NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058696

Metagenome / Metatranscriptome Family F058696

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058696
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 117 residues
Representative Sequence QDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKDDALSAAKEVLATHKGLSGGALDQYLGTFFDKAWKHFDVNLTGWIEVIKMPQFMRFLASDQWMSLKESG
Number of Associated Samples 90
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 15.27 %
% of genes near scaffold ends (potentially truncated) 62.69 %
% of genes from short scaffolds (< 2000 bps) 97.76 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.72

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.761 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(61.194 % of family members)
Environment Ontology (ENVO) Unclassified
(80.597 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.299 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.68%    β-sheet: 13.48%    Coil/Unstructured: 41.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.72
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.39.1.11: p25-alphad1wlma11wlm0.53935
c.56.5.4: Bacterial dinuclear zinc exopeptidasesd1r3na11r3n0.52485
a.39.1.7: EF-hand modules in multidomain proteinsd1tuza_1tuz0.51484
a.39.1.9: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)d1ij5a_1ij50.5145
a.39.1.2: S100 proteinsd1a4pa_1a4p0.5144


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.76 %
UnclassifiedrootN/A2.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300007957|Ga0105742_1038076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300007957|Ga0105742_1041295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300008832|Ga0103951_10629805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium584Open in IMG/M
3300008931|Ga0103734_1068678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300008938|Ga0103741_1114123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium548Open in IMG/M
3300009022|Ga0103706_10126092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium613Open in IMG/M
3300009028|Ga0103708_100128928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300009028|Ga0103708_100267515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300009263|Ga0103872_1081790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300009512|Ga0115003_10341079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium884Open in IMG/M
3300009732|Ga0123373_137743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium749Open in IMG/M
3300010299|Ga0129342_1217373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300010985|Ga0138326_10567272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300010987|Ga0138324_10377482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300012394|Ga0123365_1320417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300012504|Ga0129347_1234257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300012523|Ga0129350_1115952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium848Open in IMG/M
3300012967|Ga0129343_1390712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300017772|Ga0181430_1154471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium666Open in IMG/M
3300017782|Ga0181380_1184704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300018649|Ga0192969_1027262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium912Open in IMG/M
3300018684|Ga0192983_1026328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium790Open in IMG/M
3300018692|Ga0192944_1022432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium894Open in IMG/M
3300018692|Ga0192944_1062421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300018742|Ga0193138_1020547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium853Open in IMG/M
3300018742|Ga0193138_1020553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium853Open in IMG/M
3300018742|Ga0193138_1039883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300018763|Ga0192827_1082012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300018763|Ga0192827_1092775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300018765|Ga0193031_1027648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium877Open in IMG/M
3300018765|Ga0193031_1045971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium720Open in IMG/M
3300018765|Ga0193031_1059789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium641Open in IMG/M
