NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059985

Metagenome / Metatranscriptome Family F059985

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059985
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 106 residues
Representative Sequence MIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKYEYIMRFFWELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNQKEIESKIKELQAEIDLLTEWKQA
Number of Associated Samples 120
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 17.29 %
% of genes near scaffold ends (potentially truncated) 36.84 %
% of genes from short scaffolds (< 2000 bps) 67.67 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.211 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(15.038 % of family members)
Environment Ontology (ENVO) Unclassified
(53.383 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(86.466 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.53%    β-sheet: 11.01%    Coil/Unstructured: 50.46%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF01391Collagen 6.02
PF00575S1 3.76
PF00085Thioredoxin 2.26
PF04865Baseplate_J 0.75
PF01165Ribosomal_S21 0.75
PF01556DnaJ_C 0.75
PF03382DUF285 0.75
PF00166Cpn10 0.75
PF07591PT-HINT 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.75
COG0484DnaJ-class molecular chaperone with C-terminal Zn finger domainPosttranslational modification, protein turnover, chaperones [O] 0.75
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.24 %
UnclassifiedrootN/A3.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000929|NpDRAFT_10163406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium664Open in IMG/M
3300001348|JGI20154J14316_10095498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium971Open in IMG/M
3300001460|JGI24003J15210_10000064Not Available40691Open in IMG/M
3300001472|JGI24004J15324_10020143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2269Open in IMG/M
3300003620|JGI26273J51734_10039967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1574Open in IMG/M
3300004097|Ga0055584_100199120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2033Open in IMG/M
3300004097|Ga0055584_100338323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1550Open in IMG/M
3300004097|Ga0055584_100380751All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1458Open in IMG/M
3300005590|Ga0070727_10713850All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium562Open in IMG/M
3300005601|Ga0070722_10510254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium540Open in IMG/M
3300006025|Ga0075474_10034326All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1771Open in IMG/M
3300006403|Ga0075514_1561049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium534Open in IMG/M
3300006789|Ga0098054_1050619All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1591Open in IMG/M
3300006790|Ga0098074_1032290All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1520Open in IMG/M
3300006793|Ga0098055_1026052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2452Open in IMG/M
3300006802|Ga0070749_10111157All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1614Open in IMG/M
3300006810|Ga0070754_10069213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1808Open in IMG/M
3300006868|Ga0075481_10033999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1982Open in IMG/M
3300006869|Ga0075477_10049009All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1886Open in IMG/M
3300006870|Ga0075479_10362259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M
3300006919|Ga0070746_10161218All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1087Open in IMG/M
3300007231|Ga0075469_10037859All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1507Open in IMG/M
3300007346|Ga0070753_1015668All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3458Open in IMG/M
3300007539|Ga0099849_1069952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1434Open in IMG/M
3300007539|Ga0099849_1166309All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium845Open in IMG/M
3300007541|Ga0099848_1000264All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15723423Open in IMG/M
3300007558|Ga0102822_1060855All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium892Open in IMG/M
3300008050|Ga0098052_1003157All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1579774Open in IMG/M
3300008961|Ga0102887_1035537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1690Open in IMG/M
3300009027|Ga0102957_1144363All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium842Open in IMG/M
3300009149|Ga0114918_10000180Not Available51337Open in IMG/M
3300009433|Ga0115545_1240145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300009436|Ga0115008_10591702All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium798Open in IMG/M
