (potentially truncated) | 95.49 % |
% of genes from short scaffolds (< 2000 bps) | 87.22 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.917 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (14.286 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.617 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF00691 | OmpA | 14.29 |
PF01904 | DUF72 | 3.76 |
PF00291 | PALP | 3.76 |
PF01467 | CTP_transf_like | 2.26 |
PF08002 | DUF1697 | 2.26 |
PF00999 | Na_H_Exchanger | 2.26 |
PF10041 | DUF2277 | 1.50 |
PF09364 | XFP_N | 1.50 |
PF07992 | Pyr_redox_2 | 1.50 |
PF01184 | Gpr1_Fun34_YaaH | 1.50 |
PF04134 | DCC1-like | 1.50 |
PF08972 | DUF1902 | 1.50 |
PF02371 | Transposase_20 | 0.75 |
PF13715 | CarbopepD_reg_2 | 0.75 |
PF10011 | DUF2254 | 0.75 |
PF13463 | HTH_27 | 0.75 |
PF01757 | Acyl_transf_3 | 0.75 |
PF00437 | T2SSE | 0.75 |
PF01548 | DEDD_Tnp_IS110 | 0.75 |
PF13231 | PMT_2 | 0.75 |
PF00474 | SSF | 0.75 |
PF00723 | Glyco_hydro_15 | 0.75 |
PF06283 | ThuA | 0.75 |
PF13419 | HAD_2 | 0.75 |
PF13620 | CarboxypepD_reg | 0.75 |
PF15919 | HicB_lk_antitox | 0.75 |
PF01243 | Putative_PNPOx | 0.75 |
PF04542 | Sigma70_r2 | 0.75 |
PF08532 | Glyco_hydro_42M | 0.75 |
PF00440 | TetR_N | 0.75 |
PF10546 | P63C | 0.75 |
PF01242 | PTPS | 0.75 |
PF00309 | Sigma54_AID | 0.75 |
PF00196 | GerE | 0.75 |
PF05119 | Terminase_4 | 0.75 |
PF13672 | PP2C_2 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 3.76 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 2.26 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 2.26 |
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 2.26 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 2.26 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 2.26 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 2.26 |
COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 1.50 |
COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 1.50 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.50 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.75 |
COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.75 |
COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.75 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.75 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.75 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.75 |
COG3747 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.75 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.75 |
COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.75 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.92 % |
Unclassified | root | N/A | 33.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001404|JGI20181J14860_1007198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 994 | Open in IMG/M |
3300001413|JGI20180J14839_1008656 | Not Available | 677 | Open in IMG/M |
3300001593|JGI12635J15846_10700622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300004082|Ga0062384_100830655 | Not Available | 648 | Open in IMG/M |
3300004092|Ga0062389_100811095 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300004092|Ga0062389_102135915 | Not Available | 735 | Open in IMG/M |
3300004152|Ga0062386_101167176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300005344|Ga0070661_101682099 | Not Available | 537 | Open in IMG/M |
3300005451|Ga0066681_10180789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
3300005535|Ga0070684_101009419 | Not Available | 781 | Open in IMG/M |