3300018765|Ga0193031_1083362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300018766|Ga0193181_1071604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300018791|Ga0192950_1047661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300018800|Ga0193306_1029609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium857Open in IMG/M
3300018823|Ga0193053_1067806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300018832|Ga0194240_1005681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum882Open in IMG/M
3300018832|Ga0194240_1020654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300018832|Ga0194240_1027424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300018838|Ga0193302_1061344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300018846|Ga0193253_1068053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium870Open in IMG/M
3300018846|Ga0193253_1068717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium865Open in IMG/M
3300018846|Ga0193253_1072906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium834Open in IMG/M
3300018853|Ga0192958_1148953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300018860|Ga0193192_1058567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300018860|Ga0193192_1061211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300018861|Ga0193072_1087813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300018870|Ga0193533_1092381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300018932|Ga0192820_10114458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300018967|Ga0193178_10063315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300018967|Ga0193178_10078527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300018968|Ga0192894_10135610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium781Open in IMG/M
3300018980|Ga0192961_10093931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300018982|Ga0192947_10271435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300018989|Ga0193030_10099902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium890Open in IMG/M
3300018989|Ga0193030_10107248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium866Open in IMG/M
3300018989|Ga0193030_10146228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium762Open in IMG/M
3300018989|Ga0193030_10146241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium762Open in IMG/M
3300018989|Ga0193030_10161572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium729Open in IMG/M
3300018989|Ga0193030_10177007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum698Open in IMG/M
3300018989|Ga0193030_10291846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300018989|Ga0193030_10297293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300018989|Ga0193030_10303524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300018989|Ga0193030_10308843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300018997|Ga0193257_10236763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300019001|Ga0193034_10149013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300019001|Ga0193034_10174990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300019003|Ga0193033_10224959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300019022|Ga0192951_10361837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300019024|Ga0193535_10277898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300019025|Ga0193545_10063507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium769Open in IMG/M
3300019032|Ga0192869_10423479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300019036|Ga0192945_10158986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300019036|Ga0192945_10194661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300019036|Ga0192945_10240375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300019039|Ga0193123_10373469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300019045|Ga0193336_10124109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium913Open in IMG/M
3300019045|Ga0193336_10201280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300019045|Ga0193336_10552254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300019045|Ga0193336_10570938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300019050|Ga0192966_10110512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium952Open in IMG/M
3300019051|Ga0192826_10149320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium859Open in IMG/M
