Basic Information | |
---|---|
Family ID | F059983 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 133 |
Average Sequence Length | 40 residues |
Representative Sequence | TQNARLYLTETTRLFTQLWASLQSGEADGGVVRHMR |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.76 % |
% of genes near scaffold ends (potentially truncated) | 96.24 % |
% of genes from short scaffolds (< 2000 bps) | 59.40 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (71.429 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (26.316 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.639 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.489 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.94% β-sheet: 0.00% Coil/Unstructured: 64.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF01645 | Glu_synthase | 9.02 |
PF09360 | zf-CDGSH | 5.26 |
PF08975 | 2H-phosphodiest | 4.51 |
PF13610 | DDE_Tnp_IS240 | 3.76 |
PF03466 | LysR_substrate | 3.76 |
PF02826 | 2-Hacid_dh_C | 3.01 |
PF16925 | TetR_C_13 | 3.01 |
PF11746 | DUF3303 | 2.26 |
PF00589 | Phage_integrase | 2.26 |
PF02515 | CoA_transf_3 | 2.26 |
PF13419 | HAD_2 | 2.26 |
PF00005 | ABC_tran | 1.50 |
PF13343 | SBP_bac_6 | 1.50 |
PF00171 | Aldedh | 1.50 |
PF04303 | PrpF | 1.50 |
PF07045 | DUF1330 | 1.50 |
PF08521 | 2CSK_N | 1.50 |
PF03480 | DctP | 1.50 |
PF00440 | TetR_N | 1.50 |
PF14311 | DUF4379 | 0.75 |
PF12849 | PBP_like_2 | 0.75 |
PF13640 | 2OG-FeII_Oxy_3 | 0.75 |
PF07943 | PBP5_C | 0.75 |
PF13738 | Pyr_redox_3 | 0.75 |
PF04519 | Bactofilin | 0.75 |
PF02738 | MoCoBD_1 | 0.75 |
PF07883 | Cupin_2 | 0.75 |
PF08240 | ADH_N | 0.75 |
PF14026 | DUF4242 | 0.75 |
PF11074 | DUF2779 | 0.75 |
PF01047 | MarR | 0.75 |
PF13202 | EF-hand_5 | 0.75 |
PF13378 | MR_MLE_C | 0.75 |
PF13193 | AMP-binding_C | 0.75 |
PF07693 | KAP_NTPase | 0.75 |
PF00126 | HTH_1 | 0.75 |
PF13411 | MerR_1 | 0.75 |
PF01263 | Aldose_epim | 0.75 |
PF05610 | DUF779 | 0.75 |
PF07729 | FCD | 0.75 |
PF16912 | Glu_dehyd_C | 0.75 |
PF01144 | CoA_trans | 0.75 |
PF13564 | DoxX_2 | 0.75 |
PF13561 | adh_short_C2 | 0.75 |
PF00092 | VWA | 0.75 |
PF12680 | SnoaL_2 | 0.75 |
PF00491 | Arginase | 0.75 |
PF04542 | Sigma70_r2 | 0.75 |
PF13460 | NAD_binding_10 | 0.75 |
PF12833 | HTH_18 | 0.75 |
PF03601 | Cons_hypoth698 | 0.75 |
PF00486 | Trans_reg_C | 0.75 |
PF13302 | Acetyltransf_3 | 0.75 |
PF05199 | GMC_oxred_C | 0.75 |
PF00848 | Ring_hydroxyl_A | 0.75 |
PF04290 | DctQ | 0.75 |
PF00378 | ECH_1 | 0.75 |
PF16113 | ECH_2 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 9.02 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 9.02 |
COG5255 | Uncharacterized conserved protein | Function unknown [S] | 4.51 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 2.26 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.50 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.50 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.50 |
COG2828 | 2-Methylaconitate cis-trans-isomerase PrpF (2-methyl citrate pathway) | Energy production and conversion [C] | 1.50 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.50 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.50 |
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.50 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.75 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.75 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.75 |
COG4928 | Predicted P-loop ATPase, KAP-like | General function prediction only [R] | 0.75 |
COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.75 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.75 |
COG3564 | Uncharacterized conserved protein, DUF779 family | Function unknown [S] | 0.75 |
COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.75 |
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.75 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.75 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.75 |
COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.75 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.75 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.75 |
COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.75 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.75 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.43 % |