3300005541|Ga0070733_10990387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
3300005578|Ga0068854_101822804 | Not Available | 558 | Open in IMG/M |
3300005921|Ga0070766_10118658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1588 | Open in IMG/M |
3300006173|Ga0070716_101612982 | Not Available | 533 | Open in IMG/M |
3300006174|Ga0075014_100214225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
3300007255|Ga0099791_10641360 | Not Available | 521 | Open in IMG/M |
3300009029|Ga0066793_10710576 | Not Available | 571 | Open in IMG/M |
3300009088|Ga0099830_11649533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300009089|Ga0099828_10763332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300009174|Ga0105241_11705168 | Not Available | 612 | Open in IMG/M |
3300009521|Ga0116222_1057424 | Not Available | 1690 | Open in IMG/M |
3300009523|Ga0116221_1507064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300009525|Ga0116220_10060094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1589 | Open in IMG/M |
3300009547|Ga0116136_1084818 | Not Available | 836 | Open in IMG/M |
3300009547|Ga0116136_1154328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300009552|Ga0116138_1139593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300009630|Ga0116114_1194180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300009634|Ga0116124_1047178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1278 | Open in IMG/M |
3300009636|Ga0116112_1020371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2265 | Open in IMG/M |
3300009641|Ga0116120_1072475 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300009665|Ga0116135_1205342 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300009824|Ga0116219_10293136 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300009839|Ga0116223_10376211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
3300009839|Ga0116223_10722296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300010043|Ga0126380_12134426 | Not Available | 516 | Open in IMG/M |
3300010339|Ga0074046_10034419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3438 | Open in IMG/M |
3300010339|Ga0074046_10127938 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
3300010343|Ga0074044_11126784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300010379|Ga0136449_103984229 | Not Available | 552 | Open in IMG/M |
3300010379|Ga0136449_104138052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300011271|Ga0137393_11477647 | Not Available | 569 | Open in IMG/M |
3300012206|Ga0137380_11594490 | Not Available | 537 | Open in IMG/M |
3300012354|Ga0137366_10327262 | Not Available | 1124 | Open in IMG/M |
3300012361|Ga0137360_10200365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1615 | Open in IMG/M |
3300012362|Ga0137361_11849122 | Not Available | 521 | Open in IMG/M |
3300012918|Ga0137396_10089821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2178 | Open in IMG/M |
3300012971|Ga0126369_13578924 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300013104|Ga0157370_11864443 | Not Available | 539 | Open in IMG/M |
3300014153|Ga0181527_1387134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300014155|Ga0181524_10389069 | Not Available | 611 | Open in IMG/M |
3300014155|Ga0181524_10437751 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300014162|Ga0181538_10071171 | All Organisms → cellular organisms → Bacteria | 2107 | Open in IMG/M |