3300019051|Ga0192826_10259985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300019051|Ga0192826_10261579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300019051|Ga0192826_10262691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300019051|Ga0192826_10387785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300019095|Ga0188866_1031433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300019103|Ga0192946_1056376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300019111|Ga0193541_1069766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300019111|Ga0193541_1073354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300019118|Ga0193157_1025361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300019118|Ga0193157_1028208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300019129|Ga0193436_1056475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300019129|Ga0193436_1059940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300019129|Ga0193436_1068362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300019129|Ga0193436_1073587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300019150|Ga0194244_10036338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium752Open in IMG/M
3300019150|Ga0194244_10063077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300019150|Ga0194244_10103275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300019150|Ga0194244_10122839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium507Open in IMG/M
3300021169|Ga0206687_1132333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium804Open in IMG/M
3300021353|Ga0206693_1322417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300021872|Ga0063132_100124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium826Open in IMG/M
3300023679|Ga0232113_1040542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300024329|Ga0228631_1146120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300025897|Ga0209425_10565475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300026403|Ga0247557_1045382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300026443|Ga0247559_1124747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium523Open in IMG/M
3300026468|Ga0247603_1101156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300028102|Ga0247586_1108506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300028110|Ga0247584_1176831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300028137|Ga0256412_1238139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300028282|Ga0256413_1326222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300028282|Ga0256413_1359871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300028290|Ga0247572_1106689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300028290|Ga0247572_1181071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300028334|Ga0247597_1056624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300030671|Ga0307403_10719075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300030699|Ga0307398_10602224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300030709|Ga0307400_10933782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300030856|Ga0073990_11978073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300031004|Ga0073984_11221052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300031597|Ga0302116_1239691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300031602|Ga0307993_1059666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium960Open in IMG/M
3300031710|Ga0307386_10772829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300031725|Ga0307381_10407289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300031734|Ga0307397_10547197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300031750|Ga0307389_10945230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300032517|Ga0314688_10541522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300032820|Ga0310342_102088427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine61.19%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.94%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater11.19%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.24%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.24%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.49%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.49%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.49%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.49%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.49%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.75%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.75%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.75%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.75%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012394Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300018618Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000071 (ERX1782354-ERR1712005)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031597Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCMEnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0105742_103807623300007957Estuary WaterASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0105742_104129513300007957Estuary WaterTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0103951_1062980513300008832MarineERVITPRFSQDTDDLFMRSMITTYAHEEKSEIKEHDDGTKSGGEPTGRFWMNKEDAMSAAREVLATHKSLTGATLDQYLATFFNKAWGHFDVNQSGWIEVIKMPQFCRFLASDQWVSLGESG*
Ga0103734_106867813300008931Ice Edge, Mcmurdo Sound, AntarcticaIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0103741_111412313300008938Ice Edge, Mcmurdo Sound, AntarcticaQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG*
Ga0103706_1012609213300009022Ocean WaterMIKTYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLNTHKGLSGGALDQYLATFFEKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESGRRL*
Ga0103708_10012892813300009028Ocean WaterLTIRPFDECIQVWPSAKGPKVVEHDDGTKSGGEPSGKFWMNQAAALAAAKEVLGTHKGLAGGALDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0103708_10026751513300009028Ocean WaterDKSTVYERVITPRFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLNTHKGLSGGALDQYLATFFEKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESGRRL*
Ga0103872_108179013300009263Surface Ocean WaterAPEEKTEIKEHDDGTKTGGEPTGRFWMNKEDAMSAAREVLNTHKQLNGGALDQYLSTFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWVSLGESG*
Ga0115003_1034107913300009512MarineIEQYALEEKTKVVEHDDGTKTGGEPSGKFWMNKQGAFAASSEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGMIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0123373_13774313300009732MarineVGLDKSTLYERVITPRFSQDTDDLFMRSMIATYAHEEKSEIKEHDDGTKTGGEPTGRFWMNKEDAMSAAREVLNTHKQLNGGALDQYLSTFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWVSLGESG*
Ga0129342_121737313300010299Freshwater To Marine Saline GradientRFDTFPVGLDKSTLYERVITPRFSQDTDDLFMRSMIATYAHEEKSEIKEHDDGTKTGGEPTGRFWMNKEDAMSAAREVLNTHKQLNGGALDQYLSTFFDKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWVSLGESG*
Ga0138326_1056727213300010985MarineRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGRFWMNKEDAMSAAKEVLGTHKGLAGGALDGYLATFFNKSWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0138324_1037748233300010987MarineMRSMITTYAHEEKSEIVEHDNGTKTGGEPTGRFWMNKEDAMSAAKEVLGTHKGLAGGALDGYLATFFNKSWGHFDVNQTGWIEVIKMPQFMRFLASDQWMSLKESG*
Ga0123365_132041713300012394MarineARFDTFPVGLDKSTLYERVITPRFSQDTDDLFMRSMIATYAHEEKSEIKEHDDGTKTGGEPTGRFWMNKEDAMSAAREVLNTHKQLNGGALDQYLSTFFNKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0129347_123425713300012504AqueousYERVITPRFSQDTDDLFMRSMIATYAHEEKSEIKEHDDGTKTGGEPTGRFWMNKEDAMSAAREVLNTHKQLNGGALDQYLSTFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWVSLGESG*
Ga0129350_111595223300012523AqueousMIATYAHEEKTPVVEHDDGSKTGGEPSGRFWMNKDDAMSAAKEVLGTHKGLSGGALDSYLATFFNKSWGHFDVNQTGWIEVIKMPQFMRFLASDQWMSLKESG*
Ga0129343_139071213300012967AqueousITPRFSQDTDDLFMRSMIATYAHEEKSEIKEHDDGTKTGGEPTGRFWMNKEDAMSAAREVLNTHKQLNGGALDQYLSTFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWVSLGESG*
Ga0181430_115447113300017772SeawaterRFASDSDDIFMRSMIEQYALEEKTKVVEHEDGTKTGGEPSGKFWMNKQAAFAAANEVLNTHKGLSGAALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFICSDQYMSLGESG
Ga0181380_118470423300017782SeawaterEATYYERVTTPRFSADTDDIFMRSMIEQYALEEKSKVVEHDDGTKTGGEPTGKFWMDFNTSKAAASEVLGTHKGLHGAALQTYLDTYYEKAWKHFDVNQSGTIEVLKMP
Ga0193204_101587613300018618MarineEKTKVVKHDDGTTSGGEPSGKFWMNEAAALAASKEVLGTHKGLSGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG
Ga0192969_102726213300018649MarineLDKSTVYERVVTPRFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGSKSGGEPTGNFWMSKADAMSASNEVLATHKGLGGGSLDQYLGTFFDKAWKHFDVNQNGWIEVTKMPQFMRFLASDQWMSLKESG
Ga0192983_102632813300018684MarineMRSMIKTYAHEEKSKVVEHDDGSKSGGEPTGNFWMSKADAMSASNEVLATHKGLGGGSLDQYLGTFFDKAWKHFDVNQNGWIEVTKMPQFMRFLASDQWMSLKESG