Unclassified | root | N/A | 28.57 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10115820 | Not Available | 1069 | Open in IMG/M |
3300000101|DelMOSum2010_c10187107 | Not Available | 710 | Open in IMG/M |
3300000116|DelMOSpr2010_c10000375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 29225 | Open in IMG/M |
3300001344|JGI20152J14361_10059085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
3300001344|JGI20152J14361_10110402 | Not Available | 534 | Open in IMG/M |
3300001347|JGI20156J14371_10019182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium | 3772 | Open in IMG/M |
3300001348|JGI20154J14316_10161965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
3300001349|JGI20160J14292_10054746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 1760 | Open in IMG/M |
3300001351|JGI20153J14318_10003713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HTCC2150 | 10091 | Open in IMG/M |
3300001351|JGI20153J14318_10007056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HTCC2150 | 6678 | Open in IMG/M |
3300001351|JGI20153J14318_10039971 | Not Available | 1869 | Open in IMG/M |
3300001352|JGI20157J14317_10050181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1930 | Open in IMG/M |
3300002186|JGI24539J26755_10063874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1096 | Open in IMG/M |
3300003247|JGI26116J46587_1000968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 3821 | Open in IMG/M |
3300003265|JGI26118J46590_1001993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 3361 | Open in IMG/M |
3300003271|JGI26114J46594_1070005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor pacificus | 512 | Open in IMG/M |
3300003428|JGI26111J50215_1003071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 2809 | Open in IMG/M |
3300004279|Ga0066605_10029720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2623 | Open in IMG/M |
3300006419|Ga0075496_1431175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp. | 1355 | Open in IMG/M |
3300007557|Ga0102821_1206089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseicitreum → Roseicitreum antarcticum | 502 | Open in IMG/M |
3300007647|Ga0102855_1004942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 3732 | Open in IMG/M |
3300007667|Ga0102910_1005714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 2826 | Open in IMG/M |
3300007667|Ga0102910_1027583 | Not Available | 1285 | Open in IMG/M |
3300007670|Ga0102862_1015395 | Not Available | 1728 | Open in IMG/M |
3300007718|Ga0102852_1000813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter | 5300 | Open in IMG/M |
3300007862|Ga0105737_1096028 | Not Available | 746 | Open in IMG/M |
3300007863|Ga0105744_1121667 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300007981|Ga0102904_1115047 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300008961|Ga0102887_1125869 | Not Available | 801 | Open in IMG/M |
3300008995|Ga0102888_1103238 | Not Available | 581 | Open in IMG/M |
3300009003|Ga0102813_1016413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 2818 | Open in IMG/M |
3300009003|Ga0102813_1204685 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300009049|Ga0102911_1178187 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300009074|Ga0115549_1085108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1073 | Open in IMG/M |
3300009074|Ga0115549_1190982 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300009076|Ga0115550_1088846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1163 | Open in IMG/M |
3300009142|Ga0102885_1071597 | Not Available | 830 | Open in IMG/M |
3300009423|Ga0115548_1084493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1057 | Open in IMG/M |
3300009434|Ga0115562_1006741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 7026 | Open in IMG/M |
3300009434|Ga0115562_1123700 | Not Available | 993 | Open in IMG/M |
3300009435|Ga0115546_1039958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1854 | Open in IMG/M |
3300009438|Ga0115559_1042647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 2007 | Open in IMG/M |
3300009442|Ga0115563_1222296 | Not Available | 715 | Open in IMG/M |
3300009495|Ga0115571_1125245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oleiphilaceae → Oleiphilus | 1093 | Open in IMG/M |