3300009498|Ga0115568_10000675All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15725162Open in IMG/M
3300009599|Ga0115103_1477571All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium959Open in IMG/M
3300009599|Ga0115103_1491905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium687Open in IMG/M
3300009606|Ga0115102_10893489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1602Open in IMG/M
3300010150|Ga0098056_1081855All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1105Open in IMG/M
3300010297|Ga0129345_1248105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium623Open in IMG/M
3300012920|Ga0160423_10241073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1253Open in IMG/M
3300012928|Ga0163110_10146913All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1629Open in IMG/M
3300012936|Ga0163109_10187511All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1519Open in IMG/M
3300013010|Ga0129327_10033447All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2635Open in IMG/M
3300013103|Ga0164318_10464351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1097Open in IMG/M
3300017709|Ga0181387_1103616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium583Open in IMG/M
3300017725|Ga0181398_1037356All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1187Open in IMG/M
3300017752|Ga0181400_1107300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium816Open in IMG/M
3300017773|Ga0181386_1134764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium760Open in IMG/M
3300017776|Ga0181394_1087777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1003Open in IMG/M
3300017782|Ga0181380_1119237All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium908Open in IMG/M
3300017818|Ga0181565_10736819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium623Open in IMG/M
3300017824|Ga0181552_10159410All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1195Open in IMG/M
3300017950|Ga0181607_10000878All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15726555Open in IMG/M
3300017950|Ga0181607_10044223All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3075Open in IMG/M
3300017951|Ga0181577_10084792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2208Open in IMG/M
3300017952|Ga0181583_10413604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium837Open in IMG/M
3300017957|Ga0181571_10195321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1312Open in IMG/M
3300017968|Ga0181587_10055621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2917Open in IMG/M
3300018421|Ga0181592_10183207All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1577Open in IMG/M
3300018428|Ga0181568_10993429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium639Open in IMG/M
3300019214|Ga0180037_1101245All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium849Open in IMG/M
3300019459|Ga0181562_10480196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium591Open in IMG/M
3300020165|Ga0206125_10014867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5060Open in IMG/M
3300020189|Ga0181578_10228173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium906Open in IMG/M
3300020392|Ga0211666_10364075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300020442|Ga0211559_10011281Not Available4637Open in IMG/M
3300020450|Ga0211641_10058960All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2009Open in IMG/M
3300020463|Ga0211676_10003417All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15715506Open in IMG/M
3300021085|Ga0206677_10001004All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15726615Open in IMG/M
3300021085|Ga0206677_10310492All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium627Open in IMG/M
3300021089|Ga0206679_10509979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium626Open in IMG/M
3300021185|Ga0206682_10415628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium566Open in IMG/M
3300021356|Ga0213858_10081801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1575Open in IMG/M
3300021364|Ga0213859_10002999All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1577486Open in IMG/M
3300021389|Ga0213868_10002413All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15717934Open in IMG/M
3300021957|Ga0222717_10110252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1713Open in IMG/M
3300021958|Ga0222718_10000303All Organisms → cellular organisms → Bacteria53901Open in IMG/M
3300021958|Ga0222718_10116210All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1554Open in IMG/M
3300021959|Ga0222716_10196982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1278Open in IMG/M