3300014169|Ga0181531_11019570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300014200|Ga0181526_10101179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1842 | Open in IMG/M |
3300014501|Ga0182024_10217163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2596 | Open in IMG/M |
3300014501|Ga0182024_11568669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300014502|Ga0182021_10234225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2150 | Open in IMG/M |
3300014638|Ga0181536_10131179 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300014838|Ga0182030_10018437 | All Organisms → cellular organisms → Bacteria | 13380 | Open in IMG/M |
3300014838|Ga0182030_11118335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300015203|Ga0167650_1133240 | Not Available | 512 | Open in IMG/M |
3300016270|Ga0182036_11433752 | Not Available | 579 | Open in IMG/M |
3300016387|Ga0182040_10226932 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300017925|Ga0187856_1176737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
3300017941|Ga0187850_10426323 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300017942|Ga0187808_10460515 | Not Available | 586 | Open in IMG/M |
3300017948|Ga0187847_10027678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3405 | Open in IMG/M |
3300017996|Ga0187891_1148330 | Not Available | 836 | Open in IMG/M |
3300018003|Ga0187876_1019664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3222 | Open in IMG/M |
3300018004|Ga0187865_1200230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300018005|Ga0187878_1296944 | Not Available | 578 | Open in IMG/M |
3300018007|Ga0187805_10156269 | Not Available | 1038 | Open in IMG/M |
3300018019|Ga0187874_10188658 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300018019|Ga0187874_10287251 | Not Available | 670 | Open in IMG/M |
3300018021|Ga0187882_1179408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
3300018021|Ga0187882_1234489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
3300018021|Ga0187882_1311744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300018034|Ga0187863_10721220 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300018037|Ga0187883_10363597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300018040|Ga0187862_10458784 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 772 | Open in IMG/M |
3300018046|Ga0187851_10205238 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300018047|Ga0187859_10022176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3501 | Open in IMG/M |
3300018047|Ga0187859_10554756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300018047|Ga0187859_10590193 | Not Available | 625 | Open in IMG/M |
3300020579|Ga0210407_11370557 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300021046|Ga0215015_11075958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Enterococcaceae → Enterococcus → unclassified Enterococcus → Enterococcus sp. S159_ASV_20 | 580 | Open in IMG/M |
3300021479|Ga0210410_11333594 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300021559|Ga0210409_10750975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
3300021560|Ga0126371_13707247 | Not Available | 515 | Open in IMG/M |
3300022524|Ga0224534_1084391 | Not Available | 573 | Open in IMG/M |
3300024227|Ga0228598_1121397 | Not Available | 530 | Open in IMG/M |
3300025432|Ga0208821_1043487 | Not Available | 844 | Open in IMG/M |
