Basic Information | |
---|---|
Family ID | F058857 |
Family Type | Metagenome |
Number of Sequences | 134 |
Average Sequence Length | 45 residues |
Representative Sequence | MKKKQAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVVAL |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 48.51 % |
% of genes near scaffold ends (potentially truncated) | 98.51 % |
% of genes from short scaffolds (< 2000 bps) | 91.04 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.507 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.836 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.552 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.507 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.72% β-sheet: 0.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF09334 | tRNA-synt_1g | 36.57 |
PF08264 | Anticodon_1 | 8.96 |
PF14579 | HHH_6 | 2.24 |
PF03255 | ACCA | 1.49 |
PF04468 | PSP1 | 1.49 |
PF02371 | Transposase_20 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 36.57 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 36.57 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 36.57 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 36.57 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 36.57 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 36.57 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.49 |
COG1774 | Cell fate regulator YaaT, PSP1 superfamily (controls sporulation, competence, biofilm development) | Signal transduction mechanisms [T] | 1.49 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.51 % |
Unclassified | root | N/A | 1.49 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002562|JGI25382J37095_10079002 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1212 | Open in IMG/M |
3300002908|JGI25382J43887_10401366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 579 | Open in IMG/M |
3300003319|soilL2_10069337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1060 | Open in IMG/M |
3300004047|Ga0055499_10081016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 573 | Open in IMG/M |
3300004463|Ga0063356_104270620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 615 | Open in IMG/M |
3300005166|Ga0066674_10349238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 694 | Open in IMG/M |
3300005172|Ga0066683_10042391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2665 | Open in IMG/M |
3300005175|Ga0066673_10335905 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 882 | Open in IMG/M |
3300005177|Ga0066690_10209968 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1298 | Open in IMG/M |
3300005180|Ga0066685_10129708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1704 | Open in IMG/M |
3300005187|Ga0066675_10186897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1447 | Open in IMG/M |
3300005338|Ga0068868_100905070 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 802 | Open in IMG/M |
3300005444|Ga0070694_101174381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 642 | Open in IMG/M |
3300005446|Ga0066686_10580569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 762 | Open in IMG/M |
3300005451|Ga0066681_10827956 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 558 | Open in IMG/M |
3300005451|Ga0066681_10900264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
3300005468|Ga0070707_101364077 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
3300005518|Ga0070699_100171671 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1921 | Open in IMG/M |
3300005526|Ga0073909_10655223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
3300005549|Ga0070704_100101964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 2164 | Open in IMG/M |
3300005553|Ga0066695_10870934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