Ga0192944_102243213300018692MarineLDKSTVYERVITPRFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGSKSGGEPTGNFWMSKEDAMSAANEVLATHKGLGGGSLDQYLGTFFDKAWKHFDVNLNGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0192944_106242113300018692MarineSMIATYAHEEKSEVVEHDNGTKSGGEPTGRFWMNKDDSLNAAKEVLATHKGLTGDALNQYIATFFEKAWGHFDVNQSGWIEVLKMPQFCRFLASDQWMSLKESG
Ga0193138_102054713300018742MarineMRSMIATYAHEEKTEVVKHDDGSTTGGEPSGRFWMNKDDATAAAREVLATHKGLTGEGLDSYLATFFNKSWGHFDVNQTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193138_102055313300018742MarineLRFDAFPVGLDKSTVYERVITPMFSQDSDDIFMRSMISTYAHEEKSKVVEHDDGTKSGGEPTGKFWMNEADALSAAKEVLGTHKGLSGGALDQYLATFFAKAWGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG
Ga0193138_103988313300018742MarineMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGAALDQYIATFFDKSWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192827_108201213300018763MarineDAFPVGLDKSTLYERVITPRFSADTDDIFMRSMIATYAHEEKSEIVEHDDGTKTGGEPTGRFWMNKDDATLAAREVLGTHKGLQGDALDKYLATFFDKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192827_109277513300018763MarineMRSMIATYAHEEKSEVKEHDDGTKTGGEPTGRFWMNKDDAMAAAKEVLNTHKGLGGAGLDGYLATFFNKAWGHFDVNQTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193031_102764813300018765MarineVITPQFSGDNDDLFMRSMIATYAHEEKSEVVEHDNGTKSGGEPTGRFWMNKDDAMLASKEVLGTHKGLSGEALDKYLATFFDKSWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193031_104597123300018765MarineMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGAALDQYIATFFDKSWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193031_105978913300018765MarineMRSMIAQYAHEEKSEVVEHDNGSKSGGEPTGKFWMNKDDAVLAAREVLSTHKGLNGAALDQYLVTFLEKSWGHFDVNQTGWIEVIKMPQFMRFLASDQYMSLRESG
Ga0193031_108336223300018765MarineEGNYERVTTPHFSADSDDIFMRSMITTYAVEARTDTVTHDDGTKSGGEPTGKFLMTKSGTLAAAKEVLGTHKGLAGGALSAYLDTYFDKAWGHFDVNQTGMVEVIKMPQLMRFLASDQSLSLGESG
Ga0193181_107160413300018766MarineDIFMRSMIEQYALEERTKITEHDDGLKTGGEPSGKFWMNKSSTTAAAREVLGTHKGLSGQLLDDYMATYFDKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192950_104766113300018791MarineVTTPRFASDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193306_102960923300018800MarineMIKTYAHEEKSKVEEHDDGTKSGGEPTGRFWMSKEDAMQAAQEVLGTHKGLSGSALDQYLGTFFDKTWKHFDVNLTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193053_106780613300018823MarineFDTFPVGLDKSTVYERVITPMFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAQEVLATHKGLSGGSLDQYLGTFFDKAWKHFDVNLTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0194240_100568123300018832MarineMRFDAFPVGLDKSTVYERVITPRFSQDSDDIFMRSMIATYAHEEKSKVVEHDDGTKTGGEPTGRFWMNEADALAAAKEVLGTHKGLSGGALDQYLATFFAKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0194240_102065413300018832MarineHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGAALDQYIATFFDKAWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0194240_102742413300018832MarineMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLAGGALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193302_106134413300018838MarineMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLAGGALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193253_106805313300018846MarineMRSMIKTYAHEEKSKVVEHDNGTKSGGEPTGKFWMNHNDAMLAAQEVLATHKGLSGDALGQYLGTFFDKAWGHFDVNKSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193253_106871713300018846MarineMFSKDTDDLFMRSMIATYAHEEKSPVVDQPDGSKTGGEPIGKFWMNKEDATSAAKEVLQTHKGLTGAALDQYLNTFFEKSWGHFDVNKSGWIEVIKMPQFCRFLASD
Ga0193253_107290623300018846MarineVQAKAEIQFDTFPVSYHGAHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGAFWMNKDDAMLAAKEVLSTHKGLSGAALDQYVATFFDKSWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192958_114895313300018853MarineHGDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVEEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193192_105856713300018860MarineQDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKDDALSAAKEVLATHKGLSGGALDQYLGTFFDKAWKHFDVNLTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193192_106121113300018860MarineSMIEQYALEERTQVTEHDDGTKSGGEPSGKFWMNSAAALAAAKEVLQTHKGLSGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193072_108781313300018861MarineEDEEVQSQADVRFETFPVGLDKSTVYERVVTPRFSQDTDDIFMRSMIKTYAHEEASKVVEHDDGTKTGGEPTGNFWMSKDDAMTAAKEVLSTHKGLSGGALDSYLGTFFDKAWKHFDVNLTGWVEVIKMPQFMRFLASDQWMSLKESG