3300025453|Ga0208455_1084450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300025477|Ga0208192_1022946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1469 | Open in IMG/M |
3300025581|Ga0208355_1090445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300025612|Ga0208691_1156890 | Not Available | 513 | Open in IMG/M |
3300025619|Ga0207926_1005749 | All Organisms → cellular organisms → Bacteria | 4596 | Open in IMG/M |
3300026214|Ga0209838_1045031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300026294|Ga0209839_10255243 | Not Available | 549 | Open in IMG/M |
3300026557|Ga0179587_11149359 | Not Available | 511 | Open in IMG/M |
3300027334|Ga0209529_1009662 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
3300027570|Ga0208043_1034605 | Not Available | 1539 | Open in IMG/M |
3300027674|Ga0209118_1068586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
3300027678|Ga0209011_1071533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
3300027829|Ga0209773_10287443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
3300027854|Ga0209517_10353463 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300027905|Ga0209415_10203930 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
3300027905|Ga0209415_10501945 | Not Available | 934 | Open in IMG/M |
3300027911|Ga0209698_10400367 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300028047|Ga0209526_10170065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1520 | Open in IMG/M |
3300028069|Ga0255358_1030347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
3300028795|Ga0302227_10320625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300028824|Ga0307310_10738584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300029910|Ga0311369_11274344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 563 | Open in IMG/M |
3300030054|Ga0302182_10437675 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300030503|Ga0311370_10467012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1560 | Open in IMG/M |
3300030659|Ga0316363_10290608 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300030706|Ga0310039_10078248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1412 | Open in IMG/M |
3300031231|Ga0170824_106655715 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300031231|Ga0170824_128509186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 735 | Open in IMG/M |
3300031236|Ga0302324_100406648 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
3300031715|Ga0307476_10214349 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300031744|Ga0306918_10155929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
3300032205|Ga0307472_100279768 | Not Available | 1328 | Open in IMG/M |
3300032261|Ga0306920_100757350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1428 | Open in IMG/M |
3300032828|Ga0335080_11159148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300033289|Ga0310914_10397329 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300034282|Ga0370492_0463120 | Not Available | 514 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 14.29% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.53% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 