3300022220|Ga0224513_10120500All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1008Open in IMG/M
3300022927|Ga0255769_10120003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1292Open in IMG/M
3300023084|Ga0255778_10095988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1685Open in IMG/M
(restricted) 3300023109|Ga0233432_10052882All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2548Open in IMG/M
(restricted) 3300023112|Ga0233411_10063153All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1162Open in IMG/M
(restricted) 3300023210|Ga0233412_10022506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2508Open in IMG/M
3300023676|Ga0232114_125900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium575Open in IMG/M
3300024183|Ga0228603_1001065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3190Open in IMG/M
3300024183|Ga0228603_1041987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium686Open in IMG/M
3300024226|Ga0228667_1099679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300024229|Ga0233402_1035730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1067Open in IMG/M
3300024230|Ga0228638_1064020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium958Open in IMG/M
3300024235|Ga0228665_1136177All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium505Open in IMG/M
(restricted) 3300024255|Ga0233438_10024531All Organisms → Viruses → Predicted Viral3555Open in IMG/M
3300024262|Ga0210003_1006942All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1578338Open in IMG/M
3300024266|Ga0228661_1002069All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3357Open in IMG/M
3300024266|Ga0228661_1094819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium559Open in IMG/M
3300024296|Ga0228629_1000021Not Available54639Open in IMG/M
3300024296|Ga0228629_1007615All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2835Open in IMG/M
3300024296|Ga0228629_1144222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium623Open in IMG/M
3300024301|Ga0233451_10178269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium932Open in IMG/M
3300024322|Ga0228656_1057952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium856Open in IMG/M
3300024346|Ga0244775_10642292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium859Open in IMG/M
3300024420|Ga0228632_1040925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1083Open in IMG/M
3300024508|Ga0228663_1021673All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1266Open in IMG/M
(restricted) 3300024519|Ga0255046_10075464All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1385Open in IMG/M
3300025084|Ga0208298_1014525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1848Open in IMG/M
3300025085|Ga0208792_1006962All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2742Open in IMG/M
3300025085|Ga0208792_1019945All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1404Open in IMG/M
3300025120|Ga0209535_1000240All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15737179Open in IMG/M
3300025127|Ga0209348_1008546All Organisms → Viruses4190Open in IMG/M
3300025133|Ga0208299_1002867All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15711279Open in IMG/M
3300025137|Ga0209336_10000103All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15739547Open in IMG/M
3300025151|Ga0209645_1097803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium955Open in IMG/M
3300025570|Ga0208660_1029834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1508Open in IMG/M
3300025626|Ga0209716_1003275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium10073Open in IMG/M
3300025646|Ga0208161_1000258All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU15730313Open in IMG/M
3300025652|Ga0208134_1009555All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4135Open in IMG/M
3300025653|Ga0208428_1002481All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU1577450Open in IMG/M
3300025653|Ga0208428_1028851All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1782Open in IMG/M
3300025687|Ga0208019_1187305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300025694|Ga0209406_1030291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2233Open in IMG/M
3300025696|Ga0209532_1027010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2614Open in IMG/M
3300026479|Ga0228622_1071586All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium751Open in IMG/M
3300027751|Ga0208304_10113017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1015Open in IMG/M
3300027833|Ga0209092_10413072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium704Open in IMG/M
(restricted) 3300027861|Ga0233415_10031008All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2166Open in IMG/M