3300009495|Ga0115571_1352224 | Not Available | 581 | Open in IMG/M |
3300009495|Ga0115571_1393355 | Not Available | 541 | Open in IMG/M |
3300009505|Ga0115564_10009919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium luteolum | 7001 | Open in IMG/M |
3300009505|Ga0115564_10020141 | All Organisms → cellular organisms → Bacteria | 4491 | Open in IMG/M |
3300009507|Ga0115572_10005730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. TrichCH4B | 9475 | Open in IMG/M |
3300009507|Ga0115572_10007793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7983 | Open in IMG/M |
3300009508|Ga0115567_10174132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium | 1411 | Open in IMG/M |
3300020169|Ga0206127_1142107 | Not Available | 940 | Open in IMG/M |
3300020175|Ga0206124_10018181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → unclassified Oceanospirillaceae → Oceanospirillaceae bacterium | 3578 | Open in IMG/M |
3300020182|Ga0206129_10029824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 3907 | Open in IMG/M |
3300020185|Ga0206131_10060350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2446 | Open in IMG/M |
3300020185|Ga0206131_10163217 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300020185|Ga0206131_10294340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oleiphilaceae → Oleiphilus | 729 | Open in IMG/M |
3300020187|Ga0206130_10091776 | Not Available | 1833 | Open in IMG/M |
3300020352|Ga0211505_1116613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300021085|Ga0206677_10014217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 5188 | Open in IMG/M |
3300021365|Ga0206123_10096522 | Not Available | 1418 | Open in IMG/M |
3300021371|Ga0213863_10214877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
3300021378|Ga0213861_10233150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 982 | Open in IMG/M |
3300021389|Ga0213868_10223187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oleiphilaceae → Oleiphilus | 1116 | Open in IMG/M |
3300021389|Ga0213868_10461644 | Not Available | 690 | Open in IMG/M |
3300021957|Ga0222717_10000905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 24814 | Open in IMG/M |
3300021957|Ga0222717_10421862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Niveispirillum → Niveispirillum irakense | 733 | Open in IMG/M |
3300021959|Ga0222716_10428360 | Not Available | 761 | Open in IMG/M |
(restricted) 3300022920|Ga0233426_10048226 | Not Available | 2052 | Open in IMG/M |
3300023704|Ga0228684_1064905 | Not Available | 569 | Open in IMG/M |
3300024180|Ga0228668_1062272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 716 | Open in IMG/M |
3300024192|Ga0228637_1006101 | Not Available | 2597 | Open in IMG/M |
3300024221|Ga0228666_1011249 | Not Available | 2419 | Open in IMG/M |
3300024231|Ga0233399_1002989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5951 | Open in IMG/M |
3300024237|Ga0228653_1028630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
3300024247|Ga0228675_1000851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 11163 | Open in IMG/M |
3300024248|Ga0228676_1011544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2035 | Open in IMG/M |
3300024250|Ga0228677_1000071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 17628 | Open in IMG/M |
3300024250|Ga0228677_1006046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2063 | Open in IMG/M |
(restricted) 3300024255|Ga0233438_10061833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1844 | Open in IMG/M |
3300024292|Ga0228630_1000909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 12240 | Open in IMG/M |
3300024297|Ga0228658_1000217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 19434 | Open in IMG/M |
3300024314|Ga0228657_1083658 | Not Available | 650 | Open in IMG/M |
3300024315|Ga0228618_1011861 | Not Available | 1109 | Open in IMG/M |
3300024315|Ga0228618_1086761 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300024319|Ga0228670_1037821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oleiphilaceae → Oleiphilus | 1142 | Open in IMG/M |
3300024320|Ga0233398_1142769 | Not Available | 533 | Open in IMG/M |
3300024326|Ga0228652_1000221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 35183 | Open in IMG/M |