9.02% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.27% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.26% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.51% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.76% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.76% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.01% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.26% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.26% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.26% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.50% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.50% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.50% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.50% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.50% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.50% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.75% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.75% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001404 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 | Environmental | Open in IMG/M |
3300001413 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI20181J14860_10071981 | 3300001404 | Arctic Peat Soil | MPDGEITESGERASGNWWRTPLLYLRARLQQREDQVFLVLALVIGAL |
JGI20180J14839_10086563 | 3300001413 | Arctic Peat Soil | MSHNGQTTSGSWWRTPQSYLMAKLQEREDQVFLVLALVIGA |
JGI12635J15846_107006221 | 3300001593 | Forest Soil | MSEPVPTTSGSWWRTWLLLRVAELRQREGQIFVVLALVIGA |
Ga0062384_1008306551 | 3300004082 | Bog Forest Soil | VEMSEGDQEESDSWWGMWLSNRRAELRQREHQVILVLALVIGALTG |
Ga0062389_1008110952 | 3300004092 | Bog Forest Soil | MSEGDQEESDSWWGMWLSNRRAELRQREHQVILVLALVIG |
Ga0062389_1021359152 | 3300004092 | Bog Forest Soil | MSEGVQEESDSWWGTWLSNRRAELRQREHQVILVLALVIG |
Ga0062386_1011671762 | 3300004152 | Bog Forest Soil | LILEMKESGQTTSGSWWWTPLLHRVARLQEREDQVFLILSLVIG |
Ga0070661_1016820991 | 3300005344 | Corn Rhizosphere | MDHKDVSDQTRRGSWWRSPLLYLSARLQEREDQVFLVLALVIGALTGLTV |
Ga0066681_101807893 | 3300005451 | Soil | MSEGGQTTRRSWWRIPLLHRVAKLQQQREDQVFLVLALVIGALTGLA |
Ga0070684_1010094192 | 3300005535 | Corn Rhizosphere | MSENRQTPSGSWWKMPLSYLSARLQEHEDQVFLVLALVIGALTGLTVV |
Ga0070733_109903872 | 3300005541 | Surface Soil | MSESPATSGSWWRTPQSYLSAQLQEHEDQVFLVLAL |
Ga0068854_1018228042 | 3300005578 | Corn Rhizosphere | MSENRQTPSGSWWKMPLSYLSARLQEHEDQVFLVLALVIGALTGLT |
Ga0066706_111058011 | 3300005598 | Soil | MSESGRGTSGNWWKTPLLDLLEKVRQREDQVFLVLTLVI |
Ga0070766_101186581 | 3300005921 | Soil | VGHSQEMSEGVQTTSVSWWRTSLLDRVAELRQHEDQVILVLALVIG |
Ga0070716_1016129821 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MDHKDVSKSDQTRSGSWWRSPLLYLSARLQEREDQVFLVLALVI |
Ga0075014_1002142252 | 3300006174 | Watersheds | MNQRVQSISASGWRTWLSDRVAELRQREDQVFLLLA |
Ga0099791_106413601 | 3300007255 | Vadose Zone Soil | MLFVGHPVEMSESVQTTSESWWRTSLFDRVADLRQREGQIFLVLA |
Ga0066793_107105762 | 3300009029 | Prmafrost Soil | MSESDRMTSGNWWRTRLLRRVAVLQQREDQVFLVLALVIG |
Ga0099830_116495331 | 3300009088 | Vadose Zone Soil | MLLIGHSPEMNESGHTTSGSWWRTWLLDRVAELRQREEQVFLVLAL |
Ga0099828_107633322 | 3300009089 | Vadose Zone Soil | MRLMGHSPEMSESGETSGSWWKTPLLHRVARLKEREDQVFLILALVIGAL |
Ga0075423_124241181 | 3300009162 | Populus Rhizosphere | MSESPQRTNENWWKAQLLRLLHKAQQREDQVFLVLTLVIGALTGLA |
Ga0105241_117051682 | 3300009174 | Corn Rhizosphere | MSENRQTPSGSWWKMPLSYLSARLQEHEDQVFLVLALVIGALTGLTVVAFI |
Ga0116222_10574244 | 3300009521 | Peatlands Soil | MSDSAQTTSTSAWRSWLFDRVAELRQREGQIFLVS |
Ga0116221_15070641 | 3300009523 | Peatlands Soil | MTESVQTTNPSGWKAWLSDRVAELRQREEQVFLVLAL |
Ga0116220_100600941 | 3300009525 | Peatlands Soil | MSESDQTASESWWKTPLLRLVDKLQQREDQVFLVLALVISALTGLAVVAFI |