3300005555|Ga0066692_10881106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 549 | Open in IMG/M |
3300005555|Ga0066692_10920794 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
3300005560|Ga0066670_10333523 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 924 | Open in IMG/M |
3300005561|Ga0066699_11062642 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
3300005574|Ga0066694_10584057 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
3300006046|Ga0066652_100040091 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3444 | Open in IMG/M |
3300006794|Ga0066658_10721669 | All Organisms → cellular organisms → Bacteria → FCB group | 553 | Open in IMG/M |
3300006797|Ga0066659_10310176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1207 | Open in IMG/M |
3300006804|Ga0079221_10808655 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 673 | Open in IMG/M |
3300006806|Ga0079220_10823476 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 706 | Open in IMG/M |
3300006806|Ga0079220_10863118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 696 | Open in IMG/M |
3300006852|Ga0075433_10022900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5250 | Open in IMG/M |
3300007076|Ga0075435_100965380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 744 | Open in IMG/M |
3300007076|Ga0075435_101177185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 671 | Open in IMG/M |
3300007258|Ga0099793_10336775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 736 | Open in IMG/M |
3300007265|Ga0099794_10526987 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 623 | Open in IMG/M |
3300007788|Ga0099795_10423213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
3300009088|Ga0099830_10481470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1011 | Open in IMG/M |
3300009089|Ga0099828_11305819 | Not Available | 642 | Open in IMG/M |
3300009090|Ga0099827_11778072 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 537 | Open in IMG/M |
3300009137|Ga0066709_101905597 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 827 | Open in IMG/M |
3300009137|Ga0066709_102703021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 661 | Open in IMG/M |
3300009609|Ga0105347_1026977 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1993 | Open in IMG/M |
3300009678|Ga0105252_10039854 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1750 | Open in IMG/M |
3300009678|Ga0105252_10072422 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1342 | Open in IMG/M |
3300009804|Ga0105063_1031944 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 682 | Open in IMG/M |
3300010301|Ga0134070_10281743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 629 | Open in IMG/M |
3300010304|Ga0134088_10001416 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 9259 | Open in IMG/M |
3300010304|Ga0134088_10122473 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1230 | Open in IMG/M |
3300010320|Ga0134109_10034713 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1620 | Open in IMG/M |
3300010320|Ga0134109_10195411 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 745 | Open in IMG/M |
3300010320|Ga0134109_10488087 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
3300010333|Ga0134080_10365161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 661 | Open in IMG/M |
3300010336|Ga0134071_10361101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 735 | Open in IMG/M |
3300010364|Ga0134066_10012397 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1747 | Open in IMG/M |
3300010396|Ga0134126_12161299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 607 | Open in IMG/M |
3300010399|Ga0134127_10868214 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 955 | Open in IMG/M |