3300027917|Ga0209536_101790994All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium741Open in IMG/M
3300028110|Ga0247584_1091299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium767Open in IMG/M
3300031519|Ga0307488_10002677Not Available15021Open in IMG/M
3300031569|Ga0307489_10190873All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1264Open in IMG/M
3300032088|Ga0315321_10855148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300032277|Ga0316202_10309107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium736Open in IMG/M
3300034418|Ga0348337_045819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1818Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.04%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater15.04%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.78%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh11.28%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.26%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.26%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.76%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.76%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.76%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.01%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.01%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.01%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.26%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.50%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.50%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.50%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.50%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.75%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.75%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.75%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.75%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.75%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.75%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.75%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.75%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300001348Pelagic Microbial community sample from North Sea - COGITO 998_met_04EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005601Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300013103Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cmEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022927Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaGEnvironmentalOpen in IMG/M
3300023084Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023676Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024183Seawater microbial communities from Monterey Bay, California, United States - 3DEnvironmentalOpen in IMG/M
3300024226Seawater microbial communities from Monterey Bay, California, United States - 81DEnvironmentalOpen in IMG/M
3300024229Seawater microbial communities from Monterey Bay, California, United States - 54DEnvironmentalOpen in IMG/M
3300024230Seawater microbial communities from Monterey Bay, California, United States - 48DEnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024266Seawater microbial communities from Monterey Bay, California, United States - 75DEnvironmentalOpen in IMG/M
3300024296Seawater microbial communities from Monterey Bay, California, United States - 36DEnvironmentalOpen in IMG/M
3300024301Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly)EnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300024508Seawater microbial communities from Monterey Bay, California, United States - 77DEnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300026479Seawater microbial communities from Monterey Bay, California, United States - 26DEnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
NpDRAFT_1016340613300000929Freshwater And MarineIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDLLSEWKQT*
JGI20154J14316_1009549813300001348Pelagic MarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELTDDLGLECGNKFEKQVLTIGTEWGTHYEPNQKEIESKIKELQAEIDLLSEWKQT*
JGI24003J15210_10000064303300001460MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDNRNKYEYIMKFFFELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNKKDVESKIKELQAEIDLLTEWKQA*
JGI24004J15324_1002014323300001472MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDSNRNKYEYIMKFFFELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNKKDVESKIKELQAEIDLLTEWKQA*
JGI26273J51734_1003996723300003620MarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDLLSEWKQT*
Ga0055584_10019912023300004097Pelagic MarineMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVFESNEDSRNKYEYIMRFFFELCEDLGLECGNKFEKDVLKINTEWGTHYEPTQKEIQSKIKELQAEIDLLTEWKQT*