Ga0116136_10848183 | 3300009547 | Peatland | MSENIETTSGVGWKPWLSDRVAELRQRESQVFLVLALVIGAL |
Ga0116136_11543281 | 3300009547 | Peatland | MLWGRNSLMSETVQTTSASGWKAWLSGRLAELRQREGQIFLVLAL |
Ga0116138_11395932 | 3300009552 | Peatland | MNESVQTTSTSWWKAWLLDRVAELRQRESQVFLVLALVIGALTG |
Ga0116114_11941801 | 3300009630 | Peatland | MLWGRNSLMSETVQTPSASGWRAWLPGRLAELRQREGQIFLVLALVIGALTGLVVV |
Ga0116124_10471781 | 3300009634 | Peatland | MTESAQTTSGSWWRTSLLDRVAELRHREDQVFLVLALV |
Ga0116112_10203715 | 3300009636 | Peatland | MSENIRTTSGVGWKTWLSDRVAELRQRESQVFLVLALVIGALT |
Ga0116120_10724752 | 3300009641 | Peatland | MSGSGQTTSESWWRTPQSYFMAKLQQREDQVFLVLALVIGALTGLTVAATENRPP |
Ga0116135_12053421 | 3300009665 | Peatland | MSDSGEKTSGSWWRAPRLYLAAKLQQREDQVFLVLALVIGALTGLA |
Ga0116219_102931361 | 3300009824 | Peatlands Soil | MMEGAQTTSTSRWKTWLSDRVAELRQREDQVFLVLALVIGALTG |
Ga0116223_103762111 | 3300009839 | Peatlands Soil | MSESVQTTSGSWWRTSLLDRVAELRQREDQVFLVLALVIGALTGL |
Ga0116223_107222961 | 3300009839 | Peatlands Soil | MSETVQSMIGAKPGSWLSGRMAELRQREGQIFLVLALVIGA |
Ga0126380_121344261 | 3300010043 | Tropical Forest Soil | MSQSSQRSSGKWWKTPLLNRLDKLQEREDQVFLILALVIGALT |
Ga0074046_100344197 | 3300010339 | Bog Forest Soil | MSESIPATNKSWLRTWLSDRIAELRQREGQIFLVLALVIGALTGL |
Ga0074046_101279383 | 3300010339 | Bog Forest Soil | MSESGQTASGNWWGAPRLYFLAKLQEREDQVFLVLALVIGALT |
Ga0074044_111267841 | 3300010343 | Bog Forest Soil | MSEGVQTTSGSGWRNWFLLRVAELRQRESQVFLVLALV |
Ga0136449_1039842291 | 3300010379 | Peatlands Soil | MSERGQVSERGQTTSGSSWRTPLLYLSARLQEHEDQVFLVLALVIGA |
Ga0136449_1041380522 | 3300010379 | Peatlands Soil | MSESIPATNKSWLRTWLSDRITELRQREGQIFLVLALVWSGN* |
Ga0137393_114776471 | 3300011271 | Vadose Zone Soil | MNESGHTTSGSWCRTWLLDRVAELRQREEQVFLVL |
Ga0137380_115944901 | 3300012206 | Vadose Zone Soil | MSESGQTTSGGWWRTSLLDRMAELRQREGQVFLALALVIGALTGLAVV |
Ga0137366_103272623 | 3300012354 | Vadose Zone Soil | MLFVEHPPEMSESGQTTSRSWWRSWLLDRVAELRKREEQVFLVLA |
Ga0137360_102003651 | 3300012361 | Vadose Zone Soil | MNESGHTTSGSWWRTWLLDRVAELRQREEQVFLVLALV |
Ga0137361_118491221 | 3300012362 | Vadose Zone Soil | MRLMGHSPEMSESGETSGSWWKTPLLHRVARLKEREDQVFLILALVIG |
Ga0137396_100898211 | 3300012918 | Vadose Zone Soil | MRLMGHSPEMSESGETSGSWWKTPLLHRVARLKEREDQVFLILALVIGALT |
Ga0126369_135789241 | 3300012971 | Tropical Forest Soil | MFLGDGENGQTTIGRWWRTPLSSGAAALQQHEEQVFLVLTLVIGALTGLA |
Ga0157370_118644432 | 3300013104 | Corn Rhizosphere | VSESANATSGNSWTSPLLYLRARLQEREDQIFLLLALVIGALTGLT |
Ga0181527_13871341 | 3300014153 | Bog | MNESVQTTSTSWWKAWLLDRVAELRQRESQVFLVL |
Ga0181524_103890691 | 3300014155 | Bog | MSESGQKASGSWWRTPRLYVVAKLQQREDQVFLVLALVIG |
Ga0181524_104377511 | 3300014155 | Bog | MSENIQTTSGVGWKTWLSDRVAELRQRESQVFLVLALVIGALTGL |
Ga0181538_100711711 | 3300014162 | Bog | MSESVQTTSGSWWRTSLLDRLAELRQREGQIFLVLALVIGALTGL |
Ga0181531_110195702 | 3300014169 | Bog | MSEAVQTSSAVGWGNWLPRRVSELRQREGQIFLVLALVIGALTGL |
Ga0181526_101011791 | 3300014200 | Bog | VGQFPREMSEGVQTTSGSWWKTSLLKRVAELRHREHQLILV |
Ga0182024_102171631 | 3300014501 | Permafrost | MSEGIQSTPGSWWRAWLLNRVAELRRREDQLILVLALVIGALTGLVV |
Ga0182024_115686691 | 3300014501 | Permafrost | MSEGIQPTPGSWWRAWLLNRVAELRRREDQLILVLALVIGALTGLVV |
Ga0182021_102342253 | 3300014502 | Fen | MTENIQTTSGVGWRTWLSDRVAELRQREDQIVLVLALVI |
Ga0181536_101311791 | 3300014638 | Bog | MSESVQTTTASWWKKSLLDRVAELRQRESQVFLVLALVIGA |
Ga0182030_1001843717 | 3300014838 | Bog | MSEDVETTSGSRWKSWLLLRVAELRQREGQIFLVLALVI |