3300010403|Ga0134123_10314381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1396 | Open in IMG/M |
3300011270|Ga0137391_10792249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 782 | Open in IMG/M |
3300011270|Ga0137391_11451230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
3300011437|Ga0137429_1005873 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3610 | Open in IMG/M |
3300011438|Ga0137451_1216670 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 605 | Open in IMG/M |
3300011443|Ga0137457_1156681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 759 | Open in IMG/M |
3300012096|Ga0137389_11555267 | Not Available | 557 | Open in IMG/M |
3300012189|Ga0137388_10020565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 4948 | Open in IMG/M |
3300012198|Ga0137364_10709698 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 759 | Open in IMG/M |
3300012199|Ga0137383_10194006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1489 | Open in IMG/M |
3300012199|Ga0137383_11312136 | All Organisms → cellular organisms → Bacteria → FCB group | 515 | Open in IMG/M |
3300012200|Ga0137382_10113994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1798 | Open in IMG/M |
3300012203|Ga0137399_10284402 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1363 | Open in IMG/M |
3300012204|Ga0137374_10394133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1102 | Open in IMG/M |
3300012207|Ga0137381_10583875 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 974 | Open in IMG/M |
3300012207|Ga0137381_10845081 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 793 | Open in IMG/M |
3300012208|Ga0137376_10187350 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1788 | Open in IMG/M |
3300012208|Ga0137376_10796108 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 814 | Open in IMG/M |
3300012228|Ga0137459_1075751 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 968 | Open in IMG/M |
3300012349|Ga0137387_10044818 | All Organisms → cellular organisms → Bacteria | 2925 | Open in IMG/M |
3300012349|Ga0137387_10960840 | All Organisms → cellular organisms → Bacteria → FCB group | 615 | Open in IMG/M |
3300012350|Ga0137372_10642803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 774 | Open in IMG/M |
3300012351|Ga0137386_10615745 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 781 | Open in IMG/M |
3300012351|Ga0137386_10984337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
3300012354|Ga0137366_10112242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2062 | Open in IMG/M |
3300012354|Ga0137366_10438128 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 949 | Open in IMG/M |
3300012356|Ga0137371_10964519 | All Organisms → cellular organisms → Bacteria → FCB group | 648 | Open in IMG/M |
3300012358|Ga0137368_10234420 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1280 | Open in IMG/M |
3300012358|Ga0137368_10567305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 724 | Open in IMG/M |
3300012360|Ga0137375_10466039 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1084 | Open in IMG/M |
3300012360|Ga0137375_10528752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 997 | Open in IMG/M |
3300012917|Ga0137395_10968092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
3300012917|Ga0137395_11076388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 571 | Open in IMG/M |
3300012917|Ga0137395_11185873 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 535 | Open in IMG/M |
3300012924|Ga0137413_11204722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 604 | Open in IMG/M |
3300012927|Ga0137416_10275822 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1384 | Open in IMG/M |
3300012927|Ga0137416_10492712 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1054 | Open in IMG/M |