Ga0055584_10033832313300004097Pelagic MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYESNDESRNKYEYIMKFFWELCEDLGLEGGNKFEKEVLRLKTEWGTHYEPNKKELESKIRELQAEIDLLTEWKQT*
Ga0055584_10038075123300004097Pelagic MarineMIKIVLEPARNGVVKRVIDDNHGGGKEQWTSTDVYESNDDHRNKYEYIMRFFWDLCEDIGLECGNKFDKDVLRIKPEWGTHYEPTKKEVESKIKELQAEIDLLTEWKQT*
Ga0070727_1071385023300005590Marine SedimentMIKIVLEPARNGVVKRVIDDNHGGGKEQWTSTDVYESNDDHRNKYEYIMRFFWDLCEDIGLECGNKFDKDVLRIKPEWGTHYEPTQKEVESKIKELQAEIDLLTEWKQT*
Ga0070722_1051025423300005601Marine SedimentMLKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDDHRNKYEYIMRFFWDLCEDIGLECGNKFDKDVLRIKPEWGTHYEPTQKEVESKIKELQAEIDLLTEWKQT*
Ga0075474_1003432623300006025AqueousMVKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYEESDSDSNRYEYIMKFFFELCEDLGLECGNKFDKNVLQFDTVWGTHYEPNKKEVESKIRELQAEIDLLKEWKQG*
Ga0075514_156104913300006403AqueousMVKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYEESDSDSNRYEYIMKFFFELCEDLGLECGNKFDKNVLQFDTVWGTHYEPNKKEVESKIRELQAEIDLLKEWKQA*
Ga0098054_105061933300006789MarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELTDDLGLECGNKFEKQVLKIDTEWGTHYEPNQKEIESKIKELQAEIDLLSEWKQT*
Ga0098074_103229043300006790MarineMVKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKYEYIMRFFWELCEDLGLECGNKFEKEVLRIKTEWGTHYEPNQKEIDSKIKELQAEIDLLTEWKQA*
Ga0098055_102605243300006793MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNEDSRNKYEYLMKFFFELCEDLGLECGNKFEKEVLRIKTEWGTHYEPNKKEVESKIKELQAEIDLLTEWKQV*
Ga0070749_1011115743300006802AqueousLKPCIIERMIKIVLEPARNGVIKRIIDDNHGGGKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS*
Ga0070754_1006921343300006810AqueousERMIKIVLEPARNGVIKRIIDDNHGGGKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS*
Ga0075481_1003399923300006868AqueousMIKIVLEPARNGVIKRIIDDNHGGSKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS*
Ga0075477_1004900943300006869AqueousMIKIVLEPARNGVIKRIIDDNHGGGKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS*
Ga0075479_1036225913300006870AqueousNGVIKRIIDDNHGGSKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS*
Ga0070746_1016121823300006919AqueousMIKIVLEPARNGVIKRIIDDNHGGRKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS*
Ga0075469_1003785933300007231AqueousMLKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDDHRNKYEYIMRFFWELCEDVGLDCGNKFDKEVLRIKPEWGTHYEPNQKEVDSKIRELQAEIDLLNEWKQK*
Ga0070753_101566843300007346AqueousMIKIVLEPARNGVIKRIIDDNHGGGKERWSSTDIYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS*
Ga0099849_106995213300007539AqueousNHGGGKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTAWGTHYEPSPKEINSKIKELEAEIQLLKEWKNS*
Ga0099849_116630913300007539AqueousIDDNHGGGKEQWTSTDVYEESNSDSNKYEYIMKFFFELCEDLGLECGNKFDKNVLQFDTVWGTHYEPNKKEVESKIKELQAEIDLLKEWKQG*
Ga0099848_100026443300007541AqueousMIKIVLEPARNGVIKRTVDDNHGGGNERWTTTDVYESNEDTPDDYRYVMRFFYELCEDLGLSLGNKFDKKVIRINTEWGTHYEPSPKEIESKIKELEAEIQLLKEWKNS*
Ga0102822_106085533300007558EstuarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDLLS
Ga0098052_1003157103300008050MarineMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVFESNDEQRNKYEYIMRFFFELCDDIGLECGNKFEKEVLRLKTEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQG*
Ga0102887_103553743300008961EstuarineMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDDHRNKYEYIMRFFWELCEDVGLECGNKFDKEVLRIKPEWGTHYEPNQKEVDSKIRELQAEIDLLNEWKQK*
Ga0102957_114436323300009027Pond WaterMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVFESNEDSRNKYEYIMRFFFELCEDLGLECGNKFEKDVLKIDTEWGTHYEPTQKEIQSKIKELQAEIDLLTEWKQT*
Ga0114918_1000018083300009149Deep SubsurfaceMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNDEHRNKYEYIMRFFYELCDDLSLHRGNKFEKEVIKTTTEWGSHYEPNQKEIESKIKELQAEIDLLTEWKK*
Ga0115545_124014523300009433Pelagic MarineLMIKIVLEPARNGVIKRVIEDNHGGGREQWTSTDVFESNEDSRNKYEYIMRFFFELCEDLGLECGNKFEKDVLKINTEWGTHYEPTQKEIQSKIKELQAEIDLLTEWKQT*
Ga0115008_1059170223300009436MarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLGLECGNKFEKQVLTIGTEWGTHYEPNQKEIESKIKELQAEIDLLSEWKQT*
Ga0115568_10000675193300009498Pelagic MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYESNDESRNKYEYIMKFFWELCEDLGLECGNKFEKEVLRLKTEWGTHYEPNKKELESKIRELQAEIDLLTEWKQT*
Ga0115103_147757123300009599MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFEKDVLKIGKEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQT*
Ga0115103_149190523300009599MarineMVKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDEHRNKYEYIMRFFWELCEDIGLECGNKFEKDCLRIKTEWGTHYEPNQKEVDSKIRELQAEI
Ga0115102_1089348933300009606MarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDLFSEWKQT*
Ga0098056_108185533300010150MarineVIKRVIDDNHGGGKEQWTSTDVFESNEDSRNKYEYLMKFFFELCEDLGLECGNKFEKEVLRIKTEWGTHYEPNKKEVESKIKELQAEIDLLTEWKQV*
Ga0129345_124810523300010297Freshwater To Marine Saline GradientMIKIVLEPARNGVIKRIIDDNHGGSKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKI
Ga0160423_1024107343300012920Surface SeawaterMVKIILEPARNGVIKKVINDNHGGGKEQWTSTDVFEATDDSPNKYEYIMRFFFDLCDDLGLEVGNKFDQKVIKMNVEWGSHYEPTAKDVENKIKELQAEIDLLKEWKKP*
Ga0163110_1014691333300012928Surface SeawaterMVKIILEPARNGVIKKVINDNHGGGKEQWTSTDVFEATDDSPNKYEYIMRFFFDLCDDLGLEVGNKFDQKVVKMNVEWGSHYEPTAKDVENKIKELQAEIDLLKEWKKP*
Ga0163109_1018751133300012936Surface SeawaterMVKIVLEPARNGVIKKVINDNHGGGKEQWTSTDVFEANDDSHNKYEYIMRFFFELCDDLGLEVGNKFDQKVIKMNTEWGTHYEPTPKDIENKIKELQAEIDLLKEWKKP*
Ga0129327_1003344743300013010Freshwater To Marine Saline GradientMLKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDDHRNKYEYIMRFFWELCEDVGLDCGNKFDKEVLRIKPEWGTHYEPNQKEVDSKIRELQAEIDLLN
Ga0164318_1046435123300013103Marine SedimentMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEEHRNKFEYIMRFFYELTDDLGLDCGNKFEKQVLKIGTEWGTHYEPNKKEIESKIKELQAEIDLLSEWKQT*
Ga0181387_110361613300017709SeawaterIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEEHRNKFEYIMRFFYELTDDLGLDCGNKFEKQVLKIGTEWGTHYEPNKKEIESKIKELQAEIDLLSEWKQT
Ga0181398_103735623300017725SeawaterMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDEHRNKYEYIMRFFWELCEDIGLECGNKFEKDCLRIKTEWGTHYEPNQKEVDSKIRELQAEIDLLKEWKQK
Ga0181400_110730013300017752SeawaterMIKIVLEPARNGVVKRVIDDNHGGGKEQWTSTDVYESNDEHRNKYEYIMRFFWDLCEDIGLECGNKFDKDVLRIKPEWGTHYEPTKKEVESKIKELQAEIDLLTEWKQV
Ga0181386_113476433300017773SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDNRNKYEYIMKFFFELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNKKDVESK
Ga0181394_108777733300017776SeawaterDLMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVFESNEDSRNKYEYIMRFFFELCEDLGLECGNKFEKDVLKINTEWGTHYEPTQKEIQSKIKELQAEIDLLTEWKQT
Ga0181380_111923713300017782SeawaterPARNGVIKRVIDDNHGGGREQWTSTDVFESNEDSRNKYEYIMRFFFELCEDLGLECGNKFEKDVLKINTEWGTHYEPTQKEIQSKIKELQAEIDLLTEWKQT
Ga0181565_1073681923300017818Salt MarshVIKRIIDDNHGGSKERWSSTDVYESSDDDTSDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSAKEIDSKIKELEAEIQLLKEWKNS
Ga0181552_1015941033300017824Salt MarshMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDEHKNKFEYIMRFFWELSEDLGLDCGNKFEKQVLRMKTEWGTHYEPNQKEIESKIKELQAEIDLLTEWKQL
Ga0181607_1000087863300017950Salt MarshMVKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYEESDSDSNRYEYIMKFFFELCEDLGLECGNKFDKNVLQFDTVWGTHYEPNKKEVESKIRELQAEIDLLKEWKQG
Ga0181607_1004422343300017950Salt MarshMVKIILEPARNGVIKRVVDDNHGGGKEQWTSVDVFEFNDDHKNKYEYIMRFFWELSEDLGLDCGNKFDKNVLKLKTEWGSHYEPNQKEIESKIKELQAEIDLLTEWKQV
Ga0181577_1008479223300017951Salt MarshMIKIVLEPARNGVIKRIIDDNHGGGKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTAWGTHYEPSAKEIDSKIKELEAEIQLLKEWKNS
Ga0181583_1041360423300017952Salt MarshMIKIVLEPARNGVIKRIIDDNHGGGKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTAWGTHYEPSPKEINSKIKELEAEIQLLKEWKNS
Ga0181571_1019532123300017957Salt MarshMIKIVLEPARNGVIKRIIDDNHGGSKERWSSTDVYESSDDDTSDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSAKEIDSKIKELEAEIQLLKEWKNS
Ga0181587_1005562123300017968Salt MarshMIKIVLEPARNGVIKRIIDDNHGGSKERWSSTDVYESSDDDTSDYHYVMKFFYELCEVLGINLGNKFNKKVVKIDTTWGTHYEPSAKEIDSKIKELEAEIQLLKEWKNS
Ga0181592_1018320743300018421Salt MarshMIKIVLEPARNGVIKRIIDDNHGGGKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS
Ga0181568_1099342913300018428Salt MarshKPCIIEKMIKIVLEPARNGVIKRIIDDNHGGSKERWSSTDVYESSDDDTSDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSAKEIDSKIKELEAEIQLLKEWKNS
Ga0180037_110124513300019214EstuarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDL
Ga0181562_1048019623300019459Salt MarshDNHGGGKEQWTSTDVFESNDEHKNKFEYIMRFFWELSEDLGLDCGNKFEKQVLRMKTEWGTHYEPNQKEIESKIKELQAEIDLLTEWKQL
Ga0206125_1001486743300020165SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYESNDESRNKYEYIMKFFWELCEDLGLEGGNKFEKEVLRLKTEWGTHYEPNKKELESKIRELQAEIDLLTEWKQT
Ga0181578_1022817333300020189Salt MarshMIKIVLEPARNGVIKRIIDDNHGGGKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTAWGTHYEPSPKEINSKIKEL
Ga0211666_1036407523300020392MarineVIKKVINDNHGGGKEQWTSTDVFEATDDTPNKYEYIMRFFFDLCDDLGMEVGNKFDQKVVKMNVEWGSHYEPTAKDVENKIKELQAEIDLLKEWKKP
Ga0211559_1001128143300020442MarineMVKIVLEPARNGVIKKVINDNHGGGKEQWTSTDVFEANDDSHNKYEYIMRFFFELCDDLGLEVGNKFDQKVIKMNTEWGTHYEPTPKDIENKIKELQAEIDLLKEWKKP
Ga0211641_1005896043300020450MarineMSHTIKERMVKIILEPARNGVIKKVINDNHGGGKEQWTSTDVFEATDDSPNKYEYIMRFFFDLCDDLGIEVGNKFDQKVVKMNVEWGSHYEPTAKDVENKIKELQAEIDLLKEWKKP
Ga0211676_1000341733300020463MarineMVKIVLEPARNGLIKKVINDNHGGSKEQWTSTDVFEATDDSPNKYEYIMRFFFDLCDDLGLEVGNKFDQKVVKMNVEWGSHYEPTAKDVENKIKELQAEIDLLKEWKKP
Ga0206677_10001004143300021085SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFEKDVLKIGKEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQT
Ga0206677_1031049223300021085SeawaterMVKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDEHRNKYEYIMRFFWELCEDIGLECGNKFEKDCLRIKTEWGTHYEPNQKEVDSKIRELQAEIDLLKEWKQK
Ga0206679_1050997913300021089SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFEKDVLKIGKEWGTHYEPNKKEIESKIKELQAEI