Ga0182030_111183351 | 3300014838 | Bog | MSENIQTTSGVGWRTWLSDRVAELRQRESQVFLALAL |
Ga0167650_11332402 | 3300015203 | Glacier Forefield Soil | MVHSPEMSESGQTTSEGSWRAWLLDRVAELRQREEQ |
Ga0182036_114337521 | 3300016270 | Soil | MATNQNSWWRTPLLHHFPRLQQREDQIFLALALVIGALNGLAVVTFIVL |
Ga0182040_102269322 | 3300016387 | Soil | MPEQDQTRNTSWWRTPLLMAKMQHREDQVFLVLALVIGALTGLAVVAF |
Ga0187856_11767373 | 3300017925 | Peatland | MTENIETTSGVGWRTWLSDRVAELRQREGQVFLVL |
Ga0187850_104263231 | 3300017941 | Peatland | MSDSGEKTSGSWWRAPRLYLAAKLQQREDQVFLVLALVIG |
Ga0187808_104605151 | 3300017942 | Freshwater Sediment | VGHSPEMSESGQTTSGGSWRAWLLDRVAELRQREEQVFLVLALVIG |
Ga0187847_100276781 | 3300017948 | Peatland | MTESAEMTSTSRWRAWLLGRVAKLRQREGQIFLVL |
Ga0187891_11483303 | 3300017996 | Peatland | VEHSPEMSENIETTSGVGWKPWLSDRVAELRQRESQVFLVLALVIGAL |
Ga0187876_10196641 | 3300018003 | Peatland | VEHFPKMSESVQTTTASWWKKSLLDRVAELRQRESQVFLVLALVI |
Ga0187865_12002303 | 3300018004 | Peatland | MSETVQTPSASGWRAWLPGRLAELRQREGQIFLVLALVIGAL |
Ga0187878_12969441 | 3300018005 | Peatland | MSGSGQTTSESWWRTPQSYFMAKLQQREDQVFLVLAL |
Ga0187805_101562691 | 3300018007 | Freshwater Sediment | MLLVGHSPEMSESGQTTSGGSWRAWLLDRVAELRQREEQVFLVLALVIGALT |
Ga0187874_101886583 | 3300018019 | Peatland | VEHSPEMSENIETTSGVGWKPWLSDRVAELRQRESQVFLVLALVI |
Ga0187874_102872511 | 3300018019 | Peatland | VGHSPEMSENVETRSGSWWRTSLLDRVAELRQRESQVFLVLALVIGAL |
Ga0187882_11794081 | 3300018021 | Peatland | MTENIETTSGVGWKPWLSDRVAELRQRESQVFLVLALVIGALT |
Ga0187882_12344891 | 3300018021 | Peatland | MTEDIQTTKTGGWKTWLLDRLSELRQREGQIFMILALVIGAL |
Ga0187882_13117441 | 3300018021 | Peatland | MLWGRNSLMSETVQTPSASGWRAWLSGRLAELRQREGQIFLVL |
Ga0187863_107212202 | 3300018034 | Peatland | MSDDIQTPSVVGWRNWLQVRVSELRQREGQIFLVLALVIGAL |
Ga0187883_103635971 | 3300018037 | Peatland | VGHSQEMSEGAQTTSRSWWRTSLLGRVAELRQHEGQVIL |
Ga0187862_104587841 | 3300018040 | Peatland | LVEHSPEMSVQTKSGSGWRTWLSDRVGELRQREGQIFLVLALVIGAITGL |
Ga0187851_102052382 | 3300018046 | Peatland | MSDSGEKTSGSWWRAPRLYLAAKLQQREDQVFLVLALVIGAL |
Ga0187859_100221765 | 3300018047 | Peatland | MSEGVQTTRGSWWRTSLLDRVAELRQHEDQVILVLALVI |
Ga0187859_105547562 | 3300018047 | Peatland | MSEAVQTSSAVGWGNWLPRRVSELRQREGQIFLVLALVIGALT |
Ga0187859_105901932 | 3300018047 | Peatland | MSEGVQTTSGSWWKTSLLKRVAELRHREDQLILVLALVI |
Ga0182025_11308751 | 3300019786 | Permafrost | MSESGQKTNGTWWKTPLLHRVGKLQQREDQIFLVEDQIF |
Ga0210407_113705571 | 3300020579 | Soil | MSKSDRITRGNWLRTRLLQRLAILQQREDQVFLVLALV |
Ga0215015_110759581 | 3300021046 | Soil | VGHFRKMSELGQRTSGTWAKTQLLHRLTKLQPREDQVFLVLALVIGALTGLAVVAFIVL |
Ga0210410_113335941 | 3300021479 | Soil | MSDTKSTMSLNWWRTPLLQRVARLREREDQVFLLLALVIG |
Ga0210409_107509752 | 3300021559 | Soil | MTESVGTPNSDSWRNKLLRYISELRQREGQVFLVLALVIGALTGLA |
Ga0126371_137072472 | 3300021560 | Tropical Forest Soil | MLLVGHSQEMSEGIQTTSGSWWRTSLLDRVAELRQHEDQVILVLA |
Ga0224534_10843912 | 3300022524 | Soil | MSEDAQTTSGSWWRTPLVHLAARLHEREDQVFLVLALVIGALT |
Ga0228598_11213971 | 3300024227 | Rhizosphere | VEHYPQMSESDRMTSGSWWRTRLLRRIAILQQREDQVFLFLAL |
Ga0208821_10434873 | 3300025432 | Peatland | VEHSPEMSENIETTSGVGWKPWLSDRVAELRQRESQVFLVLALVIGALTG |
Ga0208455_10844501 | 3300025453 | Peatland | MTENIETASEIGWRTWLSDRVAELRQREGQVFLVLALVI |
Ga0208192_10229461 | 3300025477 | Peatland | MSEGVQTTSGSWWKTSLLGRVAELRQREGQVFLVLALVIGALTG |
Ga0208355_10904451 | 3300025581 | Arctic Peat Soil | MSESGRTTSGNWWRTPLAKLQQQEDQVFLVLALVIGALTGLAVVAFIV |