3300012927|Ga0137416_11219667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 678 | Open in IMG/M |
3300012927|Ga0137416_11932184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 540 | Open in IMG/M |
3300012972|Ga0134077_10271541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 706 | Open in IMG/M |
3300012972|Ga0134077_10406928 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 589 | Open in IMG/M |
3300012975|Ga0134110_10002755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6367 | Open in IMG/M |
3300014157|Ga0134078_10002035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 5198 | Open in IMG/M |
3300015052|Ga0137411_1087217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 627 | Open in IMG/M |
3300015052|Ga0137411_1151945 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1181 | Open in IMG/M |
3300015356|Ga0134073_10182308 | All Organisms → cellular organisms → Bacteria → FCB group | 685 | Open in IMG/M |
3300015357|Ga0134072_10408645 | All Organisms → cellular organisms → Bacteria → FCB group | 537 | Open in IMG/M |
3300015359|Ga0134085_10393367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 621 | Open in IMG/M |
3300017656|Ga0134112_10045594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1578 | Open in IMG/M |
3300017656|Ga0134112_10158151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 874 | Open in IMG/M |
3300017659|Ga0134083_10055370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1501 | Open in IMG/M |
3300017961|Ga0187778_10836639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 629 | Open in IMG/M |
3300017966|Ga0187776_10794475 | All Organisms → cellular organisms → Bacteria → FCB group | 678 | Open in IMG/M |
3300018082|Ga0184639_10328333 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 800 | Open in IMG/M |
3300020170|Ga0179594_10388158 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
3300021080|Ga0210382_10010086 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3187 | Open in IMG/M |
3300025159|Ga0209619_10096961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1767 | Open in IMG/M |
3300026089|Ga0207648_12054271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
3300026295|Ga0209234_1268970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
3300026300|Ga0209027_1280973 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
3300026301|Ga0209238_1149008 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 718 | Open in IMG/M |
3300026301|Ga0209238_1163785 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 662 | Open in IMG/M |
3300026306|Ga0209468_1171743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 549 | Open in IMG/M |
3300026317|Ga0209154_1131773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1052 | Open in IMG/M |
3300026319|Ga0209647_1239315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 608 | Open in IMG/M |
3300026323|Ga0209472_1206517 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 659 | Open in IMG/M |
3300026323|Ga0209472_1268165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
3300026325|Ga0209152_10084608 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1173 | Open in IMG/M |
3300026335|Ga0209804_1130472 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1136 | Open in IMG/M |
3300026536|Ga0209058_1352109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
3300026540|Ga0209376_1392906 | All Organisms → cellular organisms → Bacteria → FCB group | 519 | Open in IMG/M |
3300027616|Ga0209106_1121661 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 585 | Open in IMG/M |
3300027903|Ga0209488_10720743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 713 | Open in IMG/M |
3300031199|Ga0307495_10040531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 908 | Open in IMG/M |