Ga0206682_1041562823300021185SeawaterMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDLLSEWKQT
Ga0213858_1008180143300021356SeawaterMIKIVLEPARNGVIKRIIDDNHGGGKERWSSTDIYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS
Ga0213859_1000299973300021364SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKYEYIMRFFWELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNQKEIESKIKELQAEIDLLTEWKQA
Ga0213868_10002413163300021389SeawaterMIKIVLEPARNGVIKKVIGDNHGGGKEQWTSVDVFESTDDQRNKYEYIMRFFWELCEDLGLECGNKFEKDVLRIKKEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQA
Ga0222717_1011025223300021957Estuarine WaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYESNDESRNKYEYIMKFFWELCEDLGLEGGNKFEKDVLRLKTEWGTHYEPNKKELESKIRELQAEIDLLTEWKQT
Ga0222718_1000030343300021958Estuarine WaterMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVFESNEDSRNKYEYIMRFFFELCEDLGLECGNKFEKDVLKINTEWGTHYEPTQKEIQSKIKELQAEIDLLTEWKQT
Ga0222718_1011621043300021958Estuarine WaterMVKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYEESDSDSNRYEYIMKFFFELCEDLGLECGNKFDKNVLQFNTVWGTHYDPNKKEVESKIRELQAEIDLLKEWKQG
Ga0222716_1019698233300021959Estuarine WaterMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDDHRNKYEYIMRFFWELCEDVGLECGNKFDKEVLRIKPEWGTHYEPNQKEVDSKIRELQAEIDLLNEWKQK
Ga0224513_1012050033300022220SedimentIIDLMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYESNDESRNKYEYIMKFFWELCEDLGLEGGNKFEKDVLRLKTEWGTHYEPNKKELESKIRELQAEIDLLTEWKQT
Ga0255769_1012000313300022927Salt MarshMVKIILEPARNGVIKRVVDDNHGGGKEQWTSVDVFEFNDDHKNKYEYIMRFFWELSEDLGLDCGNKFDKNVLKLKTEWGSHYEPNQKEIESKIKELQAEIDLL
Ga0255778_1009598843300023084Salt MarshRNGVIKRIIDDNHGGSKERWSSTDVYESSDDDTSDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSAKEIDSKIKELEAEIQLLKEWKNS
(restricted) Ga0233432_1005288213300023109SeawaterDLMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFEYSDDNRNKYQYIMKFFFELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNEKDVESKIKELQAEIDLLTEWKQA
(restricted) Ga0233411_1006315333300023112SeawaterMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDLLTEWKQA
(restricted) Ga0233412_1002250613300023210SeawaterIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDLLSEWKQT
Ga0232114_12590023300023676SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFEKDVLKIGKEWGTHYEPNKKE
Ga0228603_100106553300024183SeawaterVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFEKDVLKIGKEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQT
Ga0228603_104198723300024183SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNEDHRNKYEYIMRFFWELCDDLGLECGNKFEKDVLRIKTEWGTHYEPNTKEIESKIKELQAEIDLLTEWKQT
Ga0228667_109967923300024226SeawaterMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDLLSELKQT
Ga0233402_103573033300024229SeawaterMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEEHRNKFEYIMRFFYELTDDLGLDCGNKFEKQVLKIGTEWGTHYEPNKKEIESKIKELQAEIDLLSEWKQT
Ga0228638_106402033300024230SeawaterVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNEDHRNKYEYIMRFFWELCDDLGLECGNKFEKDVLRIKTEWGTHYEPNTKEIESKIKELQAEIDLLTEWKQT
Ga0228665_113617713300024235SeawaterKDLMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDNRNKYEYIMKFFFELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNKKDVESKIKELQAEIDLLTEWKQT
(restricted) Ga0233438_1002453143300024255SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFEYSDDNRNKYQYIMKFFFELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNEKDVESKIKELQAEIDLLTEWKQA
Ga0210003_100694243300024262Deep SubsurfaceMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNDEHRNKYEYIMRFFYELCDDLSLHRGNKFEKEVIKTTTEWGSHYEPNQKEIESKIKELQAEIDLLTEWKK
Ga0228661_100206943300024266SeawaterMIKTVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFEKDVLKIGKEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQT
Ga0228661_109481913300024266SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDNRNKYEYIMKFFFELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNKKDVESKIKELQAEIDLLTEWKQT
Ga0228629_1000021213300024296SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNEDHRNKYEYIMRFFWELCDDLGLECGNKFEKDVLRIKTEWGTHYEPNTKEIESK
Ga0228629_100761523300024296SeawaterMVKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDEHRNKYEYIMRFFWELCEDIGLECGNKFEKDCLRIKTELGTHYEPNQKEVDSKIRELQAEIDLLKEWKQK
Ga0228629_114422223300024296SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNEDSRNKYEYLMKFFFELCEDLGLECGNKFEKEVLRIKTEWGTHYEPNKKEVESKIKELQAEIDLLTEWKQV
Ga0233451_1017826913300024301Salt MarshNHGGGKEQWTSTDVFESNDEHKNKFEYIMRFFWELSEDLGLDCGNKFEKQVLRMKTEWGTHYEPNQKEIESKIKELQAEIDLLTEWKQL
Ga0228656_105795213300024322SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNEDHRNKYEYIMRFFWELCDDLGLECGNKFEKDVLRIKTEWGTHYEPNTKEIESKIKELQ