3300024332|Ga0228659_1000401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 10919 | Open in IMG/M |
3300024332|Ga0228659_1003581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3813 | Open in IMG/M |
3300024343|Ga0244777_10046679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 2769 | Open in IMG/M |
3300024359|Ga0228628_1015771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1921 | Open in IMG/M |
3300025456|Ga0209776_1042910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oleiphilaceae → Oleiphilus | 921 | Open in IMG/M |
3300025483|Ga0209557_1043426 | Not Available | 1191 | Open in IMG/M |
3300025483|Ga0209557_1050659 | Not Available | 1051 | Open in IMG/M |
3300025483|Ga0209557_1119001 | Not Available | 517 | Open in IMG/M |
3300025577|Ga0209304_1138696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Roseicitreum → Roseicitreum antarcticum | 513 | Open in IMG/M |
3300025590|Ga0209195_1038744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
3300025640|Ga0209198_1093477 | Not Available | 954 | Open in IMG/M |
3300025696|Ga0209532_1034787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 2193 | Open in IMG/M |
3300025701|Ga0209771_1005873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 6350 | Open in IMG/M |
3300025704|Ga0209602_1128429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium | 846 | Open in IMG/M |
3300025704|Ga0209602_1232962 | Not Available | 523 | Open in IMG/M |
3300025705|Ga0209374_1021990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2836 | Open in IMG/M |
3300025876|Ga0209223_10039926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter → unclassified Sulfitobacter → Sulfitobacter sp. | 2964 | Open in IMG/M |
3300025880|Ga0209534_10081464 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
3300025880|Ga0209534_10116675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1481 | Open in IMG/M |
3300025886|Ga0209632_10018990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Shimia → Shimia thalassica | 5042 | Open in IMG/M |
3300025886|Ga0209632_10043495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 2939 | Open in IMG/M |
3300026447|Ga0247607_1038045 | Not Available | 831 | Open in IMG/M |
3300026479|Ga0228622_1008062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 3500 | Open in IMG/M |
3300026511|Ga0233395_1001524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 11169 | Open in IMG/M |
3300026511|Ga0233395_1041593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1404 | Open in IMG/M |
3300026517|Ga0228607_1095803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
3300027077|Ga0208941_1002690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 2892 | Open in IMG/M |
3300027170|Ga0208963_1008501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1981 | Open in IMG/M |
3300027183|Ga0208798_1024265 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300027192|Ga0208673_1015657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oleiphilaceae → Oleiphilus | 1321 | Open in IMG/M |
3300027367|Ga0208801_1011095 | Not Available | 1541 | Open in IMG/M |
3300027406|Ga0208965_1036921 | Not Available | 1151 | Open in IMG/M |
3300027413|Ga0208950_1023451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 1759 | Open in IMG/M |
3300027506|Ga0208973_1008787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 3470 | Open in IMG/M |
3300027582|Ga0208971_1002137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 10881 | Open in IMG/M |
3300028008|Ga0228674_1110052 | Not Available | 952 | Open in IMG/M |
3300028127|Ga0233401_1015946 | Not Available | 1997 | Open in IMG/M |
3300028129|Ga0228634_1102405 | Not Available | 627 | Open in IMG/M |
3300028287|Ga0257126_1057296 | Not Available | 1570 | Open in IMG/M |
3300028297|Ga0228617_1004477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5872 | Open in IMG/M |
3300028419|Ga0228625_1003677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 4632 | Open in IMG/M |
3300031519|Ga0307488_10087420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2303 | Open in IMG/M |
3300031774|Ga0315331_10008001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → unclassified Rhodobacterales → Rhodobacterales bacterium HTCC2255 | 7878 | Open in IMG/M |