3300031820|Ga0307473_11497867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
3300032180|Ga0307471_101572849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 814 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.66% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.18% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.72% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.99% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.24% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.24% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.24% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.49% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.49% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.75% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25382J37095_100790021 | 3300002562 | Grasslands Soil | MRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALTFLV |
JGI25382J43887_104013661 | 3300002908 | Grasslands Soil | MRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALTF |
soilL2_100693371 | 3300003319 | Sugarcane Root And Bulk Soil | MKKKTAERKWTVMVVPHGSGSSRAVEVSQTVVKALIGIGGVVAL |
Ga0055499_100810162 | 3300004047 | Natural And Restored Wetlands | MKKHAERKWTVMVVPHGSGSSRAVEVSQTVVKALVGIGGV |
Ga0063356_1042706202 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKKKNAERKWTVMVVPHGSGSSRAVEVSQTVVKALIGIGGVVALLFLVLGGTA |
Ga0066674_103492381 | 3300005166 | Soil | MSKKAERRWTVMVVPHGSGASRAVEVSQTVVKALVGIGSVVSLAFLVLGAAAI |
Ga0066683_100423911 | 3300005172 | Soil | MSKKTERRWTVMVVPHGSGASRAVEVSQTVVKALVGIGSVVSLAFLV |
Ga0066673_103359052 | 3300005175 | Soil | VPGLTVLMRGRGERMRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIGSVVAL |
Ga0066690_102099682 | 3300005177 | Soil | MRHKAERKWTLMVVPHGSGASRAVELSQTVVKALVGFGSALT |
Ga0066685_101297081 | 3300005180 | Soil | MRKNAERRWTVMLVPHGAGASRGVEVSQTFVKGFFGIGGVVALTFLV |
Ga0066675_101868971 | 3300005187 | Soil | MRKNAERRWTVMLVPHGAGASRGVEISQTFVKGFFGIGGVVALTFLV |
Ga0068868_1009050701 | 3300005338 | Miscanthus Rhizosphere | MKKKTAERKWTVMVVPHGSGSSRAVEVSQTVVKALIGIGG |
Ga0070694_1011743811 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRAERRWTVMVVPHGSGASRAVEVSHTVVKGLMGIGAVIAL |
Ga0066686_105805691 | 3300005446 | Soil | MPKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALTF |
Ga0066681_108279562 | 3300005451 | Soil | MKKKHAERRWTVMVVPHGSGASRAVEVSQTVLKALIGLGGVIALLV |
Ga0066681_109002642 | 3300005451 | Soil | MRGRGEQMRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALIGIGSV |
Ga0070707_1013640772 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKEAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALTFL |
Ga0070699_1001716712 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSSERRNSGRRWTVMVVPHGSGASRAVEVSHSVFKALVGIGSVLMLLLVV |
Ga0073909_106552231 | 3300005526 | Surface Soil | MKKKHAERRWTVMLVPHGSGSSRAVEISQTVVKALVGIGGVVALLFLV |
Ga0070704_1001019643 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKQAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGGLLALLFLIL |
Ga0066695_108709341 | 3300005553 | Soil | LMRGRGKRMRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIG |
Ga0066692_108811062 | 3300005555 | Soil | MRHKAERKWTVMLVPHGSGASRAVEVSQTVVKALAGFGSALALLFL |
Ga0066692_109207942 | 3300005555 | Soil | LMRGRGERMRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALIGIGS |
Ga0066670_103335231 | 3300005560 | Soil | MRKNAERRWTVMLVPHGAGASRGVEVSQTFVKGFFGIGGVVALTFLVLG |
Ga0066699_110626422 | 3300005561 | Soil | MRRATERRWTVMLVPHGAGASRGVEVSQTFVKAVLGIGGVVALTFLVLG |
Ga0066694_105840571 | 3300005574 | Soil | LMRGRGEQMRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALIGIGS |
Ga0066652_1000400911 | 3300006046 | Soil | MKKKQAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGGLLALLF |
Ga0066658_107216691 | 3300006794 | Soil | MRKKAERRWTVMVVPHGSGLSRAVEVSQTFLKTLLG |