Ga0244775_1064229233300024346EstuarineVLEPARNGVVKRVIDDNHGGGKEQWTSTDVYESNDEHRNKYEYIMRFFWDLCEDIGLECGNKFDKDVLRIKPEWGTHYEPTKKEVESKIKELQAEIDLLTEWKQT
Ga0228632_104092513300024420SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFEKDVLKIGKEWGTHYEPNKKEIESKIK
Ga0228663_102167333300024508SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFEKDVLKIGKEWGTHYEPNKKEIESKIKELQAEIDLLTE
(restricted) Ga0255046_1007546443300024519SeawaterMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIK
Ga0208298_101452523300025084MarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELTDDLGLECGNKFEKQVLKIDTEWGTHYEPNQKEIESKIKELQAEIDLLSEWKQT
Ga0208792_100696243300025085MarineIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELTDDLGLECGNKFEKQVLKIDTEWGTHYEPNQKEIESKIKELQAEIDLLSEWKQT
Ga0208792_101994513300025085MarineVIKRVIDDNHGGGREQWTSTDVFESNEDSRNKYEYIMRFFFELCEDLGLECGNKFEKDVLKINTEWGTHYEPTQKEIQSKIKELQAEIDLLTEWKQT
Ga0209535_1000240253300025120MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDSNRNKYEYIMKFFFELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNKKDVESKIKELQAEIDLLTEWKQA
Ga0209348_100854633300025127MarineMVKIVLEPARNGVIKKVINDNHGGGKDQWTSTDVFEATEDSRNKYEYIMRFFFELCDDLGLEVGNKFDKSTVRMETSWGSHYEPTAQDVENRIKELQAEIDLLKEWKKP
Ga0208299_100286783300025133MarineMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVFESNDEQRNKYEYIMRFFFELCDDIGLECGNKFEKEVLRLKTEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQG
Ga0209336_10000103173300025137MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDNRNKYEYIMKFFFELCEDLGLECGNKFEKDVLRIKTEWGTHYEPNKKDVESKIKELQAEIDLLTEWKQA
Ga0209645_109780313300025151MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNEDHRNKYEYIMRFFFDLCDDLGLEVGNKFDQKVVKMNVEWGSHYEPTAKDVENKIK
Ga0208660_102983433300025570AqueousMLKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVYESNDDHRNKYEYIMRFFWELCEDVGLDCGNKFDKEVLRIKPEWGTHYEPNQKEVDSKIRELQAEIDLLNEWKQK
Ga0209716_100327563300025626Pelagic MarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELTDDLGLECGNKFEKQVLTIGTEWGTHYEPNQKEIESKIKELQAEIDLLSEWKQT
Ga0208161_1000258223300025646AqueousMIKIVLEPARNGVIKRTVDDNHGGGNERWTTTDVYESNEDTPDDYRYVMRFFYELCEDLGLSLGNKFDKKVIRINTEWGTHYEPSPKEIESKIKELEAEIQLLKEWKNS
Ga0208134_100955553300025652AqueousMIKIVLEPARNGVVKRVIDDNHGGGKEQWTSTDVYESNDDHRNKYEYIMRFFWDLCEDIGLECGNKFDKDVLRIKPEWGTHYEPTQKEVESKIKELQAEIDLLTEWKQT
Ga0208428_100248143300025653AqueousMVKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYEESDSDSNRYEYIMKFFFELCEDLGLECGNKFDKNVLQFDTVWGTHYEPNKKEVESKIRELQAEIDLLKEWKQA
Ga0208428_102885133300025653AqueousMIKIVLEPARNGVIKRIIDDNHGGSKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS
Ga0208019_118730523300025687AqueousPHKVKNKTKRRPMVKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYEESDSDSNRYEYIMKFFFELCEDLGLECGNKFDKNVLQFDTVWGTHYEPNKKEVESKIRELQAEIDLLKEWKQ
Ga0209406_103029123300025694Pelagic MarineMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVYESNDESRNKYEYIMKFFWELCEDLGLECGNKFEKEVLRLKTEWGTHYEPNKKELESKIRELQAEIDLLTEWKQT
Ga0209532_102701023300025696Pelagic MarineMIKIVLEPARNGVVKRVIDDNHGGGKEQWTSTDVYESNDDHRNKYEYIMRFFWDLCEDIGLECGNKFDKDVLRIKPEWGTHYEPTKKEVESKIKELQAEIDLLTEWKQT
Ga0228622_107158613300026479SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNEDHRNKYEYIMRFFWELCDDLGLECGNKFEKDVLRIKTEWGTHYEPNTKEIESKIKELQAEI
Ga0208304_1011301733300027751EstuarineNDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLSLECGNKFEKQVLTIGTEWGTHYEPNQKEVESKIKELQAEIDLLSEWKQT
Ga0209092_1041307223300027833MarineMIKIVLEPARNGVIKRVINDNHGGGKEQWTSTDVFESNEDHRNKFEYIMRFFYELADDLGLECGNKFEKQVLTIGTEWGTHYEPNQKEIESKIKELQAEIDLLSEWKQT
(restricted) Ga0233415_1003100843300027861SeawaterMIKIVLEPARNGVIKRVIDDNHGGGREQWTSTDVFESNDEQRNKYEYIMRFFFELCDDIGLECGNKFEKEVLRLKTEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQA
Ga0209536_10179099433300027917Marine SedimentLKPCIIEKMIKIVLEPARNGVIKRIIDDNHGGSKERWSSTDVYESSDDDTSDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSAKEIDSKIKELEAEIQLLKEWKNS
Ga0247584_109129923300028110SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFKKDVLKIGKEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQT
Ga0307488_10002677273300031519Sackhole BrineMIKIVLEPARNGVIKKVIDDNHGGGREQWTSTDVFESNDEHRNKYEYIMRFFFELCEDIGLDCGNKFEKEVLKINTEWGTHYEPNKKEIESKIKELQAEIDILTEWKQT
Ga0307489_1019087333300031569Sackhole BrineRVINDNHGGGKEQWTSIDVFESTEDQRNKYEYIMRFFYELCDDLGLNCGNKFEKEVLKTRVEWGTHYEPNKKEIESKIKELQAEIDLLTEWKQA
Ga0315321_1085514813300032088SeawaterMIKIVLEPARNGVIKRVIDDNHGGGKEQWTSTDVFESNDDHRNKFEYIMKFFWELCEDLGLECGNKFEKDVLKIGKEWGTHYEPNKKEIESK
Ga0316202_1030910713300032277Microbial MatMIKIVLEPARNGVVKRVIDDNHGGGKEQWTSTDVYESNDDHRNKYEYIMRFFWDLCEDIGLECGNKFDKDVLRIKPEWGTHYEPTQKEVE
Ga0348337_045819_1536_18173300034418AqueousIIDDNHGGGKERWSSTDVYESSDDDTPDYHYVMKFFYELCEDLGINLGNKFNKKVVKIDTTWGTHYEPSPKEIDSKIKELEAEIQLLKEWKNS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.