Basic Information | |
---|---|
Family ID | F060167 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 133 |
Average Sequence Length | 43 residues |
Representative Sequence | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSIS |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 51.88 % |
% of genes near scaffold ends (potentially truncated) | 96.24 % |
% of genes from short scaffolds (< 2000 bps) | 94.74 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.985 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.278 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.053 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.624 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.54% β-sheet: 11.27% Coil/Unstructured: 66.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF01523 | PmbA_TldD | 61.65 |
PF00202 | Aminotran_3 | 0.75 |
PF04471 | Mrr_cat | 0.75 |
PF02569 | Pantoate_ligase | 0.75 |
PF05016 | ParE_toxin | 0.75 |
PF02548 | Pantoate_transf | 0.75 |
PF04072 | LCM | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 61.65 |
COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.75 |
COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 0.75 |
COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.98 % |
Unclassified | root | N/A | 6.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003218|JGI26339J46600_10149920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 543 | Open in IMG/M |
3300003219|JGI26341J46601_10106074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 815 | Open in IMG/M |
3300003368|JGI26340J50214_10040178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1339 | Open in IMG/M |
3300004092|Ga0062389_102237835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 720 | Open in IMG/M |
3300004092|Ga0062389_104291450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 536 | Open in IMG/M |
3300004152|Ga0062386_101869198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 501 | Open in IMG/M |
3300005166|Ga0066674_10493554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 552 | Open in IMG/M |
3300005178|Ga0066688_10852892 | Not Available | 565 | Open in IMG/M |
3300005435|Ga0070714_101526039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 653 | Open in IMG/M |
3300005538|Ga0070731_10441103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 866 | Open in IMG/M |
3300005541|Ga0070733_10945168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 579 | Open in IMG/M |
3300005557|Ga0066704_10966187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 526 | Open in IMG/M |
3300005568|Ga0066703_10772972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
3300005591|Ga0070761_10148329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1373 | Open in IMG/M |
3300005598|Ga0066706_11171815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
3300005602|Ga0070762_10123043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
3300005610|Ga0070763_10812321 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005610|Ga0070763_10963351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 510 | Open in IMG/M |
3300005712|Ga0070764_10783428 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300005764|Ga0066903_102054875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1099 | Open in IMG/M |
3300005995|Ga0066790_10081424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1393 | Open in IMG/M |
3300006028|Ga0070717_10119560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2256 | Open in IMG/M |
3300006028|Ga0070717_10697396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 922 | Open in IMG/M |
3300006176|Ga0070765_100255988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1606 | Open in IMG/M |
3300006176|Ga0070765_100655532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 991 | Open in IMG/M |
3300006794|Ga0066658_10726182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 551 | Open in IMG/M |