Ga0193533_109238113300018870MarineMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGAALDQYIATFFDKSWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192820_1011445813300018932MarineMGFPVGLDKSTVYERVITPMFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKDDALSAAKEVLATHKGLSGGALDQYLGTFFDKAWKHFDVNLTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193178_1006331513300018967MarineITPMFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKDDALSAAKEVLATHKGLSGGALDQYLGTFFDKAWKHFDVNLTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193178_1007852713300018967MarineDDIFMRSMITTYAHEEKSEVVEHDDGTKTGGEPTGRFWMNKDDATLAAREVLGTHKGLQGDALDKYLATFFDKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192894_1013561023300018968MarineMRSMITTYAHEEKSEIVEHDNGTKTGGEPTGRFWMNKDDTTAAAREVLDTHKGLSGAALDQYMATFFEKAWGHFDVNKTGWIEVIKTPQFMRFLASDQWMSLKESG
Ga0192961_1009393113300018980MarineLDKSTVYERVITPRFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKSGGEPTGNFWMSKEDAMSAANEVLATHKGLGGGSLDQYLGTFFDKAWKHFDVNLNGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0192947_1027143513300018982MarineERVITPRFSADTDDLFMRSMITTYAHEEKSEIVEHDDKTKTGGEPTGRFWMNKEDAMSAAKEVLDTHKGMAGGALDQYLATFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193030_1009990213300018989MarineMRSMIKTYAHEEKSKVVEHDNGTKSGGEPTGKFWMNHADAMLAAQEVLATHKGLSGDALGQYLGTFFDKAWGHFDVNKSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193030_1010724813300018989MarineMRFDTFPVGLDKSTLYERVITPRFSADTDDLFMRSMIETYAHEEKSEVVEHDNGTKTGGEPTGRFWMNKDDAMLAAKEVLGTHKGLGGEALDKYLATFFDKSWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193030_1014622813300018989MarineMRSMIEQYAHEEKSKVVEHDDGTKTGGEPTGNFWMNKDDATSAAREVLATHKGLTGEALDKYLATFFEKAWGHFDVNQTGFIEVIKMPQFCRFLGSDQWMSLKESG
Ga0193030_1014624123300018989MarineMRSMIEQYAHEEKSKVVEHDDGTKTGGEPTGNFWMNKDDATAAAREVLATHKGLTGDALDKYIATFFEKAWGHFDVNQTGFIEVIKMPQFCRFLGSDQWMSLKESG
Ga0193030_1016157213300018989MarineMRSMIATYAHEEKSPVVEHDDGTKSGGEPSGKFWMNKEDAMNAAKEVLGTHKGLAGGALDSYLATFFNKTWGHFDVNQTGWLEVIKMPQFMRFLASDQWMSLKESG
Ga0193030_1017700723300018989MarineMRSMIANYAHEEKSDVVEHDNGTKSGGEPTGHFWMSKDDALLAAKEVLNTHKGLSGGALDNYLATFFDKSWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193030_1029184613300018989MarineRFSQDTDDLFMRSMIATYAHEEKSEVKEHDDGTKTGGEPTGRFWMNKEDATSAAKEVLGTHKGLGGAGLDQYLATFFDKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193030_1029729313300018989MarineDKSQFYERVLPARFSQDTDDIFMRSMIAQYAHEEKSEVVEHDNGTKSGGEPTGKFWMNKNDAVSAAREVLNTHKGLAGDALNQYLVTFFEKAWGHFDVNQTGWIEVIKMPQFCRFLASDQYMSLKESG
Ga0193030_1030352413300018989MarineDTDDLFMRSMITTYAHEEKSEVVEHDDGTKTGGEPTGKFWMNKDDAMSAAKEVLDTHKGMNGGALDQYLATFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193030_1030884313300018989MarineIFMRSMIKTYAHEEKSKVVEHDDGSKTGGEPTGKFWMNKNDAMSAAQEVLATHKGLSGDGLGQYLGTFFDKAWGHFDVNRTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193257_1023676313300018997MarineESDDEDVQTQFDTIPVGYDGAHFYERKVTARFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193034_1014901313300019001MarineHGLYERVITPRFSQDTDDIFMRSMLEQYAHEEKSKIVEHDDGTKTGGEPTGRFWMNKDDATAAAKEVLGTHKGLGGEALDKYLATFFEKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193034_1017499013300019001MarineSDVRFDTFPVGLDKSQVYNRVLPDHFSHDTDDIFMRSMIATYAHEEKSPVVGHDDGSKSGGEPSGKFWMNKDDATSAAKEVLSTHKGLNGAALDQYLATFFNKAWGHFDVNQTGWIEVTKMPQFCRFLASDQWMSLKESG
Ga0193033_1022495913300019003MarineTDDIFMRSMIEQYALEERTKVVEHDNGLKSGGEPSGKFWMNHATTMAAAKEVLGTHKGLAGDLLSQYMDTYFEKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG
Ga0192951_1036183713300019022MarineMGDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0193535_1027789813300019024MarineTDDIFMRSMIKTYAHEEKSKVVEHDNGTKSGGEPTGKFWMNHADAMLAAQEVLATHKGLSGDALGQYLGTFFDKAWGHFDVNKSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193545_1006350723300019025MarineMFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDATSAAQEVLATHKGLSGGALDQYLGTFFDKAWKHFDVNLTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0192869_1042347913300019032MarineMGDKSTLYERVITPRFSADTDDLFMRSMITTYAHEEKSEVKEHDDGTKTGGEPTGKFWMSKDDGMSAAREVLDTHKGMTGGALDQYLATFFNKAWGHFDVNQTGWVEVIKMPQFMRFLASDQWMSLKESG
Ga0192945_1015898613300019036MarineLDQSQVYERVVTPRFSADTDDLFMRSMIATYAHEEKSDVVKHDDGSTSGGEPTGKFWMSKADATSAAQEVLNTHKGLSGAGLDSYLATFFGKAWGHFDVNQTGWIEVIKMPQFMRFLASDQYMSLKESG
Ga0192945_1019466113300019036MarineVITPRFSADTDDLFMRSMITTYAHEEKSEIVEHDDKTKTGGEPTGRFWMNKEDAMSAAKEVLDTHKGMAGGALDQYLATFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0192945_1024037513300019036MarineSDSDSGDEDMQTTADARFDVFPIGLDKSTVYERVITPRFSADTDDLFMRSMISSYAHEEKSDVVKHDDGSSSGGEPTGRFWMNKEDAMSAAKEVLGTHKGLTGAGLDSYLGTFFTKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193123_1037346913300019039MarineYERVITPRFSADTDDIFMRSMIATYAHEEKSEVKEHDDGTKTGGEPTGRFWMNKDDATLAAKEVLGTHKGLAGAALDQYLATFFDKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193336_1012410913300019045MarineMRSMITTYAHEEKSEIVEHDNGTKTGGEPTGRFWMNKDDTTAAAREVLNTHKGLGGAALDQYMATFFEKAWAHFDVNKTGWIEVIKTPQFMRFLASDQWMSLKESG