3300031774|Ga0315331_10014067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 5933 | Open in IMG/M |
3300032088|Ga0315321_10004335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 10923 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 26.32% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 16.54% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 12.78% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 11.28% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 11.28% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 6.02% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.01% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.26% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.26% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.26% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.50% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.50% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.75% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.75% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.75% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300002186 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome | Environmental | Open in IMG/M |
3300003247 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10 | Environmental | Open in IMG/M |
3300003265 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 | Environmental | Open in IMG/M |
3300003271 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 | Environmental | Open in IMG/M |
3300003428 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 | Environmental | Open in IMG/M |
3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
3300006419 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
3300007981 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 | Environmental | Open in IMG/M |
3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
3300008995 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 | Environmental | Open in IMG/M |
3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009142 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 | Environmental | Open in IMG/M |
3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
3300023704 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
3300024192 | Seawater microbial communities from Monterey Bay, California, United States - 47D | Environmental | Open in IMG/M |
3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
3300024250 | Seawater microbial communities from Monterey Bay, California, United States - 58D_r | Environmental | Open in IMG/M |
3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
3300024292 | Seawater microbial communities from Monterey Bay, California, United States - 37D | Environmental | Open in IMG/M |
3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
3300024315 | Seawater microbial communities from Monterey Bay, California, United States - 20D | Environmental | Open in IMG/M |
3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
3300024320 | Seawater microbial communities from Monterey Bay, California, United States - 38D | Environmental | Open in IMG/M |
3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
3300024332 | Seawater microbial communities from Monterey Bay, California, United States - 73D | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024359 | Seawater microbial communities from Monterey Bay, California, United States - 34D | Environmental | Open in IMG/M |
3300025456 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
3300025705 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes) | Environmental | Open in IMG/M |
3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
3300026447 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
3300027077 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes) | Environmental | Open in IMG/M |
3300027170 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_35 (SPAdes) | Environmental | Open in IMG/M |
3300027183 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 (SPAdes) | Environmental | Open in IMG/M |
3300027192 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes) | Environmental | Open in IMG/M |
3300027367 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027406 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