Ga0066659_103101761 | 3300006797 | Soil | MRKKAERRWTLMVVPHGSGSSRAVEVSQTFVKALVGI |
Ga0079221_108086551 | 3300006804 | Agricultural Soil | LTRGRDVEMPKKAERRWTVMVVPHGSGSSRALEVSQTFVKALVGIGSVVALTFLVL |
Ga0079220_108234762 | 3300006806 | Agricultural Soil | MPKKTERRWTVMVVPHGSGSSRALEVSQTFVKALVG |
Ga0079220_108631181 | 3300006806 | Agricultural Soil | MRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVG |
Ga0075433_100229001 | 3300006852 | Populus Rhizosphere | MRRMFAFPMKKKQAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIG |
Ga0075435_1009653802 | 3300007076 | Populus Rhizosphere | MKKKQAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVVALLFLVLGGTA |
Ga0075435_1011771851 | 3300007076 | Populus Rhizosphere | MKKKKAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVLALIV |
Ga0099793_103367751 | 3300007258 | Vadose Zone Soil | MKKKHAERKWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVVALLFL |
Ga0099794_105269871 | 3300007265 | Vadose Zone Soil | MKKKRAERRWTVMLVPHGSGSSRALEVSQTVVKALV |
Ga0099795_104232132 | 3300007788 | Vadose Zone Soil | MKKKSAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGGVVALLF |
Ga0099830_104814701 | 3300009088 | Vadose Zone Soil | MRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALTFL |
Ga0099828_113058191 | 3300009089 | Vadose Zone Soil | MPPTKERRWTVMLVPHGAAGSRSVDVSQAFLAGLAGIGSVVALT |
Ga0099827_117780721 | 3300009090 | Vadose Zone Soil | MKKKRTERRWTVMLVPHGSGSSRAVEVSQTVVKALVGI |
Ga0066709_1019055971 | 3300009137 | Grasslands Soil | MRRKTERRWTVMLVPHGSGASRAVELSQTVVKALVGIGSVIALLFLVL |
Ga0066709_1027030212 | 3300009137 | Grasslands Soil | VSKTPMRKRAERRWTVMLVPHGSGSSRAVELSHTVVKERMGIGGVIFALGVVLGLAAVVR |
Ga0105347_10269773 | 3300009609 | Soil | MKKKDAERRWTVMLVPHGSGASRAVEVSQTVVKALVGIGGVV |
Ga0105252_100398542 | 3300009678 | Soil | MKKKHAERRWTVMLVPHGSGASRAVEVSQTVVKALVGIGGVVALLFLV |
Ga0105252_100724222 | 3300009678 | Soil | MKKKDAERRWTVMLVPHGSGASRAVEVSQTVVKALVGIGGVVALLFLV |
Ga0105063_10319441 | 3300009804 | Groundwater Sand | MKKKHAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGGVVALLF |
Ga0134070_102817432 | 3300010301 | Grasslands Soil | MKKKQAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGGLLALLFLVLGG |
Ga0134088_100014161 | 3300010304 | Grasslands Soil | MRKKAERRWTVMLVPHGSGASRAVEVSQTFVKALVG |
Ga0134088_101224732 | 3300010304 | Grasslands Soil | MRKRAERRWTVMLVPHGSGSSRAVEVSHTLMKSLMGIGGVLVLLVVVLGVT |
Ga0134109_100347131 | 3300010320 | Grasslands Soil | MSKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALLGI |
Ga0134109_101954112 | 3300010320 | Grasslands Soil | MKKKQADRRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVLALLV |
Ga0134109_104880871 | 3300010320 | Grasslands Soil | MRKQAERRWTLIVVPHGSGSSRAVDVSQTFVKALVGIGSV |
Ga0134080_103651611 | 3300010333 | Grasslands Soil | MKKKQADRRWTVMLVPHGSGSSRAVEVSQTGVKALVRIGSVLALLVLVRG |
Ga0134071_103611012 | 3300010336 | Grasslands Soil | MKKKHAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGGVVALLFLV |
Ga0134066_100123972 | 3300010364 | Grasslands Soil | MRGRGERMRKKAEQRWTVMVVPHGSGSSRAVEVSQTFVKALIGIGSVVALTFLVLGV |
Ga0134126_121612992 | 3300010396 | Terrestrial Soil | VSQKHQKTDRRWTVMVVPHGSGSSRAVEVSLSVVKALIGF |
Ga0134127_108682141 | 3300010399 | Terrestrial Soil | MRKRAERRWTVMVVPHGSGANRAVELSHTVVKGLLGVASVV |
Ga0134123_103143811 | 3300010403 | Terrestrial Soil | MKKKNAERKWTVMVVPHGSGSSRAVEVSQTVVKALIGIGG |
Ga0137391_107922491 | 3300011270 | Vadose Zone Soil | MRKPAERRWTVMVVPHGSGVSRAVELSQTVVKAVVGISSVLVVLVLVLGSA |
Ga0137391_114512301 | 3300011270 | Vadose Zone Soil | MRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALV |
Ga0137429_10058731 | 3300011437 | Soil | MKKKHAERRWTVMLVPHGSGASRAVEVSQTVVKALVGIG |
Ga0137451_12166702 | 3300011438 | Soil | MKKKHAERRWTVMLVPHGSGASRAVEVSQTVVKALVGIGGVVAL |