3300006854|Ga0075425_101252080 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300006893|Ga0073928_10187365 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
3300009038|Ga0099829_11078725 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300009088|Ga0099830_10467210 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300009518|Ga0116128_1104319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
3300009552|Ga0116138_1191530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300009624|Ga0116105_1231129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300009628|Ga0116125_1087279 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300009628|Ga0116125_1147225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300009640|Ga0116126_1072408 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300010335|Ga0134063_10328340 | Not Available | 740 | Open in IMG/M |
3300010359|Ga0126376_11270981 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300011269|Ga0137392_10728771 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300011270|Ga0137391_10593554 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300011411|Ga0153933_1032197 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300012202|Ga0137363_11483021 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012203|Ga0137399_11136856 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300012211|Ga0137377_10222311 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300012356|Ga0137371_10616627 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300012362|Ga0137361_10215975 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
3300012924|Ga0137413_11691225 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300012944|Ga0137410_10737856 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300012944|Ga0137410_11884582 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300014495|Ga0182015_10089204 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
3300014501|Ga0182024_11848156 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300014657|Ga0181522_10178699 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300014658|Ga0181519_10923953 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300015371|Ga0132258_13113410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
3300017924|Ga0187820_1184396 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300017927|Ga0187824_10346988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300017940|Ga0187853_10223265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
3300017942|Ga0187808_10433126 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300018006|Ga0187804_10237356 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300018017|Ga0187872_10502351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300018024|Ga0187881_10227350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300018026|Ga0187857_10495957 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300018027|Ga0184605_10148982 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300018060|Ga0187765_10495765 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300018062|Ga0187784_10116729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2176 | Open in IMG/M |
3300018088|Ga0187771_10798011 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300018090|Ga0187770_10453989 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300018090|Ga0187770_10856760 | Not Available | 728 | Open in IMG/M |
3300018090|Ga0187770_11056484 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300018090|Ga0187770_11321089 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300018431|Ga0066655_11369614 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300018468|Ga0066662_12087444 | Not Available | 594 | Open in IMG/M |
3300018482|Ga0066669_12140648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 529 | Open in IMG/M |