Ga0208691_11568901 | 3300025612 | Peatland | MSDSGEKTSGSWWRAPRLYLAAKLQQREDQVFLVLALVIGALTGLAV |
Ga0207926_10057495 | 3300025619 | Arctic Peat Soil | MSESGRTTSGNWWRTPLAKLQQQEDQVFLVLALVIGALTG |
Ga0209838_10450311 | 3300026214 | Soil | MLLVGVLKVSESVQTTSGRGWRIWLLNRVAELRQREAQVFLFLALVIGA |
Ga0209839_102552432 | 3300026294 | Soil | MAESAEFKKKGSWTTWFSDRVAELRQREEQVFLVLALVIGA |
Ga0179587_111493591 | 3300026557 | Vadose Zone Soil | MSESGRTTNGNLWKSSTLVQRLQQREDQVFLVLALVIGALTGLAVV |
Ga0209529_10096621 | 3300027334 | Forest Soil | MTESVEIPTSSGWRSKLLRHIAELRQREGQVFLVLALVI |
Ga0208043_10346051 | 3300027570 | Peatlands Soil | MSDSAQTTSTSAWRSWLLDRVAELRQREGQIFLVSALVI |
Ga0209118_10685862 | 3300027674 | Forest Soil | MSEPVPTTSGSWWRTWLLLRVAELRQREGQIFVVLALVIGAL |
Ga0209011_10715332 | 3300027678 | Forest Soil | MNDDVQTTSGGWWRTRLLPRVAELRQREGQVFLILALVIGALTGLA |
Ga0209773_102874432 | 3300027829 | Bog Forest Soil | MSETIQTMSPGGWRNRLLLRVAKLRQREGQIFLVLALVIGALTG |
Ga0209517_103534632 | 3300027854 | Peatlands Soil | VGHSQEMNEGVQTTSRSWWRTSLLDRVAELRQHEDQVILVLALVIG |
Ga0209283_108972541 | 3300027875 | Vadose Zone Soil | MSESGQTTSRNWWKTPLLHLLDKVQQREDQVFLVLTLVIGAL |
Ga0209415_102039302 | 3300027905 | Peatlands Soil | VGHSQEMNEGVQTTSRSWWRTSLLDRVAELRQHEDQVILVLALVIGALTGLA |
Ga0209415_105019452 | 3300027905 | Peatlands Soil | MSENAVTMNPSWWRTPLLQRVARLREREDQVFLFLALVIGALTGMTV |
Ga0209698_104003671 | 3300027911 | Watersheds | MGHSPEMHETGHTSGSWWRTPLLHWVARLQRREDQVFLILALVIGALTGLAVVS |
Ga0209526_101700651 | 3300028047 | Forest Soil | MLLVGRSPEMSESVQTTSGSWRRTSLLDRVAELRQREGQVFLVLALVIGALTG |
Ga0255358_10303471 | 3300028069 | Soil | MTETIQTTSGSWRDSLLRRLAELRQREGQVFLVLALVIGALT |
Ga0302227_103206251 | 3300028795 | Palsa | MTEAVKTTSGSNRKTWLRARLAKLRLREDQVFLVLALVIGAL |
Ga0307310_107385842 | 3300028824 | Soil | MTERLQTTSRSWWRSSLLHYVAELRQREGQIFLVLALVIGVLTGF |
Ga0311369_112743441 | 3300029910 | Palsa | MLWMGDSPDMSEGVQTAAGSWWTTWLAARMEELRRREDQVFLLLALVIGALTGM |
Ga0302182_104376752 | 3300030054 | Palsa | LGGHPNKMSDGGEKTSGSWWRTPRLYVAAKLQQREDQVFLVLALVIGALTGLAVVG |
Ga0311353_110901131 | 3300030399 | Palsa | MSEPIQTPSRGWWKVSLTDRMAELRQREGQVFLVLSLVIGALT |
Ga0311370_104670123 | 3300030503 | Palsa | MSESVQDPVDGWWSIWLSNRLAELRRREHQVILVLALVIGALTGAAVV |
Ga0316363_102906082 | 3300030659 | Peatlands Soil | MSESGQTISTNWWKTWLSDRVAELRQREDQIFLVLAL |
Ga0310039_100782481 | 3300030706 | Peatlands Soil | MSDSAQTTSTSGWRSWLLDRLAELQQREGQIFLVLALVI |
Ga0170824_1066557151 | 3300031231 | Forest Soil | MQEIRAKMSEGVQASVGGWLRIWLSNRLAELRAREHQVILVLALVIGALT |
Ga0170824_1285091861 | 3300031231 | Forest Soil | MVFFDPLMTENRQENSRSRWRTPLVYLSARLQEHEDQVFLVLALVIGA |
Ga0302324_1004066483 | 3300031236 | Palsa | MSESRHSVGESWWRTPRSYLSARLHEHEDRVFLVLALVIGAL |
Ga0307476_102143491 | 3300031715 | Hardwood Forest Soil | MTENRPQKNGTWWRTPLVYLRARLQEHEDQVFLVLALVIGALTGLTVVAF |
Ga0306918_101559292 | 3300031744 | Soil | MSEGGQTTNGTWWKTPLLHRLGKLREREDQVFLILALVIGAITGSAVVAF |
Ga0307472_1002797683 | 3300032205 | Hardwood Forest Soil | MSEPVQTTSGSWWRTRLLPRVAELRQREGQVFLILALVIGALTGMVV |
Ga0306920_1007573503 | 3300032261 | Soil | MPGAEIGDSGERTSGSWWRTPLSYLTARLQQREDQVFLVLALVIG |
Ga0335080_111591482 | 3300032828 | Soil | MNGNGKTARGSWWRTPLLYLASRLQQREDQVFLVLALVIGALTGLAVVA |
Ga0310914_103973292 | 3300033289 | Soil | MPEQDQTRNTSWWRTPLLMAKMQHREDQVFLVLALVIGAL |
Ga0370492_0463120_391_513 | 3300034282 | Untreated Peat Soil | MTENIQTTSGVGWRAWLSDRAAELRQRESQVFLALALVIGA |
⦗Top⦘ |