Ga0137457_11566811 | 3300011443 | Soil | MKKKHAERRWTVMLVPHGSGASRAVEVSQTVVKALVGIGGVVALLFL |
Ga0137389_115552671 | 3300012096 | Vadose Zone Soil | MPPTKERRWTVMLVPHGAAGSRSVDVSQAFLAGLAGIGSVVALTFLVLGVAA |
Ga0137388_100205655 | 3300012189 | Vadose Zone Soil | MKKKRTERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSV |
Ga0137364_107096981 | 3300012198 | Vadose Zone Soil | MRGRGERMRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALIGIGSV |
Ga0137383_101940061 | 3300012199 | Vadose Zone Soil | MRKHAERRWTVMLVPHGSGTSRAVEVSHTVMKAFMGIGG |
Ga0137383_113121362 | 3300012199 | Vadose Zone Soil | MRKKAERRWTLMVVPHGSGSSRAVEVSQTFVKALVGIGSVV |
Ga0137382_101139941 | 3300012200 | Vadose Zone Soil | MGRIFRFPMKKKQAERRWTVMLVPHGSGSSRAVEVSQT |
Ga0137399_102844021 | 3300012203 | Vadose Zone Soil | MRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIGSV |
Ga0137374_103941332 | 3300012204 | Vadose Zone Soil | MRKKAERRWTVMLVPHGSGSSRAVELSQTAIKALVGIGSVVAL |
Ga0137381_105838752 | 3300012207 | Vadose Zone Soil | MRKKAERRWTVMLVPHGSGASRAVEVSQTFVKALVGIGSVVA |
Ga0137381_108450811 | 3300012207 | Vadose Zone Soil | MKKKRAERRWTVMLVPHGSGSSRAVEVSQTVFKALVGIGSV |
Ga0137376_101873501 | 3300012208 | Vadose Zone Soil | MKKKRAERRWTVMLVPHGSGSSRAVEVSQTVFKALVGIGSVLALLV |
Ga0137376_107961081 | 3300012208 | Vadose Zone Soil | MRKQAERRWTLMVVPHGSGSSRAVEVSQTFVKALVGIGS |
Ga0137459_10757512 | 3300012228 | Soil | MKKKDAERRWTVMLVPHGSGASRAVEVSQTVVKALVGIGGVVALLFLVLGGTALSR |
Ga0137387_100448181 | 3300012349 | Vadose Zone Soil | LQKQAERRWTVMLVPHGSGASRAVEVSQTVLKFLVGF |
Ga0137387_109608402 | 3300012349 | Vadose Zone Soil | MRKKAERRWTVMLVPHGSGASRAVEVSQTFVKALVGIGSVVALTFLVLG |
Ga0137372_106428032 | 3300012350 | Vadose Zone Soil | MRKKAERRWTLMVVPHGSGLSRAVEVSQTFVKTLVGIGSVVALTFLVLGV |
Ga0137386_106157452 | 3300012351 | Vadose Zone Soil | MKKKRTERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIG |
Ga0137386_109843372 | 3300012351 | Vadose Zone Soil | MRKKAERRWTVMLVPHGSGASRAVEVSQTFVKALVGIGSVV |
Ga0137366_101122421 | 3300012354 | Vadose Zone Soil | MRKNAERRWTVMLVPHGAGASRAVELSQTVVKTLVGIGS |
Ga0137366_104381281 | 3300012354 | Vadose Zone Soil | MSKKTERRWTVMVVPHGSGTSRALEVSQTFVKALL |
Ga0137371_109645192 | 3300012356 | Vadose Zone Soil | MPKKAERRWTLMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALTFLVLG |
Ga0137368_102344201 | 3300012358 | Vadose Zone Soil | MKKKHAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVVALMF |
Ga0137368_105673051 | 3300012358 | Vadose Zone Soil | MRKPAERRWTVMVVPHGSGSSRAVEVSQTVVKTLVGIGSVVALLF |
Ga0137375_104660391 | 3300012360 | Vadose Zone Soil | MKKKHAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVVALLFLVLG |
Ga0137375_105287521 | 3300012360 | Vadose Zone Soil | MKKKSAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVVALLFLVL |
Ga0137395_109680921 | 3300012917 | Vadose Zone Soil | MKKKQAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVVAL |
Ga0137395_110763881 | 3300012917 | Vadose Zone Soil | MKKKRAERRWTVMLVPHGSGSSRAVEVSQTVFKALVGIGSVLALL |
Ga0137395_111858732 | 3300012917 | Vadose Zone Soil | MRKPAERRWTVMVVPHGSGVSRAVELSQTVVKAVVGISSVLVVLVLVLGS |
Ga0137413_112047222 | 3300012924 | Vadose Zone Soil | MKKKSAERRWTVMLVPHGSGSSRAVEVSQTVVKALLGIGGVVA |
Ga0137416_102758221 | 3300012927 | Vadose Zone Soil | MKKKHAERRWTVMVVPHGSGASRAVEVSQTVLKALVGLGG |
Ga0137416_104927121 | 3300012927 | Vadose Zone Soil | MRKHAERRWTVMLVPHGSGASRAVELSQTVVKTLVGIGSV |
Ga0137416_112196671 | 3300012927 | Vadose Zone Soil | MKKKRTERRWTVMLVPHGSGSSRAVEVSQTVVKALV |
Ga0137416_119321841 | 3300012927 | Vadose Zone Soil | MKKKHAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSV |
Ga0134077_102715411 | 3300012972 | Grasslands Soil | LQKQAERRWTVMLVPHGSGASRAVEVSQTVLKFLVGFGSIFALLILV |
Ga0134077_104069282 | 3300012972 | Grasslands Soil | LQKQAERRWTVMLVPHGSGASRAVEVSQTVLKFLVGFGSIFALLILVLG |