3300018482|Ga0066669_12462527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300020580|Ga0210403_10802246 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300020581|Ga0210399_11357251 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300020582|Ga0210395_10045006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3230 | Open in IMG/M |
3300021180|Ga0210396_11728995 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300021402|Ga0210385_11471835 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300021406|Ga0210386_10713158 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300021474|Ga0210390_10070189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2896 | Open in IMG/M |
3300021478|Ga0210402_10108113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2504 | Open in IMG/M |
3300022557|Ga0212123_10701552 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300023019|Ga0224560_101784 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
3300025320|Ga0209171_10521872 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300025412|Ga0208194_1015881 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
3300025434|Ga0208690_1050468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300025460|Ga0208562_1081049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300025500|Ga0208686_1053774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
3300025854|Ga0209176_10135534 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300025905|Ga0207685_10206699 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300025912|Ga0207707_10496075 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300026305|Ga0209688_1003738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2680 | Open in IMG/M |
3300026310|Ga0209239_1205501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300026326|Ga0209801_1217713 | Not Available | 750 | Open in IMG/M |
3300026528|Ga0209378_1214504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300026537|Ga0209157_1061783 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
3300026557|Ga0179587_10343413 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300027591|Ga0209733_1049993 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300027643|Ga0209076_1193118 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300027681|Ga0208991_1024706 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
3300027738|Ga0208989_10093434 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300027812|Ga0209656_10087589 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
3300027855|Ga0209693_10487008 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300027862|Ga0209701_10617833 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300027869|Ga0209579_10282193 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300027879|Ga0209169_10475636 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300027889|Ga0209380_10267151 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300027894|Ga0209068_10278613 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300028780|Ga0302225_10174287 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300028780|Ga0302225_10208555 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300028800|Ga0265338_10312816 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300029636|Ga0222749_10191154 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300029907|Ga0311329_11051669 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300029986|Ga0302188_10184547 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300030007|Ga0311338_10266793 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
3300030057|Ga0302176_10066676 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
3300030943|Ga0311366_10824769 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300031231|Ga0170824_116773608 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300031234|Ga0302325_10739566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1405 | Open in IMG/M |