Ga0193336_1020128013300019045MarineMRFDASPGLDKSTVYERVITPRFSQDSDDIFMRSMIATYAHEEKSKVVEHDDGTKTGGEPTGRFWMNEADALAAAKEVLGTHKGLSGGALDQYLATFFAKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193336_1055225413300019045MarineDVQTKFDTFPIGLDGSQFYERKVTERFSQDTDDIFMRSMIATYAHEEKSEVVEHDNGTKSGGEPTGKFWMNQGDALLAAKEVLATHKGLTGAALDQYINTFFAKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193336_1057093813300019045MarineMRSMITTYAHEEKSEVKEHDDGTKTGGEPTGKFWMSKDDAMSAAREVLDTHKGMTGGALDQYLATFFNKAWGHFDVNQTGWVEVIKMPQFMRFLASDQWMSLKESG
Ga0192966_1011051213300019050MarineMIKTYAHEEKSKVVEHDDGSKSGGEPTGNFWMSKADAMSASNEVLATHKGLGGGSLDQYLGTFFDKAWKHFDVNQNGWIEVTKMPQFMRFLASDQWMSLKESGXAISNNFNAQGXAFVNLMACIS
Ga0192826_1014932013300019051MarineMIATYAHEEKSEVKEHDDGTKTGGEPTGRFWMNKDDAMAAAKEVLNTHKGLGGAGLDGYLATFFNKAWGHFDVNQTGWIEVIKMPQFMRFLASDQWMSLKESGXAFPYPRNSQLEEVANS
Ga0192826_1025998513300019051MarineDSGEDEDIQTNTDARFDTFPVGLDKSTVYERVITPQFSQDTDDIFMRSMITTYAHEEKSEVKEHDDGTKTGGEPTGRFWMSREDTEAAAREVLNTHKGLAGAALDQYLATFFSKAWGHFDVNQTGWIEVIKTPQFMRFLASDQWMSLKESG
Ga0192826_1026157913300019051MarineRVIPERFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLNEYKGLAGAALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKES
Ga0192826_1026269113300019051MarineFMRSMIEQYALEEKTKVVEHDDGTTTGGEPTGKFWMDKFSALGAAREVLNTHKGLSGAALKAYLDTYFDKAWGHFDVNQTGTIEVIKMPGLMRFLCSDQYTQLGESG
Ga0192826_1038778513300019051MarineLDKSTVYERVITPMFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKDDALSAAKEVLATHKGLSGGALDQYLGTFFDKAWKHFDVNLTGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0188866_103143313300019095Freshwater LakeFPIGMDKSIVYERVITPRFSQDTDDLFMRSMIANYAHEEKSEIKEHDDGTKSGGEPTGRFWMNKEDAMSAAREVLNTHKSLTGATLDQYLQTFFNKSWGHFDVNQSGWIEVIKMPQFMRFLASDQWVSLGESG
Ga0192946_105637613300019103MarineEDLQTKFDTFPIGLDKSQFYERQLPERFSQDTDDIFMRSMIAQYAHEEKSEVKEHDNGTKSGGEPTGKFWMNQGDALLAAKEVLATHKGLTGTALEQYLTTFFAKSWGHFDVNQTGWIEVIKMPQFCRFLASDQYMSLKESG
Ga0193541_106976613300019111MarineEEVQSQADVRFETFPVGLDKSTVYERVVTPRFSQDTDDIFMRSMIKTYAHEEASKVVEHDDGTKTGGEPTGNFWMSKDDAMTAAKEVLSTHKGLSGGALDSYLGTFFDKAWKHFDVNLTGWVEVIKMPQFMRFLASDQWMSLKESG
Ga0193541_107335413300019111MarineESSDSEDEDVQTQFDTFPVGYDGSHFYERVVPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGAALDQYIATFFDKSWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193157_102536113300019118MarineSDSGDDEDVQAGTDVRFDTFPVGLDKSTLYERVITPRFSADTDDIFMRSMIATYAHEEKSEVVEHDNGTKTGGEPTGKFWMSKDDATLAAREVLGTHKGLGGDALDKYLGTFFEKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193157_102820813300019118MarineMRSMLEQYAHEEKSEIVEHDDKTKTGGEPTGRFWMNKDDATLAAKEVLGTHKGLTGDALDKYMATFFDKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193436_105647513300019129MarineLDKSTVYERVITPMFSQDSDDIFMRSMIATYAHEEKSKVVEHDDGTKTGGEPTGKFWMNEADALSAAKEVLGTHKGLSGGALDQYLATFFAKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193436_105994013300019129MarinePVGLDKSTVYERVITPRFSQDSDDIFMRSMIAAYAHEEKSKVVEHDDGTKTGGEPTGRFWMNEADALAAAKEVLGTHKGLSGGALDQYLATFFAKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193436_106836213300019129MarineDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLVGAGLDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193436_107358713300019129MarineRSMIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLEDYVATYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0194244_1003633823300019150MarineMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGAALDQYIATFFDKAWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0194244_1006307713300019150MarineIEQYALEERTKVVEHADGLKTGGEPSGKFWMNQASALAASKEVLATHKGLSGKMLDDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0194244_1010327513300019150MarineFPVGLDKSTLYERVITPRFSADTDDLFMRSMITTYAHEEKSEIVEHDDKTKTGGEPTGRFWMNKEDAMSAAKEVLDTHKGMTGGALDQYLATFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0194244_1012283913300019150MarineFPVDADKSQFYERVLPARFSQDTDDIFMRSMIAQYAHEEKSEVVEHDNGTKSGGEPTGKFWMNKNDAVLAAREVLNTHKGLAGDALNQYLATFFEKAWGHFDVNQTGWIEVIKMPQFCRFLASDQYMSLKESG
Ga0206687_113233323300021169SeawaterMIKTYAHEEKSKVVEHDNGTKSGGEPTGKFWMNHADAMLAAQEVLATHKGLSGDALGQYLGTFFDKAWGHFDVNKSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0206693_132241713300021353SeawaterERATPARFAADTDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKAGARAAAAEVLGTHKGLSGGALEAYLNTYFDKSWGHFDVNVTGTIEVIKMPQLMRFLCSDQYMQLGEPG