3300028127 | Seawater microbial communities from Monterey Bay, California, United States - 49D | Environmental | Open in IMG/M |
3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
3300028297 | Seawater microbial communities from Monterey Bay, California, United States - 18D | Environmental | Open in IMG/M |
3300028419 | Seawater microbial communities from Monterey Bay, California, United States - 30D | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_101158203 | 3300000101 | Marine | SPCITQNARLYLAETARLFTQLWASLQSGEADGGVD* |
DelMOSum2010_101871071 | 3300000101 | Marine | YLAETTRLFTQLWASLQSGEADGGVVRQTRARIISLI* |
DelMOSpr2010_1000037528 | 3300000116 | Marine | PCITQKARLYLTETTQLFTQLWTSLQSGEADGGVVRQSLTRLKLAP* |
JGI20152J14361_100590851 | 3300001344 | Pelagic Marine | TYITQNARLYLTETTRLFTQLRASLQSGEADGGVR* |
JGI20152J14361_101104022 | 3300001344 | Pelagic Marine | SPCIKQKARLYLPETTRLFTQLWASLQSGEADGGACRHKG* |
JGI20156J14371_100191821 | 3300001347 | Pelagic Marine | MHPQNARLYLIETTQLFTQLWASFQSGEADGGAVGQMRARIRL |
JGI20154J14316_101619651 | 3300001348 | Pelagic Marine | NARLYLPETTQLFTQLWASLQSGEADGGVVRHMR* |
JGI20160J14292_100547461 | 3300001349 | Pelagic Marine | ITQNARLYLAETTQLFTQLWASLQSGEADGGVARHTR* |
JGI20153J14318_1000371312 | 3300001351 | Pelagic Marine | YITQNARLYLTETTRLFTQLRASLQSGEADGGVD* |
JGI20153J14318_100070568 | 3300001351 | Pelagic Marine | CIKQKARLYLPETTRLFTQLWASLQSGEADGGVVRHAK* |
JGI20153J14318_100399712 | 3300001351 | Pelagic Marine | QGLSPCITQNARLYLPETTRLFTQLWASLQSGEADGGAVRQIRSRI* |
JGI20157J14317_100501814 | 3300001352 | Pelagic Marine | KARLHLPETTRLFTQLWASLQSGEADGGVVRHAK* |
JGI24539J26755_100638742 | 3300002186 | Marine | MHTQNXRXYLTETTXLFTQLWASLQSGEADGGAVRQIRSRI* |
JGI26116J46587_10009686 | 3300003247 | Marine | PCITQKARLYLPETTQLFTQLWASLQSGEADGGVVSHMXSRI* |
JGI26118J46590_10019936 | 3300003265 | Marine | MHQQNACLYLAETTWLFTQLWASLQSGEADGGALRQIRSRI* |
JGI26114J46594_10700051 | 3300003271 | Marine | RLYLTETTRLFTQLWASLQSGEADGGVLRHTTTYIRSLR* |
JGI26111J50215_10030711 | 3300003428 | Marine | QQNACLYLAETTWLFTQLWASLQSGEADGGALRQIRSRI* |
Ga0066605_100297201 | 3300004279 | Marine | PCITQNARLYLTETTQLFTQLWASLQSGEADGGVHRHKR* |
Ga0075496_14311753 | 3300006419 | Aqueous | ETTRLFTQLWASLQSGEADGGVVRHTTTYIRSLR* |
Ga0102821_12060892 | 3300007557 | Estuarine | PCITQNARLYLTETTRLFTQLWASLQSGEADGGAVRQIRSRI* |
Ga0102855_10049424 | 3300007647 | Estuarine | ARLYLPEIKRLFTQLWASLQSGEADGGVQRHKRYGIDHT* |
Ga0102910_10057141 | 3300007667 | Estuarine | GLSPCITQNARLYLTETTRLFTQLWASLQSGEADGGVG* |
Ga0102910_10275831 | 3300007667 | Estuarine | SPCITQNARLYLTETTRLFTQLWASLQSGEADGGVVRQSLTRIKVL* |
Ga0102862_10153951 | 3300007670 | Estuarine | NFGPCITQNARLYLTETTRLFTQLWASLQSGEADGGAVRQIRSRI* |
Ga0102852_10008132 | 3300007718 | Estuarine | MHQQNACLYLAETTWLFTQLWASLQSGEADGGVARHTRSNIK* |
Ga0105737_10960282 | 3300007862 | Estuary Water | GLSPCITQNARLYLTETTRLFTQLWASLQSGEADGGVVRHAR* |
Ga0105744_11216671 | 3300007863 | Estuary Water | IGQYKEPSRSTTQNARLYLTETTRLFTQLWASLQSGEADGGALRQIRSRI* |
Ga0102904_11150472 | 3300007981 | Estuarine | MGRCLSPCITQNARLYLPETTQLFTQLWASLQSGEAD |
Ga0102887_11258692 | 3300008961 | Estuarine | YLAETTRLFTQLWASLQSGEADGGVVRQSLTRIKVL* |
Ga0102888_11032381 | 3300008995 | Estuarine | QNARLYLPEITRLFTQLWASLQSGEADGGVQRHKRYGIDHT* |
Ga0102813_10164135 | 3300009003 | Estuarine | MHQQNACLYLAETTRLFTQLWASLQSGEADGGALRQIR |
Ga0102813_12046851 | 3300009003 | Estuarine | TQNARLYLTETTRLFTQLWASLQSGEADGGALRQIRSRI* |
Ga0102911_11781871 | 3300009049 | Estuarine | RLYLTETTRLFTQLWASLQSGEADGGAVRQIRSRI* |
Ga0115549_10851081 | 3300009074 | Pelagic Marine | SPCIKQKARLYLPETTRLFTQLWASLQSGEADGGVVRHAK* |
Ga0115549_11909821 | 3300009074 | Pelagic Marine | MGRCLSPCITQNARLYLPETTQLFTQLWASLQSGEADG |
Ga0115550_10888461 | 3300009076 | Pelagic Marine | QGLSPCITQNARLYLPETTRLFTQLWASLQSGEADGGVVRHAK* |
Ga0102885_10715971 | 3300009142 | Estuarine | QNARLYLTETTQLFTQLWASLQSGEADGGAHRHKR* |
Ga0115548_10844931 | 3300009423 | Pelagic Marine | CLSPCIKQKARLYLPETTRLFTQLWASLQSGEADGGVVRHAK* |
Ga0115562_10067411 | 3300009434 | Pelagic Marine | YQDFGTYITQNARLYLTETTRLFTQLRASLQSGEADGGVD* |
Ga0115562_11237001 | 3300009434 | Pelagic Marine | GLSASATQSARLYLAETTRLFTQLWASLQSGEADGGVARHTRSYII* |
Ga0115546_10399581 | 3300009435 | Pelagic Marine | PCITQNVRLYLAETTRLFTQLWASLQSGEADGGAFRQIKSRI* |