3300031524|Ga0302320_10890473 | Not Available | 966 | Open in IMG/M |
3300031715|Ga0307476_10532596 | Not Available | 870 | Open in IMG/M |
3300031718|Ga0307474_10435750 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300031718|Ga0307474_10540274 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300031754|Ga0307475_11485885 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031962|Ga0307479_10508243 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300031962|Ga0307479_11031609 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300032770|Ga0335085_10448696 | Not Available | 1485 | Open in IMG/M |
3300032805|Ga0335078_11510984 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300032828|Ga0335080_11032129 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300033405|Ga0326727_11097811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300033807|Ga0314866_038690 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300034199|Ga0370514_133388 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.28% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 7.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.77% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.26% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.26% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.51% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.76% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.76% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.01% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.01% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.26% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.26% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.26% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.26% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.26% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.50% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.75% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.75% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.75% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.75% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI26339J46600_101499201 | 3300003218 | Bog Forest Soil | MWTIPVVTAEALTRALEEFLAGAAGAVVLEDGAVTFDLERAKYSISGE |
JGI26341J46601_101060741 | 3300003219 | Bog Forest Soil | MTPQILTRTVQDFLSEAAGAVVLENGIVAFDLAQSKYSIS |
JGI26340J50214_100401781 | 3300003368 | Bog Forest Soil | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLSRSKYSISG |
Ga0062389_1022378352 | 3300004092 | Bog Forest Soil | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYN |
Ga0062389_1042914502 | 3300004092 | Bog Forest Soil | MTPEALTRVVQEFLGEASGATVLEDGAVTFDLARAKYSVSGE |
Ga0062386_1018691982 | 3300004152 | Bog Forest Soil | MTPEMLTRTLQEFLAEASGAIVLEDGAIAFDLSRAKYSISGEHNKCLLH |
Ga0066674_104935541 | 3300005166 | Soil | MTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSISGER |
Ga0066688_108528921 | 3300005178 | Soil | MTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSIS |
Ga0070714_1015260393 | 3300005435 | Agricultural Soil | MLSRTVADFLSEAAGAVVLEDGAVAFDLGQAKYSISGEHNK |
Ga0070731_104411031 | 3300005538 | Surface Soil | MTPESLTQTVQDFLSEASGAVVLEDGAVVFDLAQSKYS |
Ga0070733_109451682 | 3300005541 | Surface Soil | MWTIPLMTPDTLTRTVQDFLSEAAGAVVLENGAVAFDLSQSKYSISGEY |
Ga0066704_109661871 | 3300005557 | Soil | VNPETLVRTVEDFLVGSRDAVVMEDGAVAFDLAQSKYSI |
Ga0066703_107729722 | 3300005568 | Soil | VNPETLVRTVEDFLVGARNAVVMEDGAVAFDLAQSKYSISGERNKCVL |
Ga0070761_101483291 | 3300005591 | Soil | VDNSLVTPDALTRTLQDFLSGASGAVVLEDGAVAFDLCESKYSISGD |
Ga0066706_111718151 | 3300005598 | Soil | VSPETLVRTVEDFLVGSRNAVVMEDGAVAFDLAQSKYSISGER |
Ga0070762_101230432 | 3300005602 | Soil | VWTMQVDLPMPTMTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAKSKY* |
Ga0070763_108123211 | 3300005610 | Soil | MQVDLPMPTMTPQALTRTVQDFLSEAAGAVVLENGAVAFDLA |