Ga0134110_100027551 | 3300012975 | Grasslands Soil | MSKKTERRWTVMVVPHGSGASRAVEVSQTVVKALVGIGSVVSLAF |
Ga0134078_100020355 | 3300014157 | Grasslands Soil | MPKKAERRWTLMVVPHGSGSSRAVEVSQTFVKALVGIGSVVA |
Ga0137411_10872171 | 3300015052 | Vadose Zone Soil | MKKKRAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSIAWRCCF |
Ga0137411_11519451 | 3300015052 | Vadose Zone Soil | MKKKRAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSIVALLFL |
Ga0134073_101823081 | 3300015356 | Grasslands Soil | MSKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALLGIGSVLVLAFLVL |
Ga0134072_104086452 | 3300015357 | Grasslands Soil | MRKNAERRWTVMLVPHGAGASRGVEVSQTFVKGFFGIGGVVALRDG* |
Ga0134085_103933671 | 3300015359 | Grasslands Soil | LQKQAERRWTVMLVPHGSGASRAVEVSQTVLKFLVGFGSIFA |
Ga0134112_100455941 | 3300017656 | Grasslands Soil | MKKKQADRRWTVMLVPHGSGSSRAVEVSQTVFKALVGIGSVVALLFLVL |
Ga0134112_101581511 | 3300017656 | Grasslands Soil | MRRATERRWTVMLVPHGAGASRGVEVSQTFVKAVLGIGGVLALTFLVLGLAAVSR |
Ga0134083_100553702 | 3300017659 | Grasslands Soil | MKKKQADRRWTVMLVPHGSGSSRAVEVSQTVFKALVGIGSVVALLFLV |
Ga0187778_108366391 | 3300017961 | Tropical Peatland | MRTSAERKWTVMLVPHGSGASRAVEVSQTVIKALVGIG |
Ga0187776_107944751 | 3300017966 | Tropical Peatland | MRKRAERSWTVMLVPHGAGASRAVELSHTVVKTFVGIGSVVLLVIAVLG |
Ga0184639_103283331 | 3300018082 | Groundwater Sediment | MPPKSERRWTVMVVPHGSGTSRAVEVSQTVLKTLL |
Ga0179594_103881581 | 3300020170 | Vadose Zone Soil | MKKKSAERRWTVMLVPHGSGSSRAVEVSQTVVKALLGIGGVVALLFLVLGGT |
Ga0210382_100100864 | 3300021080 | Groundwater Sediment | MKKKRAERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSIVVLLFLVLGGTAL |
Ga0209619_100969611 | 3300025159 | Soil | MRNTAERRWTVMVVPHGSGASRAVEVSQTVVKGLVGIG |
Ga0207648_120542712 | 3300026089 | Miscanthus Rhizosphere | MKKKTAERKWTVMVVPHGSGSSRAVEVSQTVVKALIGIGGVVAPLFLVLG |
Ga0209234_12689701 | 3300026295 | Grasslands Soil | MKKKHAERRWTVMVVPHGSGASRAVEISQMVLKAL |
Ga0209027_12809731 | 3300026300 | Grasslands Soil | MRKKAERRWTVMVVPHGSGLSRAVEVSQTFLKTLVGIGSV |
Ga0209238_11490082 | 3300026301 | Grasslands Soil | MKKKHAERRWTVMVVPHGSGASRAVEVSQTVLKALIGLGGVIA |
Ga0209238_11637851 | 3300026301 | Grasslands Soil | MRKQAERRWTLMVVPHGSGSSRAVEVSQTFVKALVGI |
Ga0209468_11717431 | 3300026306 | Soil | MKKKQADRRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVVALLFLVLGGTA |
Ga0209154_11317732 | 3300026317 | Soil | MRHKAERKWTLMVVPHGSGASRAVELSQTVVKALVGFGSALALLFLVLGGAA |
Ga0209647_12393152 | 3300026319 | Grasslands Soil | MKKKHAVRKWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVVALLFLV |
Ga0209472_12065171 | 3300026323 | Soil | LMRGRGERMRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALIGIGSVVA |
Ga0209472_12681652 | 3300026323 | Soil | LMRGRGEQMRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALIGIGSVVA |
Ga0209152_100846082 | 3300026325 | Soil | MRKQAERRWTLMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALTF |
Ga0209804_11304721 | 3300026335 | Soil | MPKKAERRWTLMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALT |
Ga0209058_13521092 | 3300026536 | Soil | MRKKAERRWTLMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALTFLV |
Ga0209376_13929061 | 3300026540 | Soil | MSKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALLGIGS |
Ga0209106_11216611 | 3300027616 | Forest Soil | LRRGRGERMRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIGSA |
Ga0209488_107207431 | 3300027903 | Vadose Zone Soil | MRKHAERRWTVMLVPHGSGTSRAVEVSHTVMKAFMGIGGVIVLIVVVLGSAASCYPRMPC |
Ga0307495_100405312 | 3300031199 | Soil | MKKKQVERRWTVMLVPHGSGSSRAVEVSQTVVKALVGIGSVL |
Ga0307473_114978671 | 3300031820 | Hardwood Forest Soil | MRKKAERRWTVMVVPHGSGSSRAVEVSQTFVKALVGIGSVVALTFLVLG |
Ga0307471_1015728492 | 3300032180 | Hardwood Forest Soil | MKKKHAERRWTVMLVPHGSGASRAVEVSQTVVKALVGIGGVVALLF |
⦗Top⦘ |