Ga0115559_10426471 | 3300009438 | Pelagic Marine | ARLYFTETMQLFTQLWASLQSGEADGGVVRQSLTHLKISR* |
Ga0115563_12222961 | 3300009442 | Pelagic Marine | RLYLAETTRLFTQLWASLQSGEADGGVARHTRSYII* |
Ga0115571_11252451 | 3300009495 | Pelagic Marine | QNARLYLPETTQLFTQLWASLQSGEADGGALRQIRSRI* |
Ga0115571_13522241 | 3300009495 | Pelagic Marine | QDFGTYITQNARLYLTETTRLFTQLRASLQSGEADGGAHRHKR* |
Ga0115571_13933551 | 3300009495 | Pelagic Marine | GLSPCITQNARLYLPETTRLFTQLWASLQSGEADGGVH* |
Ga0115564_100099191 | 3300009505 | Pelagic Marine | RLYLTETTRLFTQLWASLQSGEADGGVVRQSLTRIKVPR* |
Ga0115564_100201411 | 3300009505 | Pelagic Marine | QNARLYLAETTRLFTQLWASLQSGEADGGVARQMR* |
Ga0115572_100057307 | 3300009507 | Pelagic Marine | FRCYPCLSPCIKQKARLYLPETTRLFTQLWASLQSGEADGGVLRHAR* |
Ga0115572_100077931 | 3300009507 | Pelagic Marine | SSITQNARLYLIETTQLFTQLWASFQSGEADGGVR* |
Ga0115567_101741323 | 3300009508 | Pelagic Marine | SPCIKQKARLYLPETTRLFTQLWASLQSGEADGGVD* |
Ga0206127_11421071 | 3300020169 | Seawater | YQGLSPCITQNARLYLPETTRLFTQLWASLQSGEADGGVG |
Ga0206124_100181811 | 3300020175 | Seawater | GLSPCITQNARLYLPETTRLFTQLWASLQSGEADGGETGIL |
Ga0206129_100298241 | 3300020182 | Seawater | CITQNARLYLPETTQLFTQLWASLQSGEADGGVARHTR |
Ga0206131_100603501 | 3300020185 | Seawater | SPCIKQKARLYLPETTRLFTQLWASLQSGEADGGVR |
Ga0206131_101632171 | 3300020185 | Seawater | DFGTYITQNARLYLTETTRLFTQLRASLQSGEADGGVR |
Ga0206131_102943402 | 3300020185 | Seawater | QNACLYLAETTWLFTQLWASLQSGEADGGALRQIRSRI |
Ga0206130_100917761 | 3300020187 | Seawater | CITQNAHLYLAETTQLFTQLWASLQSGEADGGALRQIRSRI |
Ga0211505_11166132 | 3300020352 | Marine | TQNARLYLTITTRLFTQLWASLQSVEADGGVVRQTKSHIR |
Ga0206677_100142176 | 3300021085 | Seawater | MHQQNACLYLAETTWLFTQLWASLQSGEADGGALRQIRSRI |
Ga0206123_100965221 | 3300021365 | Seawater | PCITQNARLYLTETMRLFTQLWASLQSGEADGGVD |
Ga0213863_102148771 | 3300021371 | Seawater | KQKARLYLPETTRLFTQLWASLQSGEADGGVVRHTTTYIRSLR |
Ga0213861_102331501 | 3300021378 | Seawater | GLSPCITQNARLYLPETTQLFTQLWASLQSGEADGGVD |
Ga0213868_102231872 | 3300021389 | Seawater | LSPCITQNARLYLPETTQLFTQLWASLQSGEADGGALRQIRSRI |
Ga0213868_104616442 | 3300021389 | Seawater | QYARLYLTETTQLFTQLWSSLQSGEADGGVVRQTR |
Ga0222717_1000090523 | 3300021957 | Estuarine Water | NARMYLTETTRLFTQLWASLQSGEADGGVVRQSLTRLKLAP |
Ga0222717_104218621 | 3300021957 | Estuarine Water | YQGLSPCITQNARLYLTETTRLFTQLWASLQSGEADGGVD |
Ga0222716_104283602 | 3300021959 | Estuarine Water | QGLSPCITQNARLYLTETMRLFTQLWASLQSGEADGGAFRQIKSRI |
(restricted) Ga0233426_100482261 | 3300022920 | Seawater | TQNARLYLTETTRLFTQLWASLQSGEADGGVVRHMR |
Ga0228684_10649052 | 3300023704 | Seawater | LYLPEITQLFTQLWASLQSGEADGGVVRQNLTHLKVL |
Ga0228668_10622721 | 3300024180 | Seawater | MHQQNACLYLAETTWLFTQLWASLQSGEADGGVARHTRSNIK |
Ga0228637_10061013 | 3300024192 | Seawater | QNSRLYLTETTRLFTQLRASLQSGEADGGAVRRSLTHLKVL |
Ga0228666_10112491 | 3300024221 | Seawater | PCITKNERLYLAETTRLFTQLWASLQSGEADGGVGRPVR |
Ga0233399_10029891 | 3300024231 | Seawater | CITQNARLYLPEIKRLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0228653_10286301 | 3300024237 | Seawater | LAETTRLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0228675_100085110 | 3300024247 | Seawater | LYLPETTQLFTQLWASLQSGEADGGVVKHARTCIK |
Ga0228676_10115443 | 3300024248 | Seawater | CITQKARLYLPETTQLFTQLWASLQSGEADGGVVSHMRSRI |
Ga0228677_10000711 | 3300024250 | Seawater | YQGLSPCITQNARLYLPETTQLFTQLWASLQSGEADGGVVKHARTCIK |
Ga0228677_10060461 | 3300024250 | Seawater | PCITQNARLYLTETTQLFTQLWASLQSGEADGGVARQTIVCIQLF |
(restricted) Ga0233438_100618331 | 3300024255 | Seawater | LSPCITQNARLYLTETTRLFTQLWASLQSGEADGGVLRHAR |
Ga0228630_10009091 | 3300024292 | Seawater | TQNARLYLTETMRLFTQLWASLQSGEADGGAFRQIKSRI |
Ga0228658_10002171 | 3300024297 | Seawater | PCITQNARLYLPEIKRLFTQLWASLQSGEADGGAFRQIKSRI |
Ga0228657_10836582 | 3300024314 | Seawater | RPASATQSARLYLPEIKRLFTQLWASLQSGEADGGVD |
Ga0228618_10118611 | 3300024315 | Seawater | FSLSPCITQNARLYLPEITQLFTQLWASLQSGEADGGVVRQNLTHLKVL |
Ga0228618_10867611 | 3300024315 | Seawater | PCITQNARLYLHEITRLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0228670_10378212 | 3300024319 | Seawater | ARLYLPETTRLFTQLWASLQSGEADGGVVSHMRSRI |
Ga0233398_11427691 | 3300024320 | Seawater | QGLSPCITQNARLYLPETTQLFTQLWASLQSGEADGGVVRHTTIHII |