Ga0070763_109633511 | 3300005610 | Soil | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNR |
Ga0070764_107834281 | 3300005712 | Soil | MATPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQS |
Ga0066903_1020548751 | 3300005764 | Tropical Forest Soil | MDVNNSVMTPESPTQTVQDFLSDATGAVVPEDGAVTFDLAQAKYSTSG |
Ga0066790_100814241 | 3300005995 | Soil | MWTIALVTPDTLTRTVQDYLSEASGAVVLENGAVAFDLGQSKYSISGE |
Ga0070717_101195601 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MARVTPELLTRTVQDYLKEASGAVVLENGSVAFDLGRA |
Ga0070717_106973961 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSPESLTRTVQDFLSEASGAVVLENGAVMFDLAQSKYSISGE |
Ga0070765_1002559884 | 3300006176 | Soil | MNVEALTATLRDYLADASGAVVLEDGAVTFDLERAKYSVSGERDKCL |
Ga0070765_1006555322 | 3300006176 | Soil | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYAI |
Ga0066658_107261821 | 3300006794 | Soil | VTPDALIHIVEGFLAGSRDAVVIEDGAVTFDLAQAKYAISGEHNKCLVHL |
Ga0075425_1012520802 | 3300006854 | Populus Rhizosphere | VNPETLVRTVEDFLVGARNAVVMEDGAVAFDLAQSHLWSSER |
Ga0073928_101873651 | 3300006893 | Iron-Sulfur Acid Spring | MPTVTPQALARTVQDFLSEAAGAVVLENGAVAFDLAQSKY |
Ga0099829_110787252 | 3300009038 | Vadose Zone Soil | MWTIPFVTPDALTRTVQDFLSEASGAVVLENGAVAFDL |
Ga0099830_104672102 | 3300009088 | Vadose Zone Soil | MWTIPCVTPDALTRTVQDFLSEASGAVVLENGAVAFDLS |
Ga0116128_11043191 | 3300009518 | Peatland | MVNGQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE* |
Ga0116138_11915301 | 3300009552 | Peatland | TLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE* |
Ga0116105_12311291 | 3300009624 | Peatland | TPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE* |
Ga0116125_10872792 | 3300009628 | Peatland | MVTPALTRTVQDFLREAAGAVVLENGAVAFDLAPSKYSISGE* |
Ga0116125_11472252 | 3300009628 | Peatland | QWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE* |
Ga0116126_10724081 | 3300009640 | Peatland | MPMLTPQALTRTVQEFLSEAAGAVVLENGAVAFDLAQSKYSISGEHN |
Ga0134063_103283401 | 3300010335 | Grasslands Soil | MTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAK |
Ga0126376_112709812 | 3300010359 | Tropical Forest Soil | MTPEALVRTVEGFLSGARDAVVLEDGAVAFDLAQAKYS |
Ga0137392_107287712 | 3300011269 | Vadose Zone Soil | MTSESLVRTLEDFLAGSRDAVVLEEGAVAFDLAWAKYSISGERGKC |
Ga0137391_105935541 | 3300011270 | Vadose Zone Soil | MPTVTPQALTRTVQDFLNEAAGAVVLENGAVAFDLAQSKY |
Ga0153933_10321972 | 3300011411 | Attine Ant Fungus Gardens | MPLVTPQALTQTVQDFLCEASGAVVLENGAVAFDLAQAKYSISGEYNR |
Ga0137363_114830212 | 3300012202 | Vadose Zone Soil | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYS |
Ga0137399_111368562 | 3300012203 | Vadose Zone Soil | MAAMTPDALTRTVQDFLSEAAGAVVLEDGAVAFDLG |
Ga0137377_102223111 | 3300012211 | Vadose Zone Soil | MDNSIVTPDSLIRIVQDFLSEAAGAVVLEDGAVSFDLGQAKYSISGDHNTCL |
Ga0137371_106166272 | 3300012356 | Vadose Zone Soil | MTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYS |
Ga0137361_102159752 | 3300012362 | Vadose Zone Soil | VNPETLVRTVEDFLVGARNAVVMEDGAVAFDLAQSKYSISGERN |
Ga0137413_116912251 | 3300012924 | Vadose Zone Soil | MPTVTPQTLTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNR |
Ga0137410_107378562 | 3300012944 | Vadose Zone Soil | MPTVTPEALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYS |
Ga0137410_118845821 | 3300012944 | Vadose Zone Soil | MTPELLTRTVQDFLSDASGAVVLEEGAVTFDLGQAKYSISGECNKCL |
Ga0182015_100892041 | 3300014495 | Palsa | VTPESLTRTVQDFLNEAVGAVVLEDGAVAFDLAQARYS |
Ga0182024_118481562 | 3300014501 | Permafrost | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQS |
Ga0181522_101786991 | 3300014657 | Bog | MTPETLGRTVADFLADAAGAVVLEDGALAFDLAQARYS |
Ga0181519_109239532 | 3300014658 | Bog | MLTPQALTQTVQEFLSDASSAVVLENGAVAFDLAQS |
Ga0132258_131134104 | 3300015371 | Arabidopsis Rhizosphere | MNSELLARTLEEFLSDASGAVVIEDGAVTFDLAQAKYSISGEHNK* |
Ga0187820_11843961 | 3300017924 | Freshwater Sediment | MTPEALSHTVQEFLSEASGAIVLEVGAVAFDLERAKHSISGEYNKCLLHL |