Ga0063132_10012413300021872MarineLRFDAFPVGLDKSTVYERVITPMFSQDTDDIFMRSMIATYAHEEKSKVVEHDDGTKSGGEPTGKFWMNEADALSAAKEVLGTHKGLSGGALDQYLATFFAKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0232113_104054213300023679SeawaterTYAHEEKSKVVEHDNGTKSGGEPTGKFWMNHADAMLAAQEVLATHKGLSGDALGQYLGTFFDKAWGHFDVNKSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0228631_114612013300024329SeawaterVTTPRFSADTDDIFMRSMIEQYALEERTKVVEHDDGLKTGGEPSGKFWMNEASAASAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0209425_1056547513300025897Pelagic MarinePDGSKTGGEPIGKFWMNKEDATSAAKEVLSTHKGLTGAALDQYLNTFFEKSWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0247557_104538213300026403SeawaterDDIFMRSMIENYALEEKTKVVEHDDGTKSGGDPSGKFWMNEAAALAASKEVLGTHKGLAGGMLDAYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGDSG
Ga0247559_112474713300026443SeawaterFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGRFWMNKDDAMLAAKEVLSTHKGLSGNALDQYVATFFDKSWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0247594_110117313300026448SeawaterKTPVVKLDNGLSTGGEPSGKFWMNEAAANAAAKEVLGTHKGLSGDALAAYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0247603_110115613300026468SeawaterGYDGSHYYERQITPMFSKDTDDLFMRSMIATYAHEEKSPVVDQPDGSKTGGEPIGKFWMNKEDATSAAREVLETHKGLTGAALDQYLNTFFEKSWGHFDVNKSGWIEVTKMPQFCRFLAS
Ga0247586_110850613300028102SeawaterQDTDDIFMRSMIKTYAHEEKSKVVEHDNGTKSGGEPTGKFWMNHADAMLAAQEVLATHKGLSGDALGQYLGTFFDKAWGHFDVNKSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0247582_117025613300028109SeawaterVIEHDDGLKTGGEPSGKFWMNQASAMAAAKEVLTTHKGLTGKQLEDYVATYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0247584_117683113300028110SeawaterSMIKTYAHEEKSKVVEHDNGTKSGGEPTGKFWMNHADAMLAAQEVLATHKGLSGDALGQYLGTFFDKAWGHFDVNKSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0256412_123813913300028137SeawaterMIKTYAHEEKSKVTEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGGALDQYIATFFDKTWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0256413_132622213300028282SeawaterPRFSSDSDDIFMRSMIENYALEEKTKVVEHDDGTKSGGDPSGKFWMNEAAALAASKEVLGTHKGLAGGMLDAYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMQLGESG
Ga0256413_135987113300028282SeawaterQITPMFSKDTDDLFMRSMIATYAHEEKSPVVDQPDGSKTGGEPIGKFWMNKEDATSAAREVLETHKGLTGAALDQYLNTFFEKSWGHFDVNKSGWIEVTKMPQFCRFLASD
Ga0247572_110668913300028290SeawaterLEERTKVVEHDDGLKTGGEPSGKFWMNEASAAAAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247572_118107113300028290SeawaterDDLFMRSMIATYAHEEKSPVVDQPDGSKTGGEPIGKFWMNKEDATSAAREVLETHKGLTGAALDQYLNTFFEKSWGHFDVNKSGWIEVTKMPQFCRFLASD
Ga0247597_105662413300028334SeawaterITPMFSQDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGRFWMNKDDAMLAAKEVLSTHKGLSGNALDQYVATFFDKSWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0307403_1071907513300030671MarineDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0307398_1060222413300030699MarineKVVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307400_1093378213300030709MarineDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0073990_1197807323300030856MarineMRSMIKTYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGAALDQYIATFFDKAWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0073984_1122105213300031004MarineDLQTASDARFDAFPVGLDKSTLYERVITPRFSQDTDDLFMRSMIEQYAHEEKSEIVEHDNGTKTGGEPTGRFWMNKDDATLAAKEVLNTHKGLGGEALDKYLATFFDKAWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0302116_123969113300031597MarineMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307993_105966613300031602MarineMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307386_1077282913300031710MarineHYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEHDDGTKTGGEPTGKFWMNGATAKAAASEVLGTHKGLHGQALQTYLDTYYEKAWRHFDVNQSGSIEVIKMP
Ga0307381_1040728913300031725MarineMIEQYALEEKTKIVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0307397_1054719713300031734MarineSDSDDIFMRSMIEQYALEEKTKVVEHDDGTKSGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0307389_1094523013300031750MarineYYERVTTPRFSQDGDDIFMRSMIEQYALEEKTKVVEKDDGTKTGGEPTGKFWMNKATANAASSEVLGTHKGLHGAALQTYLDTYYEKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG
Ga0314688_1054152223300032517SeawaterMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG
Ga0310342_10208842713300032820SeawaterALEERNKVIEHDNGLKSGGEPNGKFWMNKSGTLAAAKEVLGTHKGLSGKLLDDYVNTYFDKAWGHFDVNQTGFVEVIKMPQLMRFLASDQYISLGE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.