Ga0228652_10002211 | 3300024326 | Seawater | NARLYLAETTRLFTQLWASLQSGEADGGVVKHARTCIK |
Ga0228659_10004011 | 3300024332 | Seawater | QNARLYLPETTQLFTQLWASLQSGEADGGVVKHARTCIK |
Ga0228659_10035814 | 3300024332 | Seawater | QNARLYLPETTRLFTQLRASLQSGEADGGAVRRSLTHLKVL |
Ga0244777_100466792 | 3300024343 | Estuarine | MGRCLSPCITQNARLYLTETTQLFTQLWASLQSGEADGGVLRHAR |
Ga0228628_10157713 | 3300024359 | Seawater | TQNARLYLPEITRLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0209776_10429102 | 3300025456 | Marine | NFGPCITQNARLYLTETTRLFTQLWASLQSGEADGGAVRQIRSRI |
Ga0209557_10434261 | 3300025483 | Marine | PCITQNARLYLAETTRLFTQLWASLQSGEADGGVLRHAR |
Ga0209557_10506591 | 3300025483 | Marine | PCITQKARLYLPETTRLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0209557_11190011 | 3300025483 | Marine | YQGHSPCITQNARLYLTETTRLFTQLWASLQSGEADGGVA |
Ga0209304_11386961 | 3300025577 | Pelagic Marine | QNASLYLAETTRLFTQLWASLQSGEADGGAVRQIRSRI |
Ga0209195_10387441 | 3300025590 | Pelagic Marine | SPCITQNARLYLPETTRLFTQLWASLQSGEADGGVR |
Ga0209198_10934772 | 3300025640 | Pelagic Marine | GLSPCITQNARLYLPETTQLFTQLWASLQSGEADGGVR |
Ga0209532_10347871 | 3300025696 | Pelagic Marine | ITQNARLYLAETTRLFTQLWASLQSGEADGGVARHTR |
Ga0209771_10058731 | 3300025701 | Marine | PCITQNARLYLTETTRLFTQLWASLQSGEADGGVLRHTTT |
Ga0209602_11284293 | 3300025704 | Pelagic Marine | PCITQNARLYLPETTQLFTQLWASLQSGEADGGVD |
Ga0209602_12329621 | 3300025704 | Pelagic Marine | CITQNARLYLTEPMPLYTQLWASLQSGEADGGVGSLLRTSL |
Ga0209374_10219903 | 3300025705 | Marine | CITQNARLYLTETTQLFTQLWASLQSGEADGGVHRHKR |
Ga0209223_100399261 | 3300025876 | Pelagic Marine | QNARLYLPETTRLFTQLWASLQSGEADGGSTGTRRL |
Ga0209534_100814643 | 3300025880 | Pelagic Marine | PCITQNARLYLTETTRLFTQLWASLQSGEADGGVVRQSLTRIKVPR |
Ga0209534_101166754 | 3300025880 | Pelagic Marine | PCIKQKARLYLPETTRLFTQLWASLQSGEADGGVVRHAK |
Ga0209632_100189906 | 3300025886 | Pelagic Marine | SNQGLSPCITQNARLYLTETMRLFMQLWASLQSGQADGGVD |
Ga0209632_100434957 | 3300025886 | Pelagic Marine | CITQNARLYLAETTQLFTQLWASLQSGEADGGVARHTR |
Ga0247607_10380451 | 3300026447 | Seawater | PCITQNARLYLPEITQLFTQLWASLQSGEADGGVVRQNLTHLKVL |
Ga0228622_10080621 | 3300026479 | Seawater | IRRPASATQSARLYPPEITRLFTQLWASLQSGEADGGVD |
Ga0233395_100152410 | 3300026511 | Seawater | ARLYLPETTQLFTQLWASLQSGEADGGVVKHARTCIK |
Ga0233395_10415931 | 3300026511 | Seawater | PCITQNARMYLTETTRLFTQLWASLQSGEADGGETGIL |
Ga0228607_10958031 | 3300026517 | Seawater | PCITQNARLYLTETMRLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0208941_10026905 | 3300027077 | Marine | QQNACLYLAETTWLFTQLWASLQSGEADGGALRQIRSRI |
Ga0208963_10085014 | 3300027170 | Marine | MHQQNACLYLAETTWLFTQLWASLQSGEADGGALRQIRSR |
Ga0208798_10242652 | 3300027183 | Estuarine | YKEPSRSTTQNARLYLTETTRLFTQLWASLQSGEADGGALRQIRSRI |
Ga0208673_10156571 | 3300027192 | Estuarine | QNARLYLTETTRLFTQLWASLQSGEADGGAVRQIRSRI |
Ga0208801_10110952 | 3300027367 | Estuarine | CLYLAETTWLFTQLWASLQSGEADGGALRQIRSRI |
Ga0208965_10369211 | 3300027406 | Marine | PCITQNARLYLTETTQLFTQLWASLQSGEADGGVD |
Ga0208950_10234513 | 3300027413 | Marine | MGRCLSPCITQNARLYLPETTQLFTQLWASLQSGEADGI |
Ga0208973_10087871 | 3300027506 | Marine | LYLTETTQLFTQLWASLQSGEADGGVVKHARTCIK |
Ga0208971_100213710 | 3300027582 | Marine | RLYLPEIKRLFTQLWASLQSGEADGGVVKHARTCIK |
Ga0228674_11100522 | 3300028008 | Seawater | LSPCITQNARLYLPEITRLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0233401_10159463 | 3300028127 | Seawater | TQNVRLYLAETTRLFTQLWANLQSGEADGGVGRPVR |
Ga0228634_11024052 | 3300028129 | Seawater | ITQNARLYLTETTRLFTQLWASLQSGEADGGVIRQTNYTI |
Ga0257126_10572961 | 3300028287 | Marine | QYARLYLTETTQLFTQLWASLQSGEADGGVVRHMR |
Ga0228617_10044771 | 3300028297 | Seawater | ITQNARLYLTETMRLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0228625_10036771 | 3300028419 | Seawater | LSPCITQNARLYLTETTQLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0307488_100874203 | 3300031519 | Sackhole Brine | QDLSPCITQNARMYLTETTRLFTQLWASLQSGEADGGVD |
Ga0315331_100080017 | 3300031774 | Seawater | PCITQNARLYLPETTRLFTQLWASLQSGEADGGVIKHTR |
Ga0315331_100140676 | 3300031774 | Seawater | LDLTETTRLFTQLWASLQSGEADGGVARQTIVCIQLF |
Ga0315321_1000433510 | 3300032088 | Seawater | TQNARLYLPETTQLFTQLWASLQSGEADGGVVKHARTCIK |
⦗Top⦘ |