Ga0187824_103469881 | 3300017927 | Freshwater Sediment | VTPDALTRTVQEFLSEASGAVVLEDGAVAFDLGQAKYSISGDYNKCLL |
Ga0187853_102232652 | 3300017940 | Peatland | MVNGQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE |
Ga0187808_104331261 | 3300017942 | Freshwater Sediment | MTPEMLSRTIADFLAEACGAVVLEDGAVAFDLAQAKYS |
Ga0187804_102373561 | 3300018006 | Freshwater Sediment | MTPEALTNTLQDFLAEASGAVVLEDGAVAFDLGQAKYSISGE |
Ga0187872_105023511 | 3300018017 | Peatland | NGQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE |
Ga0187881_102273503 | 3300018024 | Peatland | ALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE |
Ga0187857_104959572 | 3300018026 | Peatland | MPTVTPQALTRTVQDFLSQAAGAVVLENGAVAFDLAQSKYS |
Ga0184605_101489821 | 3300018027 | Groundwater Sediment | VNPETLVRTVKDFLVGARNAVVMEDGAVAFDLAQSKYSISG |
Ga0187765_104957651 | 3300018060 | Tropical Peatland | MSPETLARTLEEFLSEASGAVVLEDGAVTFDLAQAKY |
Ga0187784_101167293 | 3300018062 | Tropical Peatland | MWRIPVVTPDALARTLQDFLADASGAVVLENGAVAFDLERAKYSISGEY |
Ga0187771_107980111 | 3300018088 | Tropical Peatland | MTAETLTRTLQDFLAEASGAVVLEDGAVAFDLERAKYSISGEYNK |
Ga0187770_104539891 | 3300018090 | Tropical Peatland | MTAETLTRTLQEFLAEASGAVVLEDGAVAFDLERAKYSI |
Ga0187770_108567602 | 3300018090 | Tropical Peatland | MLSMTPESLARTVQGFLSEASGAVVLEDGAVTFDLERS |
Ga0187770_110564842 | 3300018090 | Tropical Peatland | MSTIPGVTPEALTRTLQDFLAEASGAVVLEDGAVSFDLERA |
Ga0187770_113210891 | 3300018090 | Tropical Peatland | MPTLTPQALTRTVQDFLSEAATAVVLENGAVAFDLAQSK |
Ga0066655_113696141 | 3300018431 | Grasslands Soil | VHNSPVTPESLTRTVQDFLAEASGALVLEDGAVSFDLARAKYSISGEYNKCLL |
Ga0066662_120874441 | 3300018468 | Grasslands Soil | MTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSISG |
Ga0066669_121406482 | 3300018482 | Grasslands Soil | MTPEALVRTVDDFLCGARDAVVLDDGAVVFDLAQAKYSISGERNKCLLH |
Ga0066669_124625271 | 3300018482 | Grasslands Soil | MPTVTPEALTRTVHDFLNQAAGAIVLENGAVAFDLTQSKFSISGEYNRCLLHL |
Ga0210403_108022462 | 3300020580 | Soil | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSIS |
Ga0210399_113572511 | 3300020581 | Soil | MPTVTPQALTRTVQDFLNEAAGAVVLENGAVAFDLAQSKYSISGEYNR |
Ga0210395_100450064 | 3300020582 | Soil | MRTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNRCLL |
Ga0210396_117289951 | 3300021180 | Soil | MPMVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKY |
Ga0210385_114718352 | 3300021402 | Soil | MPMVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNR |
Ga0210386_107131581 | 3300021406 | Soil | MQTVNPQALTRTVQEFLSEAAGALVLENGAVAFDLAQSKYSISG |
Ga0210390_100701891 | 3300021474 | Soil | MRTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSI |
Ga0210402_101081131 | 3300021478 | Soil | MPTVTPQALTRTVQDFLSEAAGAIVLENGAVAFDLAQSKYSI |
Ga0212123_107015521 | 3300022557 | Iron-Sulfur Acid Spring | MPTVTSQALTRTVQDFLSEATGAVVLENGAVAFDLAQSKYSISGEYNR |
Ga0224560_1017841 | 3300023019 | Soil | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNRCLL |
Ga0209171_105218721 | 3300025320 | Iron-Sulfur Acid Spring | MPTVTSQALTRTVQDFLSEATGAVVLENGAVAFDL |
Ga0208194_10158811 | 3300025412 | Peatland | MANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSIS |
Ga0208690_10504682 | 3300025434 | Peatland | QWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE |
Ga0208562_10810492 | 3300025460 | Peatland | RTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE |
Ga0208686_10537742 | 3300025500 | Peatland | RHSGMVNGQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE |
Ga0209176_101355341 | 3300025854 | Arctic Peat Soil | VTPDALTRTVQDFLSEAAGAVVLEDGAVAFDLGRSKYSISGEYN |
Ga0207685_102066992 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPDSLTRTVQDFLSEAAGAVVLENGAVAFDLSEAKYSISGEYEKCLL |
Ga0207707_104960751 | 3300025912 | Corn Rhizosphere | MRLPDVHNSPVTPETLTRTVQDFLAEASGALVFEDGAVSFDLARAKYSISGE |
Ga0209688_10037381 | 3300026305 | Soil | MTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQA |
Ga0209239_12055011 | 3300026310 | Grasslands Soil | MTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSISGERNKCL |
Ga0209801_12177131 | 3300026326 | Soil | MTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKY |
Ga0209378_12145041 | 3300026528 | Soil | MTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSISGE |
Ga0209157_10617831 | 3300026537 | Soil | MKPEALVRTVEDFLVSASDAVVMEEGVIAFDLANAKYYL |
Ga0179587_103434132 | 3300026557 | Vadose Zone Soil | MPSVTSETLTRTVQDFLSEAAGAVVLENGAVTFDLTQS |
Ga0209733_10499932 | 3300027591 | Forest Soil | MPTVTPHALTRTVQDFLSGAAGAMVLENGAVAFDLAQSKYSISG |
Ga0209076_11931181 | 3300027643 | Vadose Zone Soil | VNPETLVRTVEDFLVGARNAVVMEDGAVAFDLAQSKYSISGERNK |
Ga0208991_10247062 | 3300027681 | Forest Soil | MPRVTPEALTRTVQDYLNQASGAVVLEDGSVAFDLGRAKYSIS |
Ga0208989_100934342 | 3300027738 | Forest Soil | VTPEALTRTVQDYLNQASGAVVLEGGSVAFDLGRAKYSISGEH |
Ga0209656_100875891 | 3300027812 | Bog Forest Soil | MPVTPQVLTRTLQDFLSEAAGAVVLENGAVAFDLAQSKY |
Ga0209693_104870081 | 3300027855 | Soil | MQVDLPMPTMTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSK |
Ga0209701_106178332 | 3300027862 | Vadose Zone Soil | MPTVTPQALTRTVQDFLSEAAGAVVLENGTVAFDLA |
Ga0209579_102821932 | 3300027869 | Surface Soil | MTPESLTQTVQDFLSEASGAVVLEDGAVVFDLAQSKYSISGEHN |
Ga0209169_104756362 | 3300027879 | Soil | MTPDLLTRTVQDFLSDASGAVVLEDGAVAFDLGQAKY |
Ga0209380_102671511 | 3300027889 | Soil | MQTVNPQALTRTVQEFLSEAAGALVLENGAVAFDLAQSKYSIS |
Ga0209068_102786132 | 3300027894 | Watersheds | MTPEALVRSVQDFLSACCDAVVLEDGASVFDLAQSKYSISG |
Ga0302225_101742872 | 3300028780 | Palsa | MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSI |
Ga0302225_102085551 | 3300028780 | Palsa | MTPDALTRAVQDFLGEAVGAVVLEDGAVTFDLARAKKK |
Ga0265338_103128161 | 3300028800 | Rhizosphere | VNNSHVTPDALTRTVQDFLSEASGAVVLENGALDFDLAQSKYSISGEYNKC |
Ga0222749_101911542 | 3300029636 | Soil | MPTVTPQALIRTVHDFLSEAAGAVVLENGSVAFDL |
Ga0311329_110516691 | 3300029907 | Bog | MCGDGSMTTVTPQALTRTVQDFLSQAAGAVVLENGAVAFDLAQC |
Ga0302188_101845471 | 3300029986 | Bog | VSSVTPQALTQTVQDFLSESAGAVVLENGCVAFDLAQSKYSISGEYNRCL |
Ga0311338_102667932 | 3300030007 | Palsa | MVTPQALTRTVQDFLSEAAGAVVLENGSVAFDLAQSK |
Ga0302176_100666762 | 3300030057 | Palsa | MNPELLTRTVRDFLSEAAGAVVLEDGAVAFDLARSKYSISGEQNKCL |
Ga0311366_108247692 | 3300030943 | Fen | MTPESLRRTVSDFLAESRAAVVIEDGAAVFDLTEAKYSISGEYNKCLLQ |
Ga0170824_1167736083 | 3300031231 | Forest Soil | MPTVSPQILTRTVQDFLSEAAGAIVLENGAVAFDLA |
Ga0302325_107395662 | 3300031234 | Palsa | MPTVTPQSLTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYS |
Ga0302320_108904732 | 3300031524 | Bog | MVTPALTRTVQDFLREAAGAVVLENGAVAFDLAPSKYSISGE |
Ga0307476_105325962 | 3300031715 | Hardwood Forest Soil | MMTPERLTRTLQDFLSEAAGAVVLEDGAVAFDLERAKYSI |
Ga0307474_104357502 | 3300031718 | Hardwood Forest Soil | MWTIPSVTPDLLTRTVQEFLSEASGAVVLEDGAVA |
Ga0307474_105402741 | 3300031718 | Hardwood Forest Soil | MPTVTPQALTRTVQDFLSEAAGAVVLENGSVAFDLAESKYSISGEYNR |
Ga0307475_114858852 | 3300031754 | Hardwood Forest Soil | MQTVNPQALTRTVQEFLSEAAGALVLENGAVAFDLAQSKYSI |
Ga0307479_105082431 | 3300031962 | Hardwood Forest Soil | MAIRDNWSMNAETLTHTLEEFLSDASGAVVIEDGAVMFDLAQAKYSISGEHN |
Ga0307479_110316092 | 3300031962 | Hardwood Forest Soil | MWTIPLMTSDTLTRTVQDFLSEAAGAVVLENGAVA |
Ga0335085_104486962 | 3300032770 | Soil | MTPESLSRELEGFLAGARGAVVLEAGAVLFDLAHAKYSISGE |
Ga0335078_115109842 | 3300032805 | Soil | MWTILSVTPEALSHTVQEFLSEASGAVVLENGAVAFDLERAK |
Ga0335080_110321291 | 3300032828 | Soil | VNPDALTRTLQEFLAEASGAVVLEDGAVAFDLARAKYSIS |
Ga0326727_110978111 | 3300033405 | Peat Soil | MNPEHLTRTLQDFLGDATGAVVLEDGVVAFDLAQAKYSISGERNKC |
Ga0314866_038690_1_132 | 3300033807 | Peatland | MTPEALTRTLQQFLSEASGAVVLEDGAVTFDLVQARYSISGEYD |
Ga0370514_133388_528_638 | 3300034199 | Untreated Peat Soil | MPMATPQSLTRTVQDFLSEAATAVVLEDGMVAFDLAQ |
⦗Top